0 42325 0 00 274 42325 000 65 42599 0000001 20 42664 000001 12 42684 00001 16 42696 00002 6 42712 00003 44 42718 00004 33 42762 00005 29 42795 00006 30 42824 00007 28 42854 00009 6 42882 0001 42 42888 00010101 15 42930 00010101000000 12 42945 00012 6 42957 00013 6 42963 00014 6 42969 00015 6 42975 00016 6 42981 001 15 42987 00145e3710ab 5 43002 002 12 43007 003 11 43019 004 6 43030 00z 8 43036 01 265 43044 02 88 43309 03 198 43397 034983 10 43595 04 14 43605 05 21 43619 050 6 43640 05dbe824 5 43646 06 22 43651 07 21 43673 08 19 43694 09 19 43713 0b 5 43732 0b00000000001111000000000000000000 6 43737 0b0011001 5 43743 0b101001111 5 43748 0e96a3a7f353 4 43753 0x 5 43757 0x003a 5 43762 0xabcde 6 43767 0E003a 5 43773 1 32945 43778 10 3151 76723 100 229 79874 1000 197 80103 10000 20 80300 100000 26 80320 1005 8 80346 101 6 80354 1024 70 80360 104 19 80430 1047 112 80449 108 17 80561 10pt 5 80578 10x11 9 80583 10x14 9 80592 11 1195 80601 110 19 81796 11025 4 81815 1103 5 81819 111 15 81824 112 7 81839 1129 136 81846 1130 136 81982 1132 136 82118 1133 136 82254 1137 136 82390 114 7 82526 1140 112 82533 1142 112 82645 1143 112 82757 1144 112 82869 1145 112 82981 1146 112 83093 1147 112 83205 1148 112 83317 1149 112 83429 115 6 83541 1153 162 83547 1154 136 83709 1155 136 83845 1156 136 83981 1157 136 84117 1158 136 84253 1160 136 84389 1162 136 84525 1164 136 84661 11dd 5 84797 11x17 9 84802 12 1559 84811 120 15 86370 1200 5 86385 123 40 86390 12345 8 86430 123456 9 86438 123456000000 5 86447 1234656000000 4 86452 1250 376 86456 1251 361 86832 1252 377 87193 1253 378 87570 1254 378 87948 1255 379 88326 1256 379 88705 1257 379 89084 1258 379 89463 126 8 89842 127 28 89850 12712 112 89878 128 28 89990 128000 8 90018 12x11 11 90026 13 1775 90037 130 4 91812 13383 4 91816 134 13 91820 1363 112 91833 1364 136 91945 1371 136 92081 13749 5 92217 1388 136 92222 1390 136 92358 1399 136 92494 14 4355 92630 1415926535897932 42 96985 1415926535897936 7 97027 143 8 97034 14E14 30 97042 15 2972 97072 150 9 100044 151 6 100053 1538 10 100059 1540 24 100069 1541 17 100093 1545 5 100110 1562 5 100115 158 8 100120 15t00 4 100128 15t06 4 100132 15t10 13 100136 15x11 9 100149 16 2518 100158 1601 18 102676 16384 6 102694 1641 6 102700 165 4 102706 166 6 102710 16684 136 102716 16804 112 102852 16be 317 102964 16k 19 103281 16le 317 103300 16x16 4 103617 16E16 22 103621 17 1952 103643 1753 4 105595 18 3836 105599 1832 6 109435 185 4 109441 19 817 109445 19005 12 110262 192 8 110274 1950 5 110282 197 4 110287 1970 5 110291 19800802 5 110296 1984 6 110301 19840326062421 6 110307 1995 164 110313 1997 320 110477 1998 112 110797 1999 138 110909 1c 2029 111047 1cv8 51 113076 1cv8c 13 113127 1cv8cdirect 10 113140 1cv8A 9 113150 1cws 10 113159 1e 7 113169 1er 7 113176 1nd 7 113183 1rd 7 113190 1st 7 113197 1th 7 113204 1withcomments 9 113211 1A 1227 113220 1A:><<5=B0@8O<8 9 114447 2 25771 114456 20 1655 140227 200 56 141882 2000 138 141938 20000929 5 142076 20001113 18 142081 2001 85 142099 2002 85 142184 20020401 5 142269 20020531 5 142274 20020703151902 5 142279 20020714 13 142284 20020714091500 12 142297 20020715220000 13 142309 20020820153309 10 142322 2003 47 142332 20031120 7 142379 2004 59 142386 20040204 40 142445 2005 12 142485 20051120140323 12 142497 2007 16 142509 2008 27 142525 2009 21 142552 20091120 5 142573 2010 7 142578 2016 12 142585 2017 17 142597 2018 67 142614 2019 6 142681 2022 727 142687 2028 9 143414 2029 9 143423 2048 28 143432 20E20 8 143460 21 1583 143468 210 4 145051 2147483647 30 145055 2147483648 10 145085 22 1169 145095 220 8 146264 22050 4 146272 222 6 146276 23 3178 146282 230 10 149460 2312 451 149470 2341 6 149921 2345 5 149927 2354 5 149932 238 5 149937 23segment 13 149942 24 1236 149955 24E24 12 151191 25 1255 151203 250 10 152458 2518 28 152468 254 9 152496 255 52 152505 256 47 152557 25segment 13 152604 26 2433 152617 2616 32 155050 265 5 155082 2678400 5 155087 2678401 5 155092 27 1472 155097 270 6 156569 2704299 9 156575 28 39 156584 281 4 156623 28374623 4 156627 29 29 156631 299 10 156660 2enabletaxi 9 156670 2@07@5H8BLB0:A8 9 156679 3 50288 156688 30 89 206976 300 18 207065 3000 4 207083 30000 21 207087 31 125 207108 310 4 207233 32 419 207237 320 10 207656 32000 8 207666 32646mb 4 207674 32768 6 207678 32be 136 207684 32k 21 207820 32kbig 11 207841 32le 136 207852 32E32 4 207988 33 26 207992 330 10 208018 331 6 208028 34 41 208034 340 4 208075 35 11 208079 355 6 208090 36 5 208096 360 37 208101 3600 6 208138 3601 4 208144 364 6 208148 366 5 208154 37 124 208159 38 30 208283 383 6 208313 39 13 208319 3986 13 208332 3999 5 208345 3E 4 208350 4 2179 208354 40 88 210533 400 24 210621 4096 11 210645 41 36 210656 410 5 210692 419 6 210697 42 11 210703 4217 4 210714 422 5 210718 425 5 210723 4294967 30 210728 4294967295 25 210758 43 10 210783 430 5 210793 432000 10 210798 43a1 10 210808 44 37 210818 440 5 210855 44100 9 210860 443 14 210869 45 74 210883 450 5 210957 456 17 210962 460 16 210979 465 12 210995 47 8 211007 470 5 211015 480 5 211020 4899 136 211025 49 7 211161 490 5 211168 4909 136 211173 4971 136 211309 4c67 4 211445 4k 7 211449 5 4687 211456 50 76 216143 500 72 216219 5000 34 216291 511 5 216325 512 8 216330 5123 136 216338 52 6 216474 520 6 216480 53 6 216486 5342 5 216492 54 6 216497 5432 4 216503 55 26 216507 555 19 216533 56 12 216552 5600 6 216564 56000 13 216570 5601 340 216583 57002 136 216923 57003 136 217059 57004 136 217195 57005 136 217331 57007 136 217467 57008 136 217603 57009 136 217739 57010 136 217875 57011 136 218011 5789 4 218147 58 23 218151 59 115 218174 5ad8 10 218289 6 4055 218299 60 135 222354 600 8 222489 604800 4 222497 604801 4 222501 61 4 222505 611 6 222509 63 14 222515 64 202 222529 643 18 222731 64k 6 222749 65 6 222755 65535 58 222761 65536 6 222819 66 4 222825 6700 6 222829 7 1210 222835 70 10 224045 700 6 224055 709 10 224061 71234567890 5 224071 72 28 224076 728 6 224104 73 11 224110 77 5 224121 777 5 224126 778 6 224131 782712893 6 224137 78271289338397 6 224143 78271289338398 7 224149 789 11 224156 7890 8 224167 79 7 224175 7f58f27d 10 224182 7zip 4 224192 8 135170 224196 80 459 359366 800 32 359825 8000 4 359857 803 136 359861 8035200 6 359997 8080 4 360003 810 6 360007 8192 18 360013 833 6 360031 84 16 360037 840 16 360053 8482 136 360069 85 6 360205 8601 4 360211 86400 9 360215 86401 4 360224 865831 5 360228 867 136 360233 874 369 360369 8859 1165 360738 891 8 361903 8ca0000d8843cd1b11dc8d043d71007f 6 361911 8e13 4 361917 8k 6 361921 9 2858 361927 90 25 364785 901 136 364810 902 136 364946 90b7 6 365082 916 5 365088 920 5 365093 9223372036854775807 40 365098 928 6 365138 93 4 365144 943 6 365148 949 341 365154 95 14 365495 950 136 365509 955 5 365645 96 9 365650 960 6 365659 96000 4 365665 97 11 365669 971 136 365680 99 28 365816 990 4 365844 9900 5 365848 993 8 365853 995 4 365861 999 25 365865 9999 5 365890 999999999 40 365895 9x11 9 365935 a 3869 365944 a2 11 369813 a2fa 6 369824 a3 17 369830 a4 19 369847 a4c6 5 369866 a5 15 369871 a6 13 369886 a763cfbb 4 369899 a8 10 369903 aa1e 10 369913 aaa 13 369923 aac 4 369936 abbr 9 369940 abort 9 369949 abortretryignore 9 369958 about 5 369967 abs 9 369972 absolute 36 369981 abstract 31 370017 accentcolor 11 370048 accept 18 370059 acceptcharset 9 370077 access 79 370086 accessdenied 41 370165 accessdisabled 48 370206 accessenabled 48 370254 accessfields 9 370302 accessibility 9 370311 accessid 9 370320 accesskey 30 370329 accessparameters 34 370359 accessprotectionsupported 9 370393 accessright 10 370402 accessrightsextensionlimitingroles 60 370412 accesstoken 103 370472 accesstokenauthentication 66 370575 accesstokenid 36 370641 accesstokenissuer 36 370677 accesstokensignalgorithm 70 370713 accessviolation 9 370783 account 2122 370792 accountcalendardata 25 372914 accountcalendareventdata 30 372939 accountcontactdata 25 372969 accountcr 55 372994 accountdr 56 373049 accountfield 10 373105 accountid 8 373115 accounting 871 373123 accountingbalancetype 10 373994 accountingflag 153 374004 accountingflags 9 374157 accountingrecordtype 16 374166 accountingregister 271 374182 accountingregisterextdimensions 41 374453 accountingregisterlist 30 374494 accountingregistermanager 156 374524 accountingregisterrecord 120 374680 accountingregisterrecordkey 18 374800 accountingregisterrecordset 206 374818 accountingregisters 20 375024 accountingregisterselection 108 375044 accountingregistersmanager 12 375152 accountmainpresentation 24 375164 accountname 9 375188 accountpassword 9 375197 accountregistersoptionstable 6 375206 accountregistertotalsoptions 6 375212 accounts 1120 375218 accountsource 26 376338 accounttype 21 376364 accounttypeexpression 10 376385 accouting 41 376395 accumregagg 6 376436 accumrgaggdims 6 376442 accumrgagggrid 6 376448 accumrgaggopt 6 376454 accumrgaggoptions 6 376460 accumrgbf 6 376466 accumrgdl 6 376472 accumrgst 6 376478 accumulation 785 376484 accumulationrecordtype 16 377269 accumulationregister 212 377285 accumulationregisteraggregate 20 377497 accumulationregisteraggregateperiodicity 40 377517 accumulationregisteraggregates 15 377557 accumulationregisteraggregateuse 15 377572 accumulationregisterlist 30 377587 accumulationregistermanager 210 377617 accumulationregisteroptionstable 6 377827 accumulationregisterrecord 66 377833 accumulationregisterrecordkey 19 377899 accumulationregisterrecordset 212 377918 accumulationregisters 20 378130 accumulationregisterselection 66 378150 accumulationregistersmanager 12 378216 accumulationregistersoptionstable 6 378228 accumulationregistertype 24 378234 accuracy 9 378258 accurate 9 378267 accusative 12 378276 acknowledgepurchase 9 378288 acos 28 378297 acoustic 9 378325 acoustics 9 378334 acousticspresentation 15 378343 acquirelicenseautomatically 9 378358 acquirelicensebyphone 9 378367 acquirelicensefromstoragedevice 9 378376 action 221 378385 actionname 9 378606 actiononpasswordrequirementsviolationonauthentication 9 378615 actiononthepasswordrequirementsviolationonauthentication 20 378624 actionperiod 84 378644 actionperiodisbasic 44 378728 actionperiods 6 378772 actionperioduse 9 378778 actions 27 378787 actionsource 11 378814 actionspanel 21 378825 actionspanelcreate 9 378846 actionspanelreports 9 378855 actionspaneltools 9 378864 actionswritingonpost 9 378873 activate 128 378882 activateinteractively 22 379010 activatetask 11 379032 activationcode 9 379043 activationprocessing 28 379052 active 379 379080 activeborder 11 379459 activedocument 17 379470 activedocumentshell 15 379487 activeobject 11 379502 activepassive 9 379513 activeperiod 11 379522 activepoint 9 379533 activescanningsupported 9 379542 activeseries 9 379551 activesessioncount 22 379560 activesubscription 9 379582 activetitlebar 11 379591 activetitlebartext 11 379602 activeusers 27 379613 activewindow 10 379640 activex 6 379650 activity 9 379656 activitycolor 11 379665 actualactionperiod 60 379676 actualactionperioditem 18 379736 ad 9 379754 adaptername 9 379763 adbannerrepresentation 20 379772 add 2164 379792 addaccesstoken 9 381956 addactivex 11 381965 addadditionaldata 9 381976 addadditionaldatafieldpresentation 9 381985 addarchivetimestamp 9 381994 addarchivetimestampasync 9 382003 addasync 9 382012 addauthentication 21 382021 addcalendar 9 382042 addcontact 9 382051 addcopy 9 382060 addcredit 11 382069 adddebit 11 382080 added 72 382091 addemptyvalue 9 382163 addevent 9 382172 addexpense 11 382181 addhandler 6 382192 addin 25 382198 addinasynccallresult 15 382223 addinattach 42 382238 addinattacherror 36 382280 addinconnectiontype 15 382316 addindetachmentonerror 22 382331 addindetachmentonerrorprocessing 10 382353 addinfullaccess 61 382363 addinhash 14 382424 addinname 6 382438 addinobject 6 382444 addinsettings 12 382450 addintype 15 382462 addition 200 382477 additional 24 382677 additionalauthenticationsettings 9 382701 additionalauthenticationsettingsmanager 50 382710 additionalauthenticationsettingsupdate 36 382760 additionalauthenticationsettingsupdateerror 36 382796 additionalcreateparameters 9 382832 additionaldata 64 382841 additionaldatafieldspresentations 9 382905 additionaldetailprocessing 9 382914 additionalfields 9 382923 additionalfiles 9 382932 additionalfilteravailablefields 11 382941 additionalfulltextsearchdictionaries 9 382952 additionalgrammar 9 382961 additionalindex 25 382970 additionalindexes 141 382995 additionalinfo 4 383136 additionalinformation 18 383140 additionalparameter 11 383158 additionalparameters 117 383169 additionalproperties 253 383286 additionalreportinformation 9 383539 additionalrequestinformation 9 383548 additionalsettings 11 383557 additionalshowmode 25 383568 additionaluserverification 9 383593 additionaluserverificationmanager 25 383602 additionaluserverificationmethod 15 383627 additionaluserverificationrequired 9 383642 additionalvaluesaxis 30 383651 additionalvaluesscale 31 383681 additiontype 22 383712 addline 11 383734 addlistitem 5 383745 addlocalnotification 9 383750 addmonth 10 383759 addon 9 383769 addparameter 9 383778 addportrange 11 383787 addreceipt 11 383798 addrepresentationobject 9 383809 addrepresentationobjectasync 9 383818 address 130 383827 addressdata 55 383957 addresses 14 384012 addressing 53 384026 addressingattribute 165 384079 addressingattributes 9 384244 addressingdimension 9 384253 addressline 9 384262 addressline2 9 384271 addrow 30 384280 addsignature 9 384310 addsignatureasync 9 384319 addtofavorites 11 384328 addtolistfrompasswords 9 384339 addtolistfrompasswordsstoredvalues 9 384348 addtosubscriberadministrators 9 384357 adequateaccuracy 9 384366 adjustedeffectiveperiod 6 384375 adjustvalue 9 384381 administration 6 384390 administrationactiononresourceconsumptionlimitexcess 25 384396 administrationadministrator 54 384421 administrationassignmentrule 54 384475 administrationassignmentruletype 20 384529 administrationbinarydatastorage 48 384549 administrationcluster 246 384597 administrationclustermanager 42 384843 administrationconnection 66 384885 administrationconnectionsecuritylevel 20 384951 administrationinfobase 216 384971 administrationinfobasedeletionmode 20 385187 administrationlicense 78 385207 administrationlock 36 385285 administrationparameterschange 36 385321 administrationportrange 23 385357 administrationprocesschoicepriority 15 385380 administrationresourceconsumptioncounter 138 385395 administrationresourceconsumptioncounterfiltertype 20 385533 administrationresourceconsumptioncountergrouptype 15 385553 administrationresourceconsumptioncountervalue 90 385568 administrationresourceconsumptionlimit 114 385658 administrationsecurityprofile 192 385772 administrationserversconnectionsparameters 6 385964 administrationservice 30 385970 administrationsession 318 386000 administrationworkprocess 126 386318 administrationworkprocessstatus 20 386444 administrationworkserver 186 386464 admob 9 386650 adobe 119 386659 adopt 9 386778 adopted 9 386787 adoptnode 18 386796 adrepresentation 9 386814 adrepresentationmanager 100 386823 ads 9 386923 adstatus 25 386932 advance 4 386957 advanced 4 386961 advertisingpresentationtools 10 386965 ae 12 386975 ae92005056c0000811dcf650677a5575 5 386987 aes 24 386992 aes128 25 387016 aes192 25 387041 aes256 25 387066 af 26 387091 affiliation 5 387117 afp 4 387122 after 23 387126 afterallfields 9 387149 afterchangevalue 5 387158 aftercurrentrow 18 387163 afterdateofposting 10 387181 afterdeleteline 12 387191 afterdeleterow 10 387203 afterexchangedatawithmainserver 10 387213 afterrestorevalues 22 387223 afterwrite 307 387245 afterwriteatserver 99 387552 afterwritedatahistoryversionsprocessing 110 387651 agent 9 387761 agentipaddress 9 387770 agentstandardcall 13 387779 aggregate 20 387792 aggregateinformation 43 387812 aggregates 20 387855 aggregatesinformation 37 387875 aggregatesisfilled 11 387912 al 12 387923 aladdin 10 387935 algorithmselectionborder 9 387945 alias 89 387954 aliceblue 11 388043 align 142 388054 aligndatatable 9 388196 alignitemboundariesbytimescale 9 388205 alignuse 4 388214 alink 9 388218 all 183 388227 allapplicationusers 9 388410 allbutselected 9 388419 allcharacters 9 388428 alldata 18 388437 allday 13 388455 alldecisions 9 388468 allerrors 9 388477 allfields 9 388486 allfilesaccess 9 388495 allfunctions 9 388504 allfunctionsmode 6 388513 allincomingsharerequeststypesprocessing 9 388519 allitems 9 388528 alllevelshorizontal 9 388537 alllevelsvertical 9 388546 allmodulesextension 14 388555 allow 44 388569 allowaccessrightauditeventsrecording 25 388613 allowaccessrightsextension 47 388638 allowautocapture 9 388685 allowautohidestate 11 388694 allowautosaveauthentication 36 388705 allowclose 11 388741 allowdockedstate 11 388752 allowed 6 388763 allowedactions 9 388769 allowedaddin 36 388778 allowedaddins 36 388814 allowedcomclass 84 388850 allowedexternalapplication 36 388934 allowedexternalapplications 36 388970 allowedexternalmodule 36 389006 allowedexternalmodules 36 389042 allowedincomingsharerequesttypes 9 389078 allowedinternetresource 48 389087 allowedinternetresources 36 389135 allowedlength 34 389171 allowedmessageno 20 389205 allowedread 14 389225 allowedsign 25 389239 allowedvalues 9 389264 allowedvirtualdirectories 36 389273 allowedvirtualdirectory 48 389309 allowedwrite 14 389357 allowexternalcodeexecutioninunsafemode 47 389371 allowfloatstate 11 389418 allowgettingcurrentrowurl 9 389429 allowinputemptymultiplevalues 10 389438 allowjoinwindow 11 389448 allowlicensedistribution 47 389459 allowmultiplevaluesduplicates 10 389506 allownormalstate 11 389516 allownull 9 389527 allowrootchoice 18 389536 allowsave 11 389554 allowsaveauthenticationforreauthentication 36 389565 allowterminationatsessionstart 51 389601 allowtestcertificates 9 389652 allowvideoconferences 4 389661 allpointvalues 9 389665 allrefstype 110 389674 allselected 9 389784 alltasks 9 389793 allvalues 18 389802 alt 92 389820 alternation 9 389912 alternationrowbackcolor 11 389921 alternative 15 389932 altitude 9 389947 always 81 389956 alwayshorizontal 9 390037 am 32 390046 amazon 15 390078 amount 6 390093 an 95 390099 analysis 93 390194 analysisdatatype 16 390287 analysistype 18 390303 analyticssystem 10 390321 analyticssystemclient 10 390331 analyticssystemmanager 25 390341 analyticssystemquery 4 390366 analyticssystemschema 42 390370 analyticssystemserverconnection 20 390412 anchor 23 390432 anchors 9 390455 and 43 390464 andgroup 9 390507 android 423 390516 angle 9 390939 animation 18 390948 annotation 368 390966 annotations 11 391334 anonymoustypedefinition 22 391345 anroid 5 391367 ansi 99 391372 ansifixedfont 11 391471 ansitxt 37 391482 ansivariablefont 11 391519 ansiH@8DB<>=>H8@8==K9 11 391530 ansiH@8DB?@>?>@F8>=0;L=K9 11 391541 answer 20 391552 answered 20 391572 antecedent 9 391592 antique 16 391601 antiquewhite 11 391617 any 70 391628 anyinterval 9 391698 anypart 9 391707 anysimpletype 11 391716 anytype 5 391727 anyunorderednode 9 391732 anyuri 11 391741 ap 25 391752 apache 10 391777 apartment 6 391787 api 55 391793 apns 22 391848 apop 13 391870 app 27 391883 appartment 9 391910 appdata 22 391919 appearance 204 391941 appearancearea 47 392145 appearanceareaitem 24 392192 appearanceareasetting 59 392216 appearanceareassettingcontrol 18 392275 appearanceareatype 15 392293 appearanceboxesempty 12 392308 appearanceboxesfilled 12 392320 appearanceboxesonefilled 12 392332 appearanceboxesthreefilled 12 392344 appearanceboxestwofilled 12 392356 appearancecheckbox 12 392368 appearancecheckicon 12 392380 appearancecircleblack 12 392392 appearancecircleempty 12 392404 appearancecirclefilled 12 392416 appearancecirclegreen 12 392428 appearancecircleonefourthfilled 12 392440 appearancecirclered 12 392452 appearancecirclethreefourthfilled 12 392464 appearancecircletwofourthfilled 12 392476 appearancecircleyellow 12 392488 appearancecross 12 392500 appearancecrossicon 12 392512 appearancedashyellow 12 392524 appearancedownarrowgray 12 392536 appearancedownarrowred 12 392548 appearancedowninclinearrowgray 12 392560 appearancedowninclinearrowred 12 392572 appearancedowninclinearrowyellow 12 392584 appearancedowntrianglered 12 392596 appearanceexclamationmark 19 392608 appearanceexclamationmarkicon 19 392627 appearancefield 5 392646 appearancefields 5 392651 appearancefieldsavailablefields 11 392656 appearanceflaggreen 12 392667 appearanceflagred 12 392679 appearanceflagyellow 12 392691 appearancerightarrowgray 12 392703 appearancerightarrowyellow 12 392715 appearancesetting 17 392727 appearancesettingitem 36 392744 appearancesettingsettings 59 392780 appearancesettingssettingcontrol 18 392839 appearancestarempty 12 392857 appearancestarfilled 12 392869 appearancestarhalffilled 12 392881 appearancetemplate 46 392893 appearancetemplatearea 12 392939 appearancetemplateareaitem 5 392951 appearanceuparrowgray 12 392956 appearanceuparrowgreen 12 392968 appearanceupinclinearrowgray 12 392980 appearanceupinclinearrowgreen 12 392992 appearanceupinclinearrowyellow 12 393004 appearanceuptrianglegreen 12 393016 append 28 393028 appendaschildren 9 393056 appendchild 378 393065 appenddata 45 393443 appendfile 10 393488 appgallery 4 393498 appid 37 393502 appinfo 9 393539 appinfos 11 393548 apple 96 393559 appleinapppurchase 12 393655 applet 8 393667 applets 9 393675 applettags 9 393684 appletB538 9 393693 application 1257 393702 applicationdata 9 394959 applicationext 14 394968 applicationformsopenningmode 24 394982 applicationid 9 395006 applicationname 65 395015 applicationpresentation 26 395080 applications 9 395106 applicationtype 9 395115 applicationusagestatistics 19 395124 applicationusagestatisticsmanager 60 395143 applicationworkspace 11 395203 apply 9 395214 applyappearance 9 395223 applyappearancetemplate 9 395232 applyassignmentrules 26 395241 applyservicesettings 26 395267 applysettings 11 395293 appname 4 395304 approve 9 395308 approving 9 395317 approximationdegree 9 395326 approximationtype 9 395335 apps 4 395344 appvariant 10 395348 appversion 14 395358 aqua 12 395372 aquamarine 11 395384 ar 190 395395 arcgis 4 395585 archive 18 395589 archivefilecompressionlevel 20 395607 archivefilecompressionmethod 20 395627 archivefileencryptionmethod 25 395647 archivefileentries 24 395672 archivefileentry 102 395696 archivefilereader 57 395798 archivefilerestorefilepathsmode 15 395855 archivefilestorepathmode 20 395870 archivefilesubdirprocessingmode 15 395890 archivefiletype 40 395905 archivefilewriter 45 395945 archivename 9 395990 archivetimestamps 9 395999 arctic 16 396008 are 29 396024 area 156 396053 areas 11 396209 areatags 9 396220 areatemplate 5 396229 areatype 22 396234 areaB538 9 396256 arial 23 396265 arm 53 396288 arm64 13 396341 around 5 396354 array 81 396359 arrayend 9 396440 arraylist 9 396449 arraystart 9 396458 arrowstyle 20 396467 article 27 396487 as 42 396514 asboolean 9 396556 asc 145 396565 ascend 9 396710 ascending 9 396719 ascii 288 396728 ascode 45 397016 ascx 4 397061 asdescription 54 397065 asfile 9 397119 asfileref 9 397128 asin 28 397137 askuser 9 397165 asnumber 9 397174 asnumeric 9 397183 asp 9 397192 asphalt 9 397201 aspx 14 397210 asset 5 397224 assets 5 397229 assign 18 397234 assignmentrulekey 9 397252 assignmentruletype 11 397261 assistant 9 397272 associatedtable 27 397281 associationgroup 20 397308 associationrule 35 397328 associationrulesdatasourcetype 16 397363 associationrulesprunetype 16 397379 async 21 397395 aszero 9 397416 at 18 397425 atan 27 397443 atclient 10 397470 atclientatserver 6 397480 atclientatservernocontext 5 397486 atintersection 9 397491 atomic 18 397500 atrow 9 397518 atscale 9 397527 atserver 19 397536 atservernocontext 5 397555 attach 12 397560 attachaddin 10 397572 attachaddinasync 10 397582 attachaftermessagesendhandler 9 397592 attachcallshandler 11 397601 attachcomputerinformationextensionasync 10 397612 attachcryptoextension 10 397622 attachcryptoextensionasync 10 397632 attachdatachangehandler 11 397642 attachfilesystemextension 10 397653 attachfilesystemextensionasync 10 397663 attachgeneratecommandshandler 9 397673 attachhandler 9 397682 attachidlehandler 31 397691 attachinstallationcompletehandler 9 397722 attachinternetconnectionchangehandler 9 397731 attachlicensingclientparametersrequesthandler 10 397740 attachlocationchangehandler 9 397750 attachment 76 397759 attachments 58 397835 attachmentssupported 9 397893 attachmenttype 36 397902 attachmessageactionhandler 9 397938 attachmessagehandler 9 397947 attachmonitoredgeofencesborderscrossingdetectionhandler 9 397956 attachnewmessageshandlerasync 9 397965 attachnotificationhandler 19 397974 attachprovidersavailabilitychangehandler 9 397993 attachsmsmessagehandler 11 398002 attachstatechangehandler 9 398013 attendee 9 398022 attendees 9 398031 attention 9 398040 attn 5 398049 attribute 2154 398054 attributecount 27 400208 attributedeclaration 20 400235 attributedeclarations 11 400255 attributeformdefault 11 400266 attributeformqualified 9 400277 attributegroupdefinition 9 400286 attributegroupdefinitions 11 400295 attributelocalname 27 400306 attributename 38 400333 attributenamespaceuri 27 400371 attributeplacement 22 400398 attributeprefix 27 400420 attributes 564 400447 attributetype 27 401011 attributeuse 38 401038 attributeuserestriction 10 401076 attributeuses 22 401086 attributevalue 27 401108 attributewildcard 11 401135 au 18 401146 aud 5 401164 audio 30 401169 audioplaybackandvibration 9 401199 audiorecordingchanneluse 24 401208 audiorecordingformat 24 401232 audiorecordingparameters 29 401256 audiorecordingstophandler 9 401285 audiorecordingsupported 9 401294 authenticate 59 401303 authenticateadmin 15 401362 authenticateagent 25 401377 authentication 48 401402 authenticationautosavesettings 24 401450 authenticationdataerror 9 401474 authenticationemail 18 401483 authenticationerror 36 401501 authenticationfirstfactor 36 401537 authenticationlock 45 401573 authenticationmode 66 401618 authenticationresultverificationhttprequest 9 401684 authenticationresultverificationhttprequestmethod 9 401693 authenticationseparation 9 401702 authenticationunlock 36 401711 authenticationunlockerror 36 401747 author 9 401783 authority 7 401792 authorization 8 401799 auto 1516 401807 autoaddincomplete 9 403323 autoappendpresentations 7 403332 autocalculate 9 403339 autocapitalizationontextinput 39 403348 autocellheight 31 403387 autochangerecord 15 403418 autochoiceincomplete 20 403433 autocolor 9 403453 autocolumnminwidth 9 403462 autocomplete 10 403471 autocompletetext 11 403481 autoconnect 18 403492 autocontextmenu 11 403510 autocorrectionontextinput 29 403521 autodelete 20 403550 autodeleteoff 9 403570 autodeleteonunpost 9 403579 autodetailrecords 9 403588 autodetect 9 403597 autodetectwholeinterval 9 403606 autofill 31 403615 autofillavailablefields 19 403646 autofillcheck 9 403665 autofillhint 9 403674 autofilloff 9 403683 autofixation 11 403692 autofont 9 403703 autofree 9 403712 autohide 9 403721 autoindent 25 403730 autoinsertnewrow 20 403755 autoitemtext 9 403775 automarkincomplete 62 403784 automatic 18 403846 automaticandmanaged 9 403864 automation 80 403873 automaxheight 189 403953 automaxheightintablerows 9 404142 automaxvalue 9 404151 automaxwidth 207 404160 autominvalue 9 404367 autonumbering 45 404376 autonumeration 88 404421 autonumerationinform 15 404509 autoorder 24 404524 autoorderbycode 9 404548 autopointlabels 9 404557 autopointtext 18 404566 autorecord 9 404584 autorefresh 141 404593 autorefreshperiod 141 404734 autorowheight 11 404875 autorowminheight 9 404886 autosave 9 404895 autosaveauthenticationbydefault 36 404904 autosavedatainsettings 9 404940 autosavedauthenticationlifetime 36 404949 autosaveformdatainsettings 15 404985 autosaveusersettings 9 405000 autosendsms 9 405009 autoserieslabels 9 405018 autoseriesseparation 56 405027 autoseriestext 18 405083 autoshowclearbutton 9 405101 autoshowclearbuttonmode 20 405110 autoshowopenbutton 9 405130 autoshowopenbuttonmode 20 405139 autoshowstate 9 405159 autoshowstatemode 26 405168 autosize 20 405194 autosizeignorescale 9 405214 autotaborder 11 405223 autotext 9 405234 autotime 20 405243 autotimemode 30 405263 autotitle 20 405293 autotransposition 9 405313 autoupdate 18 405322 autourl 9 405340 autouse 27 405349 autumn 9 405376 auxiliarychoiceform 81 405385 auxiliaryconstantsform 9 405466 auxiliaryfolderchoiceform 18 405475 auxiliaryfolderform 18 405493 auxiliaryform 36 405511 auxiliarylistform 117 405547 auxiliaryloadform 9 405664 auxiliarynavigationcolor 11 405673 auxiliaryobjectform 72 405684 auxiliaryrecordform 9 405756 auxiliarysaveform 9 405765 auxiliarysettingsform 9 405774 auxuliaryservice 20 405783 availabilityforappearance 9 405803 availabilityforchoice 9 405812 available 55 405821 availableatexternalvariant 9 405876 availableatlocalvariant 9 405885 availablecharttypes 9 405894 availablecomparetypes 11 405903 availablefields 54 405914 availableforgetting 9 405968 availablelicenseacquisitioncountry 15 405977 availableobjects 11 405992 availableparameters 151 406003 availableperfomance 14 406154 availableperformance 11 406168 availablesettingssource 18 406179 availabletables 9 406197 availabletypes 27 406206 availablevalues 53 406233 averagecallduration 11 406286 averagedbmscallsduration 11 406297 averageservicecallduration 11 406308 averagethreadcount 11 406319 averageworkprocesscallprocessingduration 11 406330 avg 6 406341 avgcalltime 14 406347 avgdbcalltime 19 406361 avgintervals 9 406380 avglockcalltime 19 406389 avgobjectsize 9 406408 avgservercalltime 19 406417 avgthreads 14 406436 await 9 406450 aws 12 406459 axis 9 406471 az 51 406480 azimuthalaitoffprojection 9 406531 azimuthalequidistantprojection 9 406540 azimuthalhammerprojection 9 406549 azimuthallambertequalareaprojection 9 406558 azimuthalwagner7projection 9 406567 azimuthalwinkeltripelprojection 9 406576 aztec 21 406585 azure 11 406606 a0c 4 406617 b 49 406621 b0 10 406670 b4 15 406680 b5 34 406695 b6 15 406729 b8 17 406744 ba 22 406761 back 12 406783 backcolor 740 406795 backcoloruse 4 407535 background 41 407539 backgroundaudioplaybackandvibration 9 407580 backgroundaudiorecording 9 407589 backgroundintervals 18 407598 backgroundjob 175 407616 backgroundjobs 10 407791 backgroundjobsmanager 36 407801 backgroundjobstate 25 407837 backgroundlocation 9 407862 backgroundpicture 11 407871 backgroundscanningsupported 9 407882 backspace 17 407891 backup 9 407908 badge 14 407917 balance 111 407931 balanceandturnovers 18 408042 balancecr 22 408060 balanced 13 408082 balancedaccount 22 408095 balancedextdimension 22 408117 balancedr 22 408139 balancedturnover 11 408161 balancedturnovercr 11 408172 balancedturnoverdr 11 408183 balancegroup 10 408194 balancetype 10 408204 balloon 9 408214 ban 8 408223 bani 8 408231 bar 189 408239 bar3d 9 408428 barchartpointsorder 53 408437 barcodescanning 9 408490 barcodescanningsupported 9 408499 barcodetype 100 408508 bare 189 408608 bargraph 9 408797 base 115 408806 base64 134 408921 base64binary 4 409055 base64string 10 409059 base64value 10 409069 base647=0G5=85 21 409079 base64AB@>:0 41 409100 basecalculationtypes 167 409141 basecalculationtypesrow 24 409308 basedimension 9 409332 basedon 81 409341 basename 38 409422 baseperiod 29 409460 basetype 40 409489 basetypedefinition 22 409529 basetypename 22 409551 baseuri 144 409573 baseurl 18 409717 basevalue 48 409735 basic 35 409783 basis 63 409818 basisparameter 88 409881 bbb 12 409969 bc 17 409981 bcc 29 409998 bcp 8 410027 be 44 410035 bearer 4 410079 been 6 410083 beep 10 410089 before 5 410099 beforeaddline 77 410104 beforeaddrow 22 410181 beforeafter 9 410203 beforebeginsenddatatomaster 11 410212 beforebeginsenddatatoslave 11 410223 beforechangevalue 5 410234 beforeclose 22 410239 beforecollapse 72 410261 beforecollapsedimensionitem 9 410333 beforeconnect 9 410342 beforecreate 9 410351 beforecreateinitialimage 11 410360 beforecreatesubbusinessprocesses 11 410371 beforecreatetasks 11 410382 beforecurrentrow 18 410393 beforedatechange 33 410411 beforedateofposting 10 410444 beforedelete 110 410454 beforedeleterow 22 410564 beforeeditend 22 410586 beforeexecute 32 410608 beforeexecuteinteractively 23 410640 beforeexit 17 410663 beforeexpand 72 410680 beforeexpanddimensionitem 9 410752 beforeloaddatafromsettingsatserver 10 410761 beforeloadusersettingsatserver 18 410771 beforeloadvariantatserver 9 410789 beforeopen 12 410798 beforeparentchange 33 410810 beforeposting 22 410843 beforeprint 63 410865 beforereopenfromotherserver 10 410928 beforerowchange 22 410938 beforesavevalues 22 410960 beforesetdeletionmark 99 410982 beforestart 37 411081 beforestartedit 9 411118 beforestartquickedit 9 411127 beforeundoposting 22 411136 beforewrite 499 411158 beforewriteatserver 99 411657 begin 290 411756 beginadbannerdownloading 9 412046 beginadding 9 412055 beginaddingarchivetimestamp 9 412064 beginandend 36 412073 beginandendtime 9 412109 beginangle 32 412118 beginarrow 9 412150 beginattachingaddin 10 412159 beginattachingcomputerinformationextension 10 412169 beginattachingcryptoextension 10 412179 beginattachingfilesystemextension 10 412189 beginattachnewmessageshandler 9 412199 beginbegin 9 412208 beginbookmark 55 412217 begincalling 9 412272 begincase 18 412281 begincheckingcertificate 9 412299 begincheckingexistence 9 412308 begincheckingisdirectory 9 412317 begincheckingisfile 9 412326 beginclose 63 412335 beginconnect 9 412398 begincopyingfile 10 412407 begincopyto 36 412417 begincreate 9 412453 begincreatebinarydatafromfile 10 412462 begincreatedatadump 9 412472 begincreatedatadumpasync 9 412481 begincreatetempfile 9 412490 begincreatingdirectory 10 412499 begindate 9 412509 begindates 6 412518 begindecrypting 9 412524 begindeletedata 9 412533 begindeleting 9 412542 begindeletingfiles 10 412551 begindetachnewmessageshandler 9 412561 begindisconnect 9 412570 begineditcurrentarea 9 412579 begineditingitem 10 412588 beginencrypting 9 412598 beginend 9 412607 beginenhancingsignature 9 412616 beginfindingbyserialnumber 9 412625 beginfindingbysubject 9 412634 beginfindingbythumbprint 9 412643 beginfindingfiles 10 412652 beginflush 36 412662 beginfullscreenaddownloading 9 412698 begingaugeangle 9 412707 begingetattachments 9 412716 begingetbinarydata 9 412725 begingetbinarydatabuffer 9 412734 begingetconversation 10 412743 begingetdata 9 412753 begingetfilefromserver 10 412762 begingetfilesfromserver 10 412772 begingetmobiledevicelibraryfilethumbnail 9 412782 begingetsignaturedescriptions 9 412791 begingetsize 27 412800 begingetting 9 412827 begingettingall 9 412836 begingettingcertificatesfromsignature 9 412845 begingettingcertificatestore 9 412854 begingettingcryptomoduleinformation 18 412863 begingettingcryptosignaturescontainer 9 412881 begingettingdocumentsdir 10 412890 begingettingfiles 10 412900 begingettinghidden 9 412910 begingettingmobiledevicelibrarydir 10 412919 begingettingmodificationtime 9 412929 begingettingmodificationuniversaltime 9 412938 begingettingnetworkadaptersinformation 10 412947 begingettingreadonly 9 412957 begingettingsize 9 412966 begingettingtempfilesdir 10 412975 begingettinguserdataworkdir 10 412985 begininfobaseregistration 9 412995 begininfobaseunregistration 9 413004 begininitialization 36 413013 begininstalladdin 10 413049 begininstallation 18 413059 begininstallcryptoextension 10 413077 begininstallfilesystemextension 10 413087 begininstallingcomputerinformationextension 10 413097 beginitem 18 413107 beginleft 18 413125 beginmovingfile 10 413143 beginning 56 413153 beginningoflastday 9 413209 beginningoflasthalfyear 9 413218 beginningoflastmonth 9 413227 beginningoflastquarter 9 413236 beginningoflasttendays 9 413245 beginningoflastweek 9 413254 beginningoflastyear 9 413263 beginningofnextday 9 413272 beginningofnexthalfyear 9 413281 beginningofnextmonth 9 413290 beginningofnextquarter 9 413299 beginningofnexttendays 9 413308 beginningofnextweek 9 413317 beginningofnextyear 9 413326 beginningofthisday 9 413335 beginningofthishalfyear 9 413344 beginningofthismonth 9 413353 beginningofthisquarter 9 413362 beginningofthistendays 9 413371 beginningofthisweek 9 413380 beginningofthisyear 9 413389 beginningvariant 11 413398 beginofdisplayperiod 11 413409 beginofperiod 37 413420 beginofrepresentationperiod 18 413457 beginofwholeinterval 9 413475 beginopen 27 413484 beginopenforappend 9 413511 beginopenforread 9 413520 beginopenforwrite 9 413529 beginopenstreamforread 9 413538 beginoutput 22 413547 beginpurchasing 9 413569 beginputdata 9 413578 beginputfile 10 413587 beginputfilestoserver 10 413597 beginputfiletoserver 10 413607 beginputtingfiles 10 413617 beginread 47 413627 beginreadbyte 9 413674 beginreadchars 9 413683 beginreading 20 413692 beginreadint16 9 413712 beginreadint32 9 413721 beginreadint64 9 413730 beginreadintobinarydatabuffer 9 413739 beginreadline 9 413748 beginreadto 9 413757 beginrequestinguserpermission 10 413766 beginrestorefromdatadump 9 413776 beginrestorefromdatadumpasync 9 413785 beginrewardedvideodownloading 9 413794 beginrunningapplication 10 413803 beginsearch 9 413813 beginseek 27 413822 beginsetsize 27 413849 beginsetting 9 413876 beginsettinghidden 9 413885 beginsettingmodificationtime 9 413894 beginsettingmodificationuniversaltime 9 413903 beginsettingreadonly 9 413912 beginside 18 413921 beginsigning 9 413939 beginskip 9 413948 beginskipto 9 413957 beginsplit 9 413966 beginsplitinpartsof 9 413975 beginswith 9 413984 begintime 47 413993 begintop 18 414040 begintransaction 21 414058 beginunload 9 414079 beginunloading 9 414088 beginupdatingcertificaterevocationlist 9 414097 beginverification 9 414106 beginverifyingsignature 9 414115 beginverifyingtimestamp 9 414124 beginverifysignature 9 414133 beginverifysignatures 9 414142 beginwrite 56 414151 beginwriteattachments 9 414207 beginwriteattachmentsdeletion 9 414216 beginwritebinarydatabuffer 9 414225 beginwritebyte 9 414234 beginwritechars 9 414243 beginwritein16 9 414252 beginwriteint32 9 414261 beginwriteint64 9 414270 beginwriteline 9 414279 beginwriterepresentationobject 9 414288 beginwritesignature 9 414297 beginwriting 52 414306 beginwritingfileforprinting 9 414358 begofactionperiod 55 414367 begofbaseperiod 66 414422 begofday 16 414488 begofhalfyear 6 414504 begofhour 16 414510 begofminute 16 414526 begofmonth 16 414542 begofquarter 16 414558 begoftendays 6 414574 begofweek 16 414580 begofyear 16 414596 behavior 9 414612 behavioronhorizontalcompression 9 414621 beige 11 414630 belongingtosequences 11 414641 belongsto 11 414652 belongstoitem 66 414663 bes 52 414729 between 6 414781 betweenintervalshatch 9 414787 betweenintervalshatchcolor 9 414796 betweenvalues 18 414805 bf 23 414823 bf56 5 414846 bg 41 414851 bgcolor 40 414892 bh 12 414932 big 11 414944 big5 414 414955 bigcircle 9 415369 bigendian 12 415378 bigsplitteddata 10 415390 bigsquare 9 415400 bigtriangle 9 415409 bill 4 415418 billing 4 415422 bin 11 415426 binary 9 415437 binarydata 52 415446 binarydatablockstorageusemode 25 415498 binarydatabuffer 129 415523 binarydataexternalstorageaccessparameters 20 415652 binarydataexternalstorageconnectionparameters 24 415672 binarydataexternalstoragemanager 55 415696 binarydataexternalstorages 9 415751 binarydataexternalstoragesmanager 25 415760 binarydataexternalstorageurltype 15 415785 binarydataqualifiers 33 415800 binarydatastorage 40 415833 binarydatastoragedatacontent 44 415873 binarydatastoragedatacontentitem 15 415917 binarydatastoragedatacopiesplacementmode 25 415932 binarydatastorageinformation 40 415957 binarydatastoragelocationuse 33 415997 binarydatastoragelocationusefield 18 416030 binarydatastoragemanager 105 416048 binarydatastoragemode 25 416153 binarydatastoragereadwritemode 15 416178 binarydatastorageservice 24 416193 binarydatastoragetype 29 416217 binarydatastorageusemode 24 416246 bindir 10 416270 biometrics 9 416280 biometricsonly 9 416289 biometricsorpassword 9 416298 biometricverificationmethod 25 416307 birthday 14 416332 bisque 12 416346 bitmap 5 416358 bitperpixel1 9 416363 bitperpixel24 9 416372 bitperpixel32 9 416381 bitperpixel4 9 416390 bitperpixel8 9 416399 bitwiseand 10 416408 bitwiseandnot 10 416418 bitwisenot 10 416428 bitwiseor 10 416438 bitwiseshiftleft 10 416448 bitwiseshiftright 10 416458 bitwisexor 10 416468 black 12 416478 blackandwhite 30 416490 blackandwhiteview 21 416520 blanchedalmond 11 416541 blank 14 416552 blob 4 416566 block 54 416570 blockdefault 12 416624 blockedbydbms 28 416636 blockedbyls 28 416664 blog 9 416692 bls 11 416701 blue 21 416712 bluetooth 4 416733 bluetoothprinters 9 416737 bluetooth?@8=B5@K 9 416746 blueviolet 12 416755 bmp 90 416767 bn 18 416857 bo 12 416875 bocu 117 416887 body 97 417004 bodysize 9 417101 bof 9 417110 bold 15 417119 bom 134 417134 bool 6 417268 boolean 50 417274 booleanfalsepresentation 54 417324 booleantruepresentation 54 417378 booleanvalue 9 417432 bord 7 417441 border 623 417448 bordercolor 790 418071 borderquality 9 418861 bordersemitransparencypercent 9 418870 borderstyle 49 418879 bordertype 24 418928 bot 114 418952 bothsides 9 419066 bothways 18 419075 bots 9 419093 bottom 322 419102 bottomborder 22 419424 bottomleft 9 419446 bottommargin 70 419455 bottommultiline 9 419525 bottommultilinetransposition 9 419534 bottomright 18 419543 bottomscrolling 9 419561 bottomtotop 9 419570 boundaries 12 419579 boundary 36 419591 boundaryanalysis 6 419627 boundarybox 54 419633 boundarytype 26 419687 box 2574 419713 bpxrficy 5 422287 br 17 422292 break 54 422309 brieferrordescription 28 422363 briefinformation 9 422391 briefpresentation 11 422400 bright 9 422411 broken 9 422420 brokentilt 9 422429 bronze 9 422438 brother 9 422447 brown 11 422456 browse 9 422467 bsl 5 422476 bstr 6 422481 bt 6 422487 bubble 9 422493 bubblechartnegativevaluesshowmode 58 422502 bubblesizecommonseries 32 422560 bubblesizevaluesource 32 422592 bubblesizing 9 422624 bucket 31 422633 bucket2 4 422664 build 9 422668 builddate 11 422677 building 9 422688 bullet 4 422697 bullet1 5 422701 bulletedlist 9 422706 bundle 5 422715 burlywood 11 422720 business 1111 422731 businessprocess 379 423842 businessprocesses 18 424221 businessprocessesmanager 24 424239 businessprocesslist 30 424263 businessprocessmanager 132 424293 businessprocessnumber 9 424425 businessprocessnumberperiodicity 39 424434 businessprocessnumbertype 25 424473 businessprocessobject 301 424498 businessprocessref 115 424799 businessprocessroutepointcase 6 424914 businessprocessroutepointcases 24 424920 businessprocessroutepointref 158 424944 businessprocessroutepoints 30 425102 businessprocessroutepointtype 50 425132 businessprocessselection 84 425182 businessprocessstart 12 425266 button 255 425278 buttonbackcolor 77 425533 buttonbordercolor 11 425610 buttondarkshadow 11 425621 buttonface 11 425632 buttongroup 9 425643 buttongrouprepresentation 20 425652 buttonhighlight 11 425672 buttonlightshadow 11 425683 buttonlocationincommandbar 25 425694 buttonorder 11 425719 buttonpanel 9 425730 buttonpicturelocation 15 425739 buttonrepresentation 25 425754 buttonrows 9 425779 buttons 33 425788 buttonsalignment 11 425821 buttonsbackcolor 9 425832 buttonshadow 11 425841 buttonshape 20 425852 buttonshaperepresentation 25 425872 buttonstype 9 425897 buttontext 11 425906 buttontextcolor 66 425917 buttontype 11 425983 buy 4 425994 bw 12 425998 by 37 426010 bycolumns 9 426047 byconfidence 9 426056 bydocumentposition 9 426065 byfieldfld36 6 426074 byfirstpageinseries 9 426080 byfontsize 9 426089 bygroups 9 426098 bygroupswithhierarchy 9 426107 byhorizontaltextlines 9 426116 byimportance 9 426125 bykeyforuser 9 426134 bylength 9 426143 bymemory 9 426152 bynum 5 426161 bypassproxyonaddresses 9 426166 bypassproxyonlocal 9 426175 byperformance 9 426184 byperformer 9 426193 byrows 9 426202 byselectedcolumns 11 426211 bysupport 18 426222 byte 8 426240 byteorder 42 426248 byteordermarkuse 20 426290 bytesall 28 426310 byteslast5min 28 426338 bz 14 426366 bzip 8 426380 bzip2 38 426388 c 597 426426 c1 11 427023 c14n 15 427034 c2 6 427049 c3 9 427055 c4 16 427064 c47b 6 427080 c5 15 427086 c6 9 427101 c65 9 427110 c982f41bed5c 10 427119 ca 32 427129 cade 104 427161 cades 104 427265 cadesav2 16 427369 cadesav3 61 427385 cadesbes 39 427446 cadesc 57 427485 cadest 68 427542 cadesxlong 12 427610 cadesxlongtype1 12 427622 cadesxlongtype2 57 427634 cadesxtype1 16 427691 cadesxtype2 16 427707 cadetblue 12 427723 caf 9 427735 calc 7 427744 calculatedfield 4 427751 calculatedfields 20 427755 calculatefootersize 12 427775 calculateheadersize 12 427787 calculation 1989 427799 calculationkind 32 429788 calculationregister 249 429820 calculationregisterlist 30 430069 calculationregistermanager 72 430099 calculationregisterperiodicity 34 430171 calculationregisterperiodtype 25 430205 calculationregisterrecalcsmanager 12 430230 calculationregisterrecord 114 430242 calculationregisterrecordkey 19 430356 calculationregisterrecordset 200 430375 calculationregisters 20 430575 calculationregisterselection 114 430595 calculationregistersmanager 12 430709 calculationtype 132 430721 calculationtypemainpresentation 24 430853 calculator 12 430877 calendar 211 430889 calendaraccount 16 431100 calendarbox 186 431116 calendardata 34 431302 calendareditingsupported 9 431336 calendareventdata 79 431345 calendareventrecurrence 30 431424 calendarfield 9 431454 calendarnavigation 20 431463 calendars 9 431483 calendarsaddingsupported 9 431492 calendarsmanager 104 431501 call 4 431605 callbackdescription 34 431609 callbackdescriptiononclose 9 431643 callcount 22 431652 callcountlast5min 11 431674 callcounttotal 11 431685 callduration 22 431696 calldurationcurrent 11 431718 calldurationlast5min 11 431729 calldurationtotal 11 431740 callhttpmethod 9 431751 callhttpmethodasync 9 431760 calllog 21 431769 calllogcalltype 25 431790 calllogrecord 36 431815 calllogsupported 11 431851 callprocessing 9 431862 calls 4 431871 callsall 28 431875 callshandlingsupported 11 431903 callslast5min 28 431914 callsleep 10 431942 callsourceevent 11 431952 calltype 11 431963 camera 9 431974 cameralightingtype 20 431983 can 90 432003 canbeexpanded 9 432093 cancel 91 432102 canceldelayedspeechtotext 9 432193 canceled 28 432202 canceledit 18 432230 cancellocalnotifications 9 432248 cancelread 11 432257 cancelsearch 12 432268 cancelsubscriberapplicationlinks 9 432280 canceluilogrecording 9 432289 cancelwrite 11 432298 cannotchangepassword 57 432309 cannotopenform 10 432366 cannotrecoverypassword 9 432376 canonical 20 432385 canonicalization 27 432405 canonicalize 9 432432 canonicalizetofile 9 432441 canonicalizetostream 9 432450 canonicalizetostring 9 432459 canread 27 432468 canreadxml 19 432495 canseek 27 432514 cansetparameter 27 432541 canuse 19 432568 canwrite 27 432587 capacity 25 432614 caption 95 432639 captionpicture 11 432734 cardinal 15 432745 case 65 432760 casecount 45 432825 caseitem 5 432870 cases 11 432875 casesensitive 9 432886 cast 14 432895 catalog 1583 432909 catalogcodesseries 29 434492 catalogcodetype 25 434521 cataloglist 30 434546 catalogmainpresentation 24 434576 catalogmanager 174 434600 catalogobject 308 434774 catalogref 149 435082 catalogs 151 435231 catalogselection 102 435382 catalogsmanager 18 435484 categories 27 435502 category 54 435529 cause 9 435583 cc 30 435592 ccc 13 435622 cdata 239 435635 cdatasection 70 435874 cdatasectionastext 9 435944 cdx 35 435953 ceilgraph 9 435988 cell 96 435997 cellappearance 159 436093 cellheight 22 436252 cellhyperlink 9 436274 cellindex 9 436283 cellpadding 9 436292 cells 65 436301 cellspacing 9 436366 cellulardata 9 436375 cent 13 436384 centai 7 436397 centas 7 436404 center 126 436411 centerbottom 9 436537 centertext 11 436546 centertop 9 436557 centraladminname 5 436566 centraleurroman 136 436571 centralserver 16 436707 centroid 18 436723 cents 7 436741 cents 7 436748 cert 16 436755 certificate 28 436771 certificateextensions 9 436799 certificateextensionsasrawdata 9 436808 certificationauthoritycertificates 27 436817 certify 9 436844 certifying 9 436853 certs 16 436862 cesu 98 436878 cf 12 436976 cfe 12 436988 cfg 16 437000 cfu 8 437016 ch 18 437024 ch03 6 437042 change 128 437048 changeandvalidate 5 437176 changeattributes 10 437181 changeautorefresh 132 437191 changecurrentparent 33 437323 changed 5 437356 changedate 22 437361 changedbyconfigurationextensions 627 437383 changedconfigurationextensionsmetadatamodifiesdatastructure 11 438010 changeddatacontent 11 438021 changedindexescontent 11 438032 changedrowcount 5 438043 changeeditingmode 88 438048 changehierarchicalview 33 438136 changelistitem 6 438169 changeposition 11 438175 changepositionofcolumns 11 438186 changerecord 6 438197 changerow 30 438203 changeroworder 86 438233 changerowset 20 438319 changes 84 438339 changesetting 11 438423 changesettingofcolumns 11 438434 changevisible 11 438445 changewindowappearancemode 11 438456 channel 34 438467 channels 9 438501 char 95 438510 characterfont 18 438605 characteristic 1218 438623 characteristicextvalues 9 439841 characteristickindcodesseries 24 439850 characteristics 233 439874 characteristicsdescription 65 440107 characteristicsdescriptions 20 440172 characteristictypemainpresentation 24 440192 characteristictypes 9 440216 characteristictypesfilterobject 9 440225 characteristictypesquery 9 440234 characteristictypestable 9 440243 characteristicvalues 9 440252 characteristicvaluesquery 9 440261 characteristicvaluestable 9 440270 charcode 10 440279 charofaccountcodeseries 24 440289 chars 42 440313 charset 31 440355 chart 4216 440386 chart3ddepth 30 444602 chartanimation 21 444632 chartanimations 6 444653 chartappearance 5 444659 chartaxis 31 444664 chartbodytemplate 5 444695 chartboundarydetectionmethod 20 444700 chartbubblesizevaluesource 21 444720 chartbubblesizing 47 444741 chartcolorpalette 86 444788 chartcolorpalettedescription 36 444874 chartcolors 6 444910 chartdatatableformat 5 444916 chartdroplinesshowmode 4 444921 chartfield 9 444925 chartgridlinesshowmode 20 444934 chartgroup 10 444954 chartgroupappearance 5 444964 chartgroupoutputparametervalues 5 444969 chartgrouptemplate 9 444974 charthierarchicalgroup 5 444983 chartlabelarea 66 444988 chartlabellocation 61 445054 chartlabelsorientation 26 445115 chartlabeltype 122 445141 chartlegendarea 65 445263 chartlegendplacement 41 445328 chartlinetype 36 445369 chartmarkertype 36 445405 chartofaccounts 378 445441 chartofaccountsextdimensiontypes 108 445819 chartofaccountsextdimensiontypesrow 36 445927 chartofaccountslist 30 445963 chartofaccountsmanager 156 445993 chartofaccountsobject 308 446149 chartofaccountsref 163 446457 chartofaccountsselection 120 446620 chartofcalculationtypes 358 446740 chartofcalculationtypesbaseuse 29 447098 chartofcalculationtypescodetype 25 447127 chartofcalculationtypeslist 30 447152 chartofcalculationtypesmanager 144 447182 chartofcalculationtypesobject 278 447326 chartofcalculationtypesref 133 447604 chartofcalculationtypesselection 102 447737 chartofcharacteristictypes 379 447839 chartofcharacteristictypeslist 30 448218 chartofcharacteristictypesmanager 174 448248 chartofcharacteristictypesobject 296 448422 chartofcharacteristictypesref 145 448718 chartofcharacteristictypesselection 102 448863 chartorientation 16 448965 chartoutputparametervalues 6 448981 chartplotarea 140 448987 chartplotareaplacement 21 449127 chartpoint 30 449148 chartpoints 45 449178 chartpointsaxisvaluessource 48 449223 chartpointsconnectiontype 21 449271 chartreferenceband 76 449292 chartreferencebandborderposition 21 449368 chartreferencebands 41 449389 chartreferenceline 51 449430 chartreferencelineposition 21 449481 chartreferencelines 41 449502 chartresourceappearance 4 449543 chartresourcetemplate 4 449547 chartreuse 11 449551 chartscale 111 449562 chartscalelabellocation 25 449673 chartscalelabelposition 4 449698 chartscalelocation 20 449702 chartscalemarklocation 30 449722 chartscalemarkposition 4 449752 chartscaleposition 4 449756 chartscaletitleplacement 21 449760 chartscaletitletextmode 4 449781 chartscaletitletextsource 20 449785 chartselectionmode 26 449805 chartsemitransparencymode 26 449831 chartseries 110 449857 chartseriesaddtype 4 449967 chartseriescollection 45 449971 chartseriesgraphicalrepresentationtype 35 450016 chartseriesorderinlegend 21 450051 chartseriesstacktype 25 450072 chartseriesvisualtype 4 450097 chartsofaccounts 19 450101 chartsofaccountsmanager 18 450120 chartsofaccountsoptions 6 450138 chartsofcalculationtypes 19 450144 chartsofcalculationtypesmanager 18 450163 chartsofcalculationtypesoptions 6 450181 chartsofcharacteristictypes 19 450187 chartsofcharacteristictypesmanager 18 450206 chartsofcharacteristictypesoptions 6 450224 chartspacemode 21 450230 chartsplinemode 16 450251 chartsviewsettings 11 450267 charttemplate 4 450278 charttitlearea 65 450282 charttitleareaplacement 51 450347 charttrendline 71 450398 charttrendlineapproximationtype 31 450469 charttrendlinefactor 21 450500 charttrendlines 41 450521 charttype 530 450562 charttypechoosedialog 29 451092 chartvalue 39 451121 chartvalueeditstate 21 451160 chartvaluelabelformat 5 451181 chartvaluesbyseriesconnectiontype 16 451186 chartvalueseditmode 21 451202 chartvaluestooltipfilltype 21 451223 chartvaluestooltipshowmode 25 451244 check 167 451269 checkacknowledged 9 451436 checkaddinattachment 10 451445 checkall 12 451455 checkattachment 12 451467 checkavailability 9 451479 checkavailabilityofenablinggeofencesmonitoring 9 451488 checkbit 10 451497 checkbox 111 451507 checkboxfield 9 451618 checkboxthreestate 11 451627 checkboxtype 34 451638 checkbybitmask 10 451672 checkbylocation 9 451682 checkcanapply 9 451691 checkcanapplyall 9 451700 checkcertificate 9 451709 checkcertificateasync 9 451718 checkconfigurationsignatureforexactmatch 9 451727 checkdata 11 451736 checked 9 451747 checkexecution 11 451756 checkfileexistence 9 451767 checkfilling 263 451776 checkfordatainsignature 9 452039 checkfordatainsignatureasync 9 452048 checkindex 9 452057 checkitems 11 452066 checkitemsasync 11 452077 checkmobileclientusageability 9 452088 checkpasswordcompliancewithpolicy 9 452097 checkpasswordcompromise 10 452106 checkpurchased 9 452116 checkput 12 452125 checkrow 21 452137 checkscriptcircularrefs 10 452158 checksyntax 12 452168 checkunique 63 452180 checkuserpasswordcompliancewithstoredvalue 10 452243 checkvalue 11 452253 chess 9 452264 child 9 452273 childformitemsgroup 25 452282 childformitemswidth 35 452307 childitems 36 452342 childitemshorizontalalign 27 452378 childitemsverticalalign 27 452405 childnodes 378 452432 chocolate 12 452810 choice 32 452822 choiceavailable 63 452854 choicebutton 31 452917 choicebuttonpicture 31 452948 choicebuttonrepresentation 34 452979 choicebyadding 10 453013 choicebyowner 11 453023 choicebyownerparameter 11 453034 choicedatagetmodeoninputbystring 105 453045 choicedatagetprocessing 121 453150 choicedatagettingmode 16 453271 choicedatagettingmodeoninputbystring 4 453287 choicefoldersanditems 256 453291 choicefoldersanditemsparameter 22 453547 choiceform 139 453569 choicehistoryoninput 195 453708 choicehistorysettings 11 453903 choiceincomplete 11 453914 choiceinitialvalue 11 453925 choicelist 41 453936 choicelistbutton 20 453977 choicelistheight 31 453997 choicelistwidth 22 454028 choicemode 230 454050 choiceparameter 23 454280 choiceparameterlink 24 454303 choiceparameterlinks 77 454327 choiceparameters 185 454404 choiceprocessing 76 454589 choose 72 454665 chooseaction 11 454737 chooseactionasync 11 454748 chooseasync 36 454759 choosedirectory 18 454795 choosefromlist 25 454813 choosefromlistasync 9 454838 choosefrommenu 20 454847 choosefrommenuasync 9 454867 chooseitem 11 454876 chooseitemasync 11 454887 chooserow 22 454898 choosetoplevel 11 454920 choosetype 31 454931 chooseusermessage 9 454962 choosevalue 11 454971 chosenaction 11 454982 chosenactionparameter 11 454993 chou 17 455004 chrome 36 455021 chromium 21 455057 ci 7 455078 cid 9 455085 circle 27 455094 circularrefsmembers 5 455121 city 41 455126 cityblock 9 455167 cl 12 455176 class 5 455188 classcount 9 455193 classic 9 455202 classic2 9 455211 classic3 9 455220 classid 4 455229 classification 9 455233 classifications 9 455242 classname 18 455251 clear 2050 455269 clearaccumulatedperformanceindicators 9 457319 clearaccumulatedvalues 11 457328 clearaggregates 11 457339 clearall 9 457350 clearbinarydatastorageunusedspace 15 457359 clearbutton 31 457374 cleardatabase 9 457405 cleardeletedmassages 9 457414 cleareventlog 10 457423 clearfiledialogresult 9 457433 clearfilter 12 457442 clearindex 9 457454 clearing 32 457463 clearitemconditionalappearance 11 457495 clearitemfilter 11 457506 clearitemorder 11 457517 clearitemoutputparameters 11 457528 clearitemselection 11 457539 clearmarkincomplete 10 457550 clearmessages 10 457560 clearportranges 11 457570 clearunusedspace 11 457581 clearunusedspacebyuniversaldate 18 457592 clearusersettings 10 457610 click 114 457620 clickformatteddocumenthyperlink 9 457734 clickformattedstringhyperlink 18 457743 clickhtmldocumenthyperlink 9 457761 clickviewstatusitem 9 457770 client 1116 457779 clientapplication 74 458895 clientapplicationagent 9 458969 clientapplicationagentmanager 50 458978 clientapplicationagentstate 20 459028 clientapplicationbasefontvariant 15 459048 clientapplicationform 625 459063 clientapplicationformscalevariant 29 459688 clientapplicationinterface 9 459717 clientapplicationinterfacecontentsettings 29 459726 clientapplicationinterfacecontentsettingsgroup 49 459755 clientapplicationinterfacecontentsettingsitem 14 459804 clientapplicationinterfacecurrentvariant 10 459818 clientapplicationinterfacesettings 31 459828 clientapplicationinterfacevariant 24 459859 clientapplicationtype 36 459883 clientapplicationwindow 35 459919 clientapplicationwindows 15 459954 clientcertificate 18 459969 clientconnectionspeed 24 459987 clientdisplayinformation 20 460011 clientid 14 460031 clientinfo 11 460045 clientipaddress 20 460056 clientmanagedapplication 9 460076 clientnotificationmanager 20 460085 clientnotifications 10 460105 clientordinaryapplication 9 460115 clientrunmode 21 460124 clientsentreceiveddatasize 11 460145 clientsentreceiveddatasizelast5min 11 460156 clientsettings 46 460167 clienttestingservice 20 460213 clientusesstandaloneserver 9 460233 clipboarddatastandardformat 20 460242 clipboarditem 22 460262 clipboardtools 45 460284 clipdata 18 460329 clonecomponent 352 460347 clonelistitem 12 460699 clonenode 378 460711 cloneobject 12 461089 close 272 461101 closeandgetbinarydata 9 461373 closeasync 63 461382 closebarcodescanning 9 461445 closed 9 461454 closedocumentscanning 9 461463 closedroplist 9 461472 closefile 9 461481 closehelp 10 461490 closeonchoice 27 461500 closeonownerclose 27 461527 closeusermessagespanel 9 461554 closing 9 461563 closingbalance 42 461572 closingbalancecr 22 461614 closingbalancedr 22 461636 closingsplittedbalancecr 22 461658 closingsplittedbalancedr 22 461680 cloud 28 461702 cluster 29 461730 clusteradministrator 36 461759 clusteradminname 6 461795 clusterconfigservice 10 461801 clustercount 4 461811 clusterid 11 461815 clusterizationmethod 30 461826 clusterizationobjects 9 461856 clusterizationtable 9 461865 clustermainport 14 461874 clustermanagerid 11 461888 clustermanagers 19 461899 clustername 14 461918 clusters 25 461932 clusterstateservice 10 461957 cms 91 461967 cn 491 462058 cn1 6 462549 cn2 6 462555 cntr 17 462561 co 12 462578 codabar 21 462590 code 313 462611 code128 20 462924 code39 20 462944 code93 20 462964 codeallowedlength 36 462984 codebase 18 463020 codelength 45 463038 codemask 9 463083 codes 4 463092 codeseries 28 463096 codetype 28 463124 cold 9 463152 collaborationsystem 10 463161 collaborationsystemapplication 15 463171 collaborationsystemapplicationid 9 463186 collaborationsystemapplicationidcollection 34 463195 collaborationsystemapplicationlinks 24 463229 collaborationsystemattachment 45 463253 collaborationsystemattachmentcollection 50 463298 collaborationsystembot 40 463348 collaborationsystembots 6 463388 collaborationsystemcommanddescription 34 463394 collaborationsystemcommandsource 35 463428 collaborationsystemconversation 60 463463 collaborationsystemconversationcontext 14 463523 collaborationsystemconversationid 9 463537 collaborationsystemconversations 9 463546 collaborationsystemconversationsfilter 64 463555 collaborationsystemdatadump 35 463619 collaborationsystemdatadumpid 9 463654 collaborationsystemdatadumpstatus 30 463663 collaborationsystemerror 9 463693 collaborationsystemexternalsystemdescription 15 463702 collaborationsystemexternalsystemparameterdescription 15 463717 collaborationsystemexternaluser 11 463732 collaborationsystemexternaluserinvitationprocessing 10 463743 collaborationsystemfromdatadumprestorestatus 15 463753 collaborationsystemgeneratecommandparameters 40 463768 collaborationsysteminfobaseregistration 6 463808 collaborationsysteminfobaseregistrationdata 5 463814 collaborationsysteminfobaseregistrationparameters 29 463819 collaborationsysteminfobaseregistrationresult 15 463848 collaborationsystemintegration 65 463863 collaborationsystemintegrationid 5 463928 collaborationsystemintegrationuser 12 463933 collaborationsystemmanager 505 463945 collaborationsystemmessage 80 464450 collaborationsystemmessageaction 20 464530 collaborationsystemmessageactioncollection 50 464550 collaborationsystemmessagebuttonpanel 15 464600 collaborationsystemmessagebuttonpanelbutton 45 464615 collaborationsystemmessagebuttonpanelbuttonaction 40 464660 collaborationsystemmessagebuttonpanelbuttonclickprocessing 9 464700 collaborationsystemmessagebuttonpanelbuttonrow 45 464709 collaborationsystemmessagebuttonpanelbuttonrows 45 464754 collaborationsystemmessagebuttonpanelbuttontype 15 464799 collaborationsystemmessageid 9 464814 collaborationsystemmessageprocessing 9 464823 collaborationsystemmessages 9 464832 collaborationsystemmessagesfilter 29 464841 collaborationsystemmessagetemplate 40 464870 collaborationsystemmessagetemplatechoiceprocessing 10 464910 collaborationsystemmessagetemplateid 9 464920 collaborationsystemnotification 10 464929 collaborationsystemnotificationrepresentation 15 464939 collaborationsystemregistrationdata 8 464954 collaborationsystemstandardcommand 75 464962 collaborationsystemstandardusers 10 465037 collaborationsystemuser 97 465047 collaborationsystemuserid 13 465144 collaborationsystemuseridcollection 34 465157 collaborationsystemusersautocomplete 20 465191 collaborationsystemuserschoiceformgetprocessing 20 465211 collaborationsystemuserschoicepurpose 20 465231 collaborationsystemusersfilter 70 465251 collapse 68 465321 collapseall 12 465389 collapsedimensionitem 9 465401 collapsedrepresentationtitle 9 465410 collapseformitemsbyimportance 20 465419 collapseitems 9 465439 collapseitemsbyimportance 9 465448 collapsepoint 9 465457 collapseseries 9 465466 collapsible 9 465475 collate 29 465484 collectactivesessionscount 11 465513 collectcallscount 11 465524 collectcallsduration 11 465535 collectcputime 11 465546 collectdbmscallsduration 11 465557 collectdbmssentandreceiveddatasize 11 465568 collectionindex 6 465579 collectionindexes 30 465585 collectiontime 22 465615 collectmemoryusage 11 465637 collectreaddiskdatasize 11 465648 collectservicecallsduration 11 465659 collectsessioncount 11 465670 collectwritediskdatasize 11 465681 color 244 465692 colorchoosedialog 29 465936 colordepth 39 465965 colorinchart 9 466004 colorpalette 19 466013 colorpalettedescription 32 466032 colorpriority 36 466064 colortype 30 466100 cols 9 466130 colspan 9 466139 column 852 466148 column3d 27 467000 columndimensions 9 467027 columneditmode 20 467036 columngroup 9 467056 columngroupfooter 6 467065 columngroupheader 6 467071 columngrouplevelcount 12 467077 columnhierarchicalgroupfooter 6 467089 columnhierarchicalgroupheader 6 467095 columnlocation 20 467101 columnname 9 467121 columns 365 467130 columnscount 20 467495 columnsettings 9 467515 columnsgroup 20 467524 columnsheadersarea 11 467544 columnsizechange 15 467555 columnsizechangemode 22 467570 columnssetting 63 467592 columnstotalplacement 11 467655 columnstotalsposition 11 467666 columnstotaltemplate 11 467677 columntype 18 467688 columnwidth 12 467706 com 933 467718 combinepartial 9 468651 combobox 174 468660 comclassname 7 468834 comconnection 71 468841 comconnector 39 468912 comconsole 13 468951 comfullaccess 14 468964 command 369 468978 commandbar 135 469347 commandbarbutton 105 469482 commandbarbuttonalignment 20 469587 commandbarbuttonorder 20 469607 commandbarbuttonrepresentation 25 469627 commandbarbuttons 66 469652 commandbarbuttontype 20 469718 commandbarhyperlink 9 469738 commandbarlocation 18 469747 commandexecuteparameters 30 469765 commandgenerateprocessing 19 469795 commandgroup 85 469814 commandgroupcategory 25 469899 commandgroups 9 469924 commandinterface 18 469933 commandinterfacecommand 10 469951 commandinterfacefragment 10 469961 commandinterfacesettings 31 469971 commandmask 14 470002 commandmodule 18 470016 commandname 9 470034 commandparametertype 18 470043 commandparameterusemode 15 470061 commandprocessing 9 470076 commands 189 470085 commandstring 11 470274 commanduniqueness 9 470285 comment 853 470294 commit 47 471147 committed 9 471194 committransaction 21 471203 common 970 471224 commonattribute 200 472194 commonattributeauthenticationseparation 24 472394 commonattributeautouse 24 472418 commonattributeconfigurationextensionsseparation 24 472442 commonattributecontent 20 472466 commonattributecontentitem 20 472486 commonattributedataseparation 24 472506 commonattributes 9 472530 commonattributeseparateddatause 24 472539 commonattributeuse 29 472563 commonattributeusersseparation 24 472592 commoncommand 110 472616 commoncommands 9 472726 commonform 6 472735 commonforms 9 472741 commonmodule 125 472750 commonmodules 9 472875 commonname 8 472884 commonpicture 70 472892 commonpictures 9 472962 commonseries 9 472971 commonsettingsstorage 26 472980 commontemplates 9 473006 communication 4 473015 comobject 43 473019 comobjectfullaccess 47 473062 compact 27 473109 company 9 473136 compare 40 473145 comparedocumentposition 378 473185 comparemethod 9 473563 comparevalues 14 473572 comparisonsettings 12 473586 comparisontype 127 473598 compatibilitymode 174 473725 complement 17 473899 complete 62 473916 completed 62 473978 completedsuccessfully 9 474040 completedwitherror 18 474049 completioninterval 9 474067 completiontime 9 474076 complex 9 474085 complextypedefinition 9 474094 component 352 474103 components 352 474455 componenttype 352 474807 composer 45 475159 composeresult 31 475204 compositewordsseparationmode 20 475235 composition 841 475255 compositionoutputparametervalues 6 476096 compositor 11 476102 compressedsize 20 476113 computationalresourcesusage 9 476133 computer 27 476142 computerdata 9 476169 computername 117 476178 comsafearray 359 476295 com:;0AA 6 476654 com>1J5:B 92 476660 comA>548=5=85 48 476752 comA>548=8B5;L 8 476800 concat 9 476808 concatbinarydata 10 476817 concatbinarydatabuffers 10 476827 concavesurface 9 476837 condition 139 476846 conditional 34 476985 conditionalappearance 186 477019 conditionalappearanceitem 47 477205 conditionalappearancesetting 59 477252 conditionalappearancesettingcontrol 18 477311 conditionalseparation 18 477329 conditioncheck 11 477347 conf 21 477358 confidence 31 477379 config 215 477410 configchangerecord 6 477625 configextensionapplyerror 36 477631 configextensionupdate 36 477667 configextpropertieschangerecord 6 477703 configupdate 36 477709 configupdateerror 36 477745 configurationchanged 21 477781 configurationchangesdescriptioninexchangemessage 24 477802 configurationdescription 24 477826 configurationerror 9 477850 configurationextension 718 477859 configurationextensionapplicationissueinformation 20 478577 configurationextensionapplicationissueseverity 20 478597 configurationextensioncompatibilitymode 10 478617 configurationextensionpurpose 38 478627 configurationextensions 10 478665 configurationextensionsadministration 6 478675 configurationextensionschanged 20 478681 configurationextensionscope 15 478701 configurationextensionsinformation 6 478716 configurationextensionsmanager 40 478722 configurationextensionsseparation 9 478762 configurationextensionssource 20 478771 configurationinformationaddress 9 478791 configurationmetadataobject 654 478800 configurationunloaddelaybyworkingprocesswithoutactiveusers 61 479454 configurationupdatedescription 19 479515 coniclambertequalareaprojection 9 479534 connect 213 479543 connectablewindow 11 479756 connectagent 38 479767 connected 27 479805 connectedat 28 479832 connectedcomponentsofsystemoflinearequationscalculationgettingmethod 20 479860 connectexternaldatasource 10 479880 connection 114 479890 connectionid 33 480004 connectionname 9 480037 connectionnumber 29 480046 connectionparameters 18 480075 connections 23 480093 connectionsecuritylevel 11 480116 connectionsperworkingprocesslimit 14 480127 connectionssecuritylevel 47 480141 connectionstarted 9 480188 connectionstoprequest 25 480197 connectionstring 46 480222 connectiontime 11 480268 connector 87 480279 connectorlinetype 35 480366 connectortextlocation 15 480401 connectunskippedvalues 9 480416 connectwithbasevalue 9 480425 connectworkingprocess 33 480434 connid 28 480467 consequent 13 480495 consortium 5 480508 const 13 480513 constant 503 480526 constantmanager 42 481029 constants 80 481071 constantschangerecord 6 481151 constantsform 16 481157 constantsmanager 24 481173 constantsset 36 481197 constantvaluekey 30 481233 constantvaluemanager 98 481263 constraint 90 481361 constraints 6 481451 consumepurchase 9 481457 contact 9 481466 contactaccount 16 481475 contactdata 134 481491 contactdataaddresstype 20 481625 contactdataelement 4 481645 contactdataelementinstantmessaging 4 481649 contactdataemailaddresstype 25 481653 contactdatainstantmessagingaddresstype 20 481678 contactdataitem 19 481698 contactdataiteminstantmessaging 24 481717 contactdataphonenumbertype 55 481741 contactdatarelationshiptype 75 481796 contactdataurltype 40 481871 contacteditingsupported 9 481911 contactmanager 64 481920 contacts 9 481984 contactsaddingsupported 9 481993 contain 523 482002 containedby 9 482525 container 352 482534 contains 523 482886 containsaggregatefunction 9 483409 containsdataasync 10 483418 containskey 9 483428 containstype 9 483437 containsvalue 22 483446 content 214 483468 contentdeleted 9 483682 contentforsale 9 483691 contentmodel 11 483700 contentmodelannotation 11 483711 context 3804 483722 contextconversation 9 487526 contextmenu 56 487535 contiguous 9 487591 contiguousfields 9 487600 continue 30 487609 contour 9 487639 contours 9 487648 control 476 487657 controlborder 11 488133 controlbordertype 51 488144 controlcollapsemode 30 488195 controledge 30 488225 controlnavigation 9 488255 controlrepresentation 9 488264 controls 363 488273 conversation 48 488636 conversationcontext 18 488684 conversationcontextmatching 9 488702 conversationmember 9 488711 conversations 12 488720 conversationsrepresentation 9 488732 conversiontocanonicalxml 24 488741 convert 9 488765 convertedlinedelimiter 9 488774 convertiblesplitteroflines 9 488783 converttocompactmode 12 488792 converttograyscale 27 488804 converttograyscaleasync 18 488831 convexsurface 9 488849 coordinate 27 488858 coordinates 27 488885 coords 9 488912 copies 29 488921 copper 9 488950 copy 351 488959 copyandmove 9 489310 copyattachment 9 489319 copycolumns 11 489328 copydatabaseuseinformation 15 489339 copydatabaseusevariant 25 489354 copyeventlog 10 489379 copyfileasync 10 489389 copyformdata 10 489399 copyingobjectparameter 99 489409 copyingvalue 81 489508 copymessage 9 489589 copyright 9 489598 copyrow 30 489607 copystate 9 489637 copyto 36 489646 copytoasync 36 489682 copytoclipboard 9 489718 copyurl 23 489727 coral 11 489750 core 368 489761 cornflowerblue 11 490129 cornsilk 12 490140 correlationid 18 490152 correspondence 9 490170 cors 29 490179 cos 43 490208 cost 21 490251 count 2841 490272 counter 11 493113 counterservice 20 493124 country 42 493144 countryname 8 493186 courier 6 493194 cover 9 493200 covered 9 493209 cp 21 493218 cp1006 127 493239 cp1025 127 493366 cp1097 129 493493 cp1098 132 493622 cp1112 136 493754 cp1122 136 493890 cp1123 136 494026 cp1124 112 494162 cp1125 112 494274 cp1131 112 494386 cp1386 112 494498 cp2 7 494610 cp33722 112 494617 cp437 136 494729 cp737 136 494865 cp775 136 495001 cp850 136 495137 cp851 136 495273 cp852 136 495409 cp855 112 495545 cp856 136 495657 cp857 136 495793 cp858 136 495929 cp860 136 496065 cp861 136 496201 cp862 136 496337 cp863 136 496473 cp864 136 496609 cp865 136 496745 cp866 350 496881 cp868 136 497231 cp869 136 497367 cp874 136 497503 cp875 136 497639 cp922 136 497775 cp930 136 497911 cp932 112 498047 cp933 136 498159 cp935 136 498295 cp937 136 498431 cp939 136 498567 cp949 112 498703 cp949c 112 498815 cp950 112 498927 cp964 112 499039 cps 4 499151 cputime 22 499155 cputimeall 14 499177 cputimecurrent 25 499191 cputimelast5min 25 499216 cputimetotal 11 499241 cr 103 499252 cram 20 499355 crammd5 18 499375 crc32 18 499393 cream 11 499411 create 146 499422 createaccount 11 499568 createaddinobjectasync 10 499579 createadministrator 11 499589 createallowedaddin 11 499600 createallowedcomclass 11 499611 createallowedexternalapplication 11 499622 createallowedexternalmodule 11 499633 createallowedinternetresource 11 499644 createallowedvirtualdirectory 11 499655 createassignmentrule 26 499666 createasync 9 499692 createattribute 18 499701 createbinarydatafromfileasync 10 499719 createbinarydatastoragedifferentialbackup 15 499729 createbinarydatastoragefullbackup 15 499744 createbot 10 499759 createbusinessprocess 11 499769 createbutton 9 499780 createcalculationtype 11 499789 createcaption 9 499800 createcdatasection 9 499809 createclient 9 499818 createcluster 11 499827 createclusteradmininfo 20 499838 createclusteradministrator 11 499858 createclusterinfo 45 499869 createcolumns 11 499914 createcomment 18 499925 createconversation 10 499943 createdatabase 20 499953 createdifferentialbackup 20 499973 createdirectory 19 499993 createdirectoryasync 10 500012 createdocument 11 500022 createdocumentfragment 9 500033 createelement 19 500042 createentityreference 9 500061 createfile 9 500070 createfolder 34 500079 createformatofrows 12 500113 createfullbackup 20 500125 createindex 9 500145 createinfobase 38 500154 createinfobaseinfo 32 500192 createinitialimage 23 500224 createintegration 10 500247 createitem 36 500257 createlicenseacquisitionrequestbyphone 9 500293 createlicenseacquisitionrequestonstoragedevice 9 500302 createlist 9 500311 createlistitem 12 500320 createmailbox 9 500332 createmanagerforeachservice 11 500341 createmessage 19 500352 createmessagereader 11 500371 createmessagewriter 11 500382 createnew 9 500393 createnode 11 500402 createnodeiterator 18 500413 creatensresolver 9 500431 createobject 33 500440 createoninput 192 500473 createpolicy 9 500665 createportrange 15 500674 createpredictionmodel 36 500689 createprocessinginstruction 9 500725 createrecordkey 66 500734 createrecordmanager 33 500800 createrecordset 88 500833 createresourceconsumptioncounter 11 500921 createresourceconsumptionlimit 11 500932 createscheduledjob 9 500943 createsecurityprofile 26 500952 createsecurityprofileaddin 15 500978 createsecurityprofileapplication 15 500993 createsecurityprofilecomclass 15 501008 createsecurityprofileinternetresource 15 501023 createsecurityprofileunsafeexternalmodule 15 501038 createsecurityprofilevirtualdirectory 15 501053 createservicesetting 26 501068 createset 11 501094 createtask 11 501105 createtempfile 9 501116 createtempfileasync 9 501125 createtemplate 9 501134 createtextnode 18 501143 createtfoot 9 501161 createthead 9 501170 createtreewalker 18 501179 createuser 19 501197 createusersettingsformitems 27 501216 createvaluekey 11 501243 createvaluemanager 11 501254 createworkingserverinfo 25 501265 createworkserver 11 501290 createwsproxy 9 501301 createxdtofactory 10 501310 createxmlschema 11 501320 createxpathexpression 9 501331 createxscomponent 11 501340 creating 30 501351 creationdate 9 501381 creationtime 11 501390 credit 30 501401 creditcardnumber 9 501431 crimson 11 501440 criteria 11 501451 criterion 71 501462 critical 9 501533 criticalprocessestotalmemory 25 501542 crl 10 501567 cron 20 501577 crsqldb 6 501597 cryptoapilibrarylocation 12 501603 cryptoavailable 47 501615 cryptocertificate 132 501662 cryptocertificatecheckmode 25 501794 cryptocertificateincludemode 25 501819 cryptocertificatestore 110 501844 cryptocertificatestoreplacement 20 501954 cryptocertificatestoretype 25 501974 cryptographyallowed 14 501999 cryptointeractivemodeuse 15 502013 cryptokeyscontainer 42 502028 cryptomanager 302 502070 cryptomoduleinformation 30 502372 cryptomoduletype 9 502402 cryptoprosecureconnection 24 502411 cryptosignature 60 502435 cryptosignaturescontainer 10 502495 cryptosignaturetype 60 502505 cryptotimestamp 15 502565 cryptotools 30 502580 cs 34 502610 csp 19 502644 css 14 502663 ct 5 502677 ctod 4 502682 ctrl 165 502686 cu 7 502851 cube 556 502858 cubes 20 503414 cumulativefrequency 4 503434 cumulativerelativefrequency 4 503438 currency 9 503442 current 217 503451 currentapplicationid 9 503668 currentarea 20 503677 currentbasefontvariant 9 503697 currentbiometricverificationmethod 9 503706 currentcheck 9 503715 currentcolumn 11 503724 currentcontrol 11 503735 currentdata 28 503746 currentdataoflist 12 503774 currentdatasettingskey 7 503786 currentdate 21 503793 currentday 9 503814 currentdbmscallduration 11 503823 currentenable 63 503834 currentframenumber 9 503897 currenthalfyear 9 503906 currenthour 9 503915 currentindex 9 503924 currentinterfacevariant 9 503933 currentinterval 9 503942 currentitem 50 503951 currentlanguage 10 504001 currentline 9 504011 currentlineparameter 154 504020 currentlocalecode 10 504174 currentmailbox 9 504184 currentminute 9 504193 currentmode 9 504202 currentmodeisedit 18 504211 currentmodified 9 504229 currentmonth 9 504238 currentnode 9 504247 currentopened 9 504256 currentorfirst 9 504265 currentorlast 9 504274 currentosuser 60 504283 currentpage 29 504343 currentpagenumber 9 504372 currentpagesstate 9 504381 currentpageurl 9 504390 currentparent 21 504399 currentperformer 9 504420 currentposition 36 504429 currentquarter 9 504465 currentreadonly 54 504474 currentrepresentationperiods 9 504528 currentrow 50 504537 currentrowuse 56 504587 currentrunmode 10 504643 currentsectionfunctionspanel 4 504653 currentservicename 39 504657 currentsessiondate 10 504696 currentsessionistested 10 504706 currentsettingskey 22 504716 currentsystemlanguage 10 504738 currenttendays 9 504748 currentuniversaldate 10 504757 currentuniversaldateinmilliseconds 10 504767 currentupdateinprogress 9 504777 currentupdatetransactionscount 9 504786 currentuser 9 504795 currentuserid 9 504804 currentuserismember 9 504813 currentuserissubscriberadministrator 10 504822 currentusersettings 10 504832 currentusersettingskey 28 504842 currentusersettingspresentation 9 504870 currentvalue 18 504879 currentvaluetype 9 504897 currentvariantkey 15 504906 currentvariantpresentation 9 504921 currentvisible 54 504930 currentweek 9 504984 currentyear 9 504993 custom 49 505002 customangle 9 505051 customexpression 12 505060 customfield 72 505072 customfields 60 505144 customization 9 505204 customizeform 12 505213 customizelist 12 505225 customquery 9 505237 customtext 9 505246 customtexttype 9 505255 cut 36 505264 cute 36 505300 cy 23 505336 cyan 12 505359 cylindricalequidistantprojection 9 505371 cylindricalgallstereographicprojection 9 505380 cylindricallambertequalareaprojection 9 505389 cylindricalmillerprojection 9 505398 cyrillic 355 505407 cyrl 36 505762 cz 12 505798 cü 7 505810 c1 7 505817 c5:@5B=K9 5 505824 c5@28A 38 505829 c5@28A>2 5 505867 c8=>=8< 4 505872 c8=B0:A8A 10 505876 c:0=8@>20==K9 4 505886 c>1KB8O 7 505890 c>45@60I0O 4 505897 c>45@68B 4 505901 c>548=5=8O 9 505905 c?@02>G=0O 4 505914 c@54AB2 9 505918 c@54AB20<8 8 505927 cB@>:01 5 505935 cB@>:02 5 505940 d 131 505945 d0 47 506076 d1 33 506123 da 14 506156 daily 9 506170 darkblue 12 506179 darkcyan 12 506191 darkgoldenrod 12 506203 darkgray 12 506215 darkgreen 12 506227 darkkhaki 12 506239 darkmagenta 12 506251 darkolivegreen 12 506263 darkorange 12 506275 darkorchid 12 506287 darkred 12 506299 darksalmon 11 506311 darkseagreen 12 506322 darkslateblue 12 506334 darkslategray 12 506346 darkturquoise 12 506358 darkviolet 12 506370 dart 9 506382 darts 9 506391 dash 36 506400 dashdotted 36 506436 dashdotteddotted 36 506472 dashed 36 506508 data 3418 506544 dataacceleratordatalocationvariant 9 509962 dataacceleratordatastoragevariant 15 509971 dataacceleratorprocessingdata 9 509986 dataacceleratorservice 24 509995 dataadministration 6 510019 dataanalysis 34 510025 dataanalysisassociationrules 13 510059 dataanalysisassociationrulesordertype 21 510072 dataanalysisassociationrulesresult 50 510093 dataanalysiscluster 20 510143 dataanalysisclusterization 13 510163 dataanalysisclusterizationcolumnparameters 15 510176 dataanalysisclusterizationresult 50 510191 dataanalysiscolumn 25 510241 dataanalysiscolumns 30 510266 dataanalysiscolumnscontrol 15 510296 dataanalysiscolumnssetting 40 510311 dataanalysiscolumntypeassociationrules 21 510351 dataanalysiscolumntypeclusterization 31 510372 dataanalysiscolumntypedecisiontree 21 510403 dataanalysiscolumntypesequentialpatterns 26 510424 dataanalysiscolumntypesummarystatistics 16 510450 dataanalysiscontiguousfieldinformation 45 510466 dataanalysisdecision 20 510511 dataanalysisdecisiontree 13 510531 dataanalysisdecisiontreeresult 60 510544 dataanalysisdiscretefieldinformation 30 510604 dataanalysisdistancemetrictype 26 510634 dataanalysisfield 24 510660 dataanalysisfieldtype 15 510684 dataanalysisfieldvalue 15 510699 dataanalysisnumericvalueusetype 16 510714 dataanalysisobject 28 510730 dataanalysisobjectclassification 20 510758 dataanalysisobjectproperty 30 510778 dataanalysisparameter 25 510808 dataanalysisparameters 30 510833 dataanalysisparameterscontrol 15 510863 dataanalysisparameterssetting 40 510878 dataanalysisreportbuilder 69 510918 dataanalysisresulttablefilltype 26 510987 dataanalysissequentialpattern 35 511013 dataanalysissequentialpatterns 13 511048 dataanalysissequentialpatternsordertype 16 511061 dataanalysissequentialpatternsresult 35 511077 dataanalysisstandardizationtype 16 511112 dataanalysissummarystatistics 13 511128 dataanalysissummarystatisticsresult 30 511141 dataanalysistimeintervalunittype 102 511171 dataarea 11 511273 databar 4 511284 database 38 511288 databaseconfigurationchangeddynamically 10 511326 databaseconfigurationupdate 30 511336 databaseconfigurationupdateexecutioninformationitem 15 511366 databaseconfigurationupdateexecutioninformationitemtype 20 511381 databaseconfigurationupdateservice 20 511401 databaseconfigurationupdatestate 20 511421 databaseconnectionerror 9 511441 databasecopies 9 511450 databasecopiesfillingchanges 6 511459 databasecopiesfillingchangesobjects 6 511465 databasecopiesfillinginfo 6 511471 databasecopiesmanager 50 511477 databasecopiessettings 6 511527 databasecopiesstandardreplicationversion 15 511533 databasecopiestablesstates 6 511548 databasecopiestransactionslogs 6 511554 databasecopiestransactionstables 6 511560 databasecopiesupdates 6 511566 databasecopiesuse 38 511572 databasecopy 7 511610 databasecopycontent 50 511617 databasecopycontentitem 40 511667 databasecopycontentitemfield 25 511707 databasecopycontentitemfields 25 511732 databasecopycontentitemfielduse 20 511757 databasecopycurrentupdatestatistics 6 511777 databasecopydbmstype 20 511783 databasecopyerror 9 511803 databasecopyinfo 60 511812 databasecopyinitialupdatestatistics 6 511872 databasecopylist 6 511878 databasecopymanager 100 511884 databasecopyoutput 6 511984 databasecopyreplicationtype 15 511990 databasecopystate 20 512005 databasecopyturnedoffreason 25 512025 databasecopyupdatestate 35 512050 databasename 47 512085 databaseserver 65 512132 databasetablenumberingservice 20 512197 databasetablespacecontent 48 512217 databasetablespacecontentitem 17 512265 databasetablespaceerror 9 512282 databasetablespacemanager 48 512291 databasetablespaces 16 512339 databasetablespacescontentitems 6 512355 databasetablespacesmanager 54 512361 databasetablespacesusemode 25 512415 databaseuser 56 512440 databaseuserpassword 20 512496 datachangetype 37 512516 datacolumns 9 512553 datacomposition 11 512562 datacompositionaccountingbalancetype 21 512573 datacompositionappearance 47 512594 datacompositionappearancefield 18 512641 datacompositionappearancefieldcollection 54 512659 datacompositionappearancefields 30 512713 datacompositionappearancetemplate 68 512743 datacompositionappearancetemplateappearance 6 512811 datacompositionappearancetemplatearea 54 512817 datacompositionappearancetemplateareaitem 18 512871 datacompositionappearancetemplatelib 99 512889 datacompositionappearancetemplatelibitem 24 512988 datacompositionappearancetemplatewizard 34 513012 datacompositionareadocumenttemplate 10 513046 datacompositionareaparameters 50 513056 datacompositionareatemplate 49 513106 datacompositionareatemplatechartappearance 25 513155 datacompositionareatemplatechartgroupappearance 25 513180 datacompositionareatemplatechartgrouptemplate 20 513205 datacompositionareatemplatechartresourceappearance 25 513225 datacompositionareatemplatechartresourcetemplate 15 513250 datacompositionareatemplatecharttemplate 10 513265 datacompositionareatemplatefield 15 513275 datacompositionareatemplatefieldappearance 25 513290 datacompositionareatemplateitems 45 513315 datacompositionareatemplatetablecell 15 513360 datacompositionareatemplatetablecellappearance 25 513375 datacompositionareatemplatetablecells 45 513400 datacompositionareatemplatetablerow 15 513445 datacompositionareatemplatetype 36 513460 datacompositionareatemplatevaluecollection 14 513496 datacompositionareatemplatevaluecollectioncell 15 513510 datacompositionareatemplatevaluecollectioncells 40 513525 datacompositionareatemplatevaluecollectionheader 14 513565 datacompositionareatemplatevaluecollectionheadercell 20 513579 datacompositionareatemplatevaluecollectionheadercells 45 513599 datacompositionattributesplacement 26 513644 datacompositionautogroupfield 12 513670 datacompositionautoorderitem 12 513682 datacompositionautoselectedfield 18 513694 datacompositionavailablefield 54 513712 datacompositionavailablefieldcollection 30 513766 datacompositionavailablefields 30 513796 datacompositionavailablefielduserestriction 18 513826 datacompositionavailablefielduserestrictions 66 513844 datacompositionavailableparameter 90 513910 datacompositionavailableparametercollection 29 514000 datacompositionavailableparameters 17 514029 datacompositionavailableparameteruserestriction 18 514046 datacompositionavailableparameteruserestrictions 66 514064 datacompositionavailablesettingsobject 12 514130 datacompositionavailablesettingsobjectcollection 30 514142 datacompositionavailablesettingsobjects 12 514172 datacompositionavailablesettingssource 16 514184 datacompositionbalancetype 21 514200 datacompositionchart 78 514221 datacompositionchartgroup 96 514299 datacompositionchartgroupoutputparametervalues 42 514395 datacompositionchartlegendplacement 31 514437 datacompositionchartoutputparametervalues 42 514468 datacompositionchartstructureitemcollection 72 514510 datacompositionchoiceparameter 17 514582 datacompositionchoiceparameterlink 21 514599 datacompositionchoiceparameterlinks 60 514620 datacompositionchoiceparameters 59 514680 datacompositioncomparisontype 107 514739 datacompositionconditionalappearance 66 514846 datacompositionconditionalappearancedisabled 12 514912 datacompositionconditionalappearanceitem 114 514924 datacompositionconditionalappearanceitemcollection 54 515038 datacompositionconditionalappearanceuse 16 515092 datacompositiondatabasecopyoutputtype 20 515108 datacompositiondataparameters 12 515128 datacompositiondataparametervalues 48 515140 datacompositiondatarelevanceoutputtype 20 515188 datacompositiondatasetfieldrole 89 515208 datacompositiondatasetslinktype 16 515297 datacompositiondetailsactionchoiceresult 18 515313 datacompositiondetailsareaparameter 20 515331 datacompositiondetailsareaparameterfieldexpression 15 515351 datacompositiondetailsareaparameterfieldexpressions 50 515366 datacompositiondetailsdata 23 515416 datacompositiondetailsfieldvalue 24 515439 datacompositiondetailsfieldvalues 65 515463 datacompositiondetailsid 6 515528 datacompositiondetailsitems 30 515534 datacompositiondetailsprocess 76 515564 datacompositiondetailsprocessdescription 23 515640 datacompositiondetailsprocessingaction 40 515663 datacompositioneditparameters 47 515703 datacompositionexpression 10 515750 datacompositionexpressionareaparameter 15 515760 datacompositionfield 11 515775 datacompositionfielddetailsitem 30 515786 datacompositionfieldplacement 31 515816 datacompositionfieldstitletype 21 515847 datacompositionfilter 65 515868 datacompositionfilterapplicationtype 20 515933 datacompositionfilteravailablefield 114 515953 datacompositionfilterdisabled 12 516067 datacompositionfilterexpressions 9 516079 datacompositionfilteritem 66 516088 datacompositionfilteritemcollection 54 516154 datacompositionfilteritemgroup 60 516208 datacompositionfilteritemsgrouptype 21 516268 datacompositionfixation 16 516289 datacompositiongroup 96 516305 datacompositiongroupdetailsitem 24 516401 datacompositiongroupfield 42 516425 datacompositiongroupfieldcollection 54 516467 datacompositiongroupfields 48 516521 datacompositiongroupfieldsdisabled 12 516569 datacompositiongroupfieldsplacement 21 516581 datacompositiongroupoutputparametervalues 42 516602 datacompositiongroupplacement 26 516644 datacompositiongroupprocessingdata 24 516670 datacompositiongrouptemplatetype 21 516694 datacompositiongrouptype 21 516715 datacompositiongroupusevariant 15 516736 datacompositionid 6 516751 datacompositionmode 15 516757 datacompositionnestedobjectsettings 66 516772 datacompositionnewchart 12 516838 datacompositionnewgroup 12 516850 datacompositionnewnestedscheme 12 516862 datacompositionnewtable 12 516874 datacompositionorder 60 516886 datacompositionorderdisabled 12 516946 datacompositionorderexpression 23 516958 datacompositionorderexpressions 45 516981 datacompositionorderitem 30 517026 datacompositionorderitemcollection 54 517056 datacompositionoutputparameters 12 517110 datacompositionoutputparametersdisabled 12 517122 datacompositionoutputparametervalues 42 517134 datacompositionparameter 10 517176 datacompositionparameters 9 517186 datacompositionparameteruse 16 517195 datacompositionparametervalue 35 517211 datacompositionparametervaluecollection 53 517246 datacompositionpartchart 5 517299 datacompositionpartgroup 5 517304 datacompositionparthierarchicalgroup 5 517309 datacompositionpartnestedobject 5 517314 datacompositionpartrecords 5 517319 datacompositionparttable 5 517324 datacompositionparttemplate 5 517329 datacompositionperiodadditiontype 122 517334 datacompositionperiodtype 16 517456 datacompositionpictureoutput 4 517472 datacompositionpictureoutputtype 25 517476 datacompositionpivottabledatasource 30 517501 datacompositionprocessor 29 517531 datacompositionresourcesautoposition 15 517560 datacompositionresourcesplacement 16 517575 datacompositionresourcesplacementinchart 21 517591 datacompositionresultitem 48 517612 datacompositionresultitemtype 21 517660 datacompositionresultnesteditemslayout 16 517681 datacompositionresultspreadsheetdocumentoutputprocessor 53 517697 datacompositionresultvaluecollectionoutputprocessor 47 517750 datacompositionschema 132 517797 datacompositionschemacalculatedfield 71 517929 datacompositionschemacalculatedfields 59 518000 datacompositionschemadatasetfield 81 518059 datacompositionschemadatasetfieldfolder 24 518140 datacompositionschemadatasetfields 51 518164 datacompositionschemadatasetlink 50 518215 datacompositionschemadatasetlinks 45 518265 datacompositionschemadatasetobject 29 518310 datacompositionschemadatasetquery 41 518339 datacompositionschemadatasets 59 518380 datacompositionschemadatasetunion 23 518439 datacompositionschemadatasource 23 518462 datacompositionschemadatasources 65 518485 datacompositionschemafieldtemplate 15 518550 datacompositionschemafieldtemplates 50 518565 datacompositionschemafielduserestriction 29 518615 datacompositionschemagrouptemplate 29 518644 datacompositionschemagrouptemplates 53 518673 datacompositionschemanesteddataset 23 518726 datacompositionschemaparameter 89 518749 datacompositionschemaparameters 60 518838 datacompositionschematemplatedescription 23 518898 datacompositionschematemplatedescriptions 60 518921 datacompositionschematotalfield 24 518981 datacompositionschematotalfields 51 519005 datacompositionschematotalfieldstemplate 40 519056 datacompositionschematotalfieldstemplates 53 519096 datacompositionschemawizard 29 519149 datacompositionselectedfield 36 519178 datacompositionselectedfieldcollection 54 519214 datacompositionselectedfieldgroup 48 519268 datacompositionselectedfields 48 519316 datacompositionselection 11 519364 datacompositionselectiondisabled 11 519375 datacompositionselectionfields 9 519386 datacompositionsettings 202 519395 datacompositionsettingscomposer 77 519597 datacompositionsettingserror 9 519674 datacompositionsettingsitemstate 20 519683 datacompositionsettingsitemviewmode 25 519703 datacompositionsettingsparametervalue 54 519728 datacompositionsettingsrefreshmethod 15 519782 datacompositionsettingsstructurecurrentdata 60 519797 datacompositionsettingstructure 24 519857 datacompositionsettingstructureitemcollection 72 519881 datacompositionsettingsvariant 24 519953 datacompositionsettingsvariants 54 519977 datacompositionsettingsviewmode 15 520031 datacompositionsettingswizard 47 520046 datacompositionsortdirection 16 520093 datacompositionstandardsettings 12 520109 datacompositiontable 78 520121 datacompositiontablegroup 96 520199 datacompositiontablegroupoutputparametervalues 42 520295 datacompositiontableoutputparametervalues 42 520337 datacompositiontablestructureitemcollection 72 520379 datacompositiontemplate 60 520451 datacompositiontemplateareatemplate 12 520511 datacompositiontemplateareatemplatedefinition 24 520523 datacompositiontemplateareatemplatedefinitions 60 520547 datacompositiontemplatebody 54 520607 datacompositiontemplatechart 42 520661 datacompositiontemplatechartbodytemplate 18 520703 datacompositiontemplatechartbodytemplates 54 520721 datacompositiontemplatechartgroup 84 520775 datacompositiontemplatechartgroupbody 54 520859 datacompositiontemplatechartgroups 54 520913 datacompositiontemplatechartgrouptemplate 18 520967 datacompositiontemplatecharthierarchicalgroup 6 520985 datacompositiontemplatecomposer 17 520991 datacompositiontemplatedatasetfield 24 521008 datacompositiontemplatedatasetfields 60 521032 datacompositiontemplatedatasetlink 60 521092 datacompositiontemplatedatasetlinks 54 521152 datacompositiontemplatedatasetobject 42 521206 datacompositiontemplatedatasetquery 48 521248 datacompositiontemplatedatasets 60 521296 datacompositiontemplatedatasetunion 36 521356 datacompositiontemplatedatasource 24 521392 datacompositiontemplatedatasources 60 521416 datacompositiontemplategenerator 11 521476 datacompositiontemplategroup 96 521487 datacompositiontemplategrouping 54 521583 datacompositiontemplategroupingitem 42 521637 datacompositiontemplatehierarchicalgroup 6 521679 datacompositiontemplatehierarchicalrecords 6 521685 datacompositiontemplatenesteddataset 30 521691 datacompositiontemplatenesteddatasets 60 521721 datacompositiontemplatenestedobject 30 521781 datacompositiontemplateparametervalue 18 521811 datacompositiontemplateparametervalues 60 521829 datacompositiontemplateperiodaddition 24 521889 datacompositiontemplaterecords 72 521913 datacompositiontemplatetable 66 521985 datacompositiontemplatetablebodytemplate 18 522051 datacompositiontemplatetablebodytemplates 54 522069 datacompositiontemplatetablegroup 96 522123 datacompositiontemplatetablegroupbody 54 522219 datacompositiontemplatetablegrouptemplate 24 522273 datacompositiontemplatetablehierarchicalgroup 6 522297 datacompositiontemplatetablehierarchicalrecords 6 522303 datacompositiontemplatetablerecords 72 522309 datacompositiontextoutputtype 21 522381 datacompositiontextplacementtype 26 522402 datacompositiontotalplacement 31 522428 datacompositiontypelink 22 522459 datacompositionuserfieldcase 30 522481 datacompositionuserfieldcasevariantcollection 54 522511 datacompositionuserfieldcollection 54 522565 datacompositionuserfieldexpression 78 522619 datacompositionuserfields 48 522697 datacompositionuserfieldscasevariants 36 522745 datacompositionuserfieldsvariant 30 522781 datacompositionusersettings 58 522811 datacompositionusersettingsitemcollection 60 522869 datacompositionvaluecollectiontemplategenerator 11 522929 datacopiesplacementtostorageonreadingfromdatabase 9 522940 datacopiesplacementtostorageonwritingtodatabase 9 522949 dataeditlockservice 20 522958 dataexchange 176 522978 dataexchangemainpresentation 24 523154 dataexchangemanagerwithmainserver 10 523178 dataexchangeparameters 24 523188 dataexchangestream 10 523212 dataexchangewithmainserver 9 523222 dataformat 10 523231 dataformatsupported 10 523241 datahashing 34 523251 datahistory 156 523285 datahistoryafterwritequeue 6 523441 datahistorychangehistoryform 18 523447 datahistorylatestversions 6 523465 datahistorymanager 70 523471 datahistorymetadata 6 523541 datahistoryqueue 6 523547 datahistorysettings 25 523553 datahistorysettingsupdate 42 523578 datahistoryuse 24 523620 datahistoryuserschoosedialog 29 523644 datahistoryversiondataform 18 523673 datahistoryversiondifferencesform 18 523691 datahistoryversions 6 523709 datahistoryversionsfilterdialog 29 523715 datainconsistency 9 523744 dataisrelevant 7 523753 dataitemreceive 20 523760 dataitemsend 20 523780 datakey 10 523800 datakind 9 523810 datalinechangetype 26 523819 datalock 35 523845 datalockcontrolmode 187 523880 datalockfields 81 524067 datalockitem 42 524148 datalockitemfield 24 524190 datalockitemfields 18 524214 datalockmode 15 524232 datamatrix 20 524247 dataparameters 37 524267 dataparametersavailablefields 11 524304 dataparametersoutput 12 524315 dataparametervalues 5 524327 datapath 242 524332 datapathfield 9 524574 dataplacementtostorageandtodatabaseoninaccessiblestorage 9 524583 dataplacementtostorageonly 9 524592 datapresentation 45 524601 dataprocessor 137 524646 dataprocessormanager 30 524783 dataprocessorobject 54 524813 dataprocessors 18 524867 dataprocessorsmanager 12 524885 datareader 272 524897 datarelevanceoutput 6 525169 datarelevancetime 7 525175 datarowchangetype 5 525182 datasearch 12 525187 dataselection 24 525199 dataseparation 112 525223 dataseparationsafemode 10 525335 dataseparationuse 9 525345 dataseparationvalue 9 525354 datasetfield 5 525363 datasetfieldfield 5 525368 datasetfieldfolder 5 525373 datasetfieldnesteddataset 4 525378 datasetfieldrole 4 525382 datasetlink 9 525386 datasetlinks 22 525395 datasetobject 9 525417 datasetquery 9 525426 datasets 44 525435 datasetunion 14 525479 datasharingsupported 9 525493 datasource 174 525502 datasourcecolumn 29 525676 datasourcedescription 23 525705 datasourcedescriptioncolumn 48 525728 datasourcedescriptioncolumns 30 525776 datasourceorganizationtype 9 525806 datasources 22 525815 datasourcetype 25 525837 datastoragetablespace 6 525862 datatableformat 41 525868 datatype 18 525909 dataversion 352 525927 dataversionfield 9 526279 datawriter 188 526288 datazonechange 36 526476 datazonechangeerror 36 526512 date 441 526548 dateadd 5 526989 dateappearance 35 526994 dateappearancecollection 15 527029 datediff 6 527044 dateformat 9 527050 datefractions 30 527059 dateoffset 66 527089 dateparts 6 527155 datepresentation 9 527161 datepresentationformat 54 527170 datequalifiers 24 527224 datereceived 40 527248 dates 9 527288 dateselectionmode 20 527297 datesent 11 527317 dateserializationformat 9 527328 datestamp 9 527337 datetime 36 527346 datewritingvariant 9 527382 dative 12 527391 datum 3418 527403 day 179 530821 dayformat 11 531000 dayfrombegofmonth 9 531011 dayfrombegofquarter 9 531020 dayfrombegofyear 9 531029 dayinmonth 18 531038 daylighttimeoffset 10 531056 dayofyear 21 531066 dayperiod 77 531087 days 7 531164 daysafter 11 531171 daysbefore 11 531182 daysincebeginofperiod 9 531193 daysrepeatperiod 18 531202 db 6 531220 db2 22 531226 dbase 4 531248 dbconfigbackgroundupdatecancel 36 531252 dbconfigbackgroundupdateerror 36 531288 dbconfigbackgroundupdatefinish 36 531324 dbconfigbackgroundupdateresume 36 531360 dbconfigbackgroundupdatestart 36 531396 dbconfigbackgroundupdatesuspend 36 531432 dbconfigextensiondelete 36 531468 dbconfigextensiondeleteerror 36 531504 dbconfigextensioninsert 36 531540 dbconfigextensioninserterror 36 531576 dbconfigextensionupdate 36 531612 dbconfigextensionupdateerror 36 531648 dbconfigupdate 36 531684 dbconfigupdateerror 36 531720 dbconfigupdatestart 36 531756 dbconnmode 14 531792 dbcopiesservice 20 531806 dbcopiestimeservice 20 531826 dbcopy1 4 531846 dbf 85 531850 dbformat 6 531935 dbms 83 531941 dbmsbytesall 28 532024 dbmsbyteslast5min 28 532052 dbmscallduration 22 532080 dbmscalldurationcurrent 11 532102 dbmscalldurationlast5min 11 532113 dbmscalldurationtotal 11 532124 dbmsconnection 11 532135 dbmslocksessionnumber 11 532146 dbmssentandreceiveddatasize 22 532157 dbmssentandreceiveddatasizelast5min 11 532179 dbmssentandreceiveddatasizetotal 11 532190 dbmstype 9 532201 dbname 24 532210 dbpagesize 6 532234 dbpassword 24 532240 dbprocinfo 28 532264 dbproctook 28 532292 dbproctookat 28 532320 dbpwd 6 532348 dbservername 24 532354 dbsrvr 6 532378 dbuid 6 532384 dbuser 24 532390 dd 31 532414 dd541276 4 532445 ddd 6 532449 dddd 6 532455 de 198 532461 debit 29 532659 debitcredit 11 532688 debug 52 532699 debugger 13 532751 debugquerytargets 8 532764 debugserveruser 48 532772 debugservice 20 532820 debugtargetattach 36 532840 debugtargetdetach 36 532876 debugtargettype 48 532912 decimal 27 532960 decision 18 532987 decisiontreenode 30 533005 decisiontreesimplificationtype 16 533035 declaration 4 533051 declare 9 533055 decodestring 10 533064 decodeuri 6 533074 decoration 135 533080 decreasearea 9 533215 decreasediameter 9 533224 decreasevalue 9 533233 decrypt 9 533242 decryptasync 9 533251 dedicatedmanagers 14 533260 deduplicateditemscount 9 533274 deeppink 11 533283 deepskyblue 11 533294 defapps 12 533305 default 97 533317 defaultbubblesize 33 533414 defaultbutton 40 533447 defaultchoiceform 99 533487 defaultcollaborationsystemuserschoiceform 9 533586 defaultconstantsform 9 533595 defaultcontrol 11 533604 defaultdatahistorychangehistoryform 9 533615 defaultdatahistoryversiondataform 9 533624 defaultdatahistoryversiondifferencesform 10 533633 defaultdatalockcontrolmode 29 533643 defaultdynamiclistsettingsform 9 533672 defaultext 9 533681 defaultfolderchoiceform 18 533690 defaultfolderform 18 533708 defaultform 36 533726 defaultguifont 11 533762 defaultinterface 67 533773 defaultinternalsettingsstorage 6 533840 defaultitem 27 533846 defaultlanguage 10 533873 defaultlistform 144 533883 defaultloadform 9 534027 defaultnamespace 9 534036 defaultobjectform 90 534045 defaultpresentation 54 534135 defaultrecordform 27 534189 defaultreportappearancetemplate 10 534216 defaultreportform 10 534226 defaultreportsettingsform 10 534236 defaultreportvariantform 9 534246 defaultroles 127 534255 defaultrunmode 10 534382 defaultsaveform 9 534392 defaultsearchform 10 534401 defaultsettings 11 534411 defaultsettingsform 9 534422 defaultstorage 9 534431 defaultstyle 10 534440 defaultsystemsettingsstorage 6 534450 defaultvalue 9 534456 defaultvariantform 9 534465 defer 9 534474 define 22 534483 defined 5 534505 definedtype 60 534510 definedtypes 9 534570 definition 33 534579 definitions 15 534612 deflate 28 534627 deflation 11 534655 del 5 534666 delayedspeechtotextresult 30 534671 delegation 10 534701 delete 2577 534711 deletearea 12 537288 deleteasync 18 537300 deletebycategory 9 537318 deletebyfilter 9 537327 deletecalendar 9 537336 deletecaption 9 537345 deletecell 9 537354 deletechangerecords 11 537363 deletecontact 9 537374 deleted 38 537383 deletedata 54 537421 deletedataasync 9 537475 deletedatabase 9 537484 deletedatadump 10 537493 deletedatadumpasync 10 537503 deletedbyuser 9 537513 deleteddatasize 9 537522 deletedefaultsetting 11 537531 deletedirectly 12 537542 deletedisallowedxmlcharacters 10 537554 deleteditemscount 9 537564 deleteerror 36 537573 deleteevent 9 537609 deletefiles 10 537618 deletefilesasync 10 537628 deletefromafterwriteversionsprocessing 9 537638 deletefromtempstorage 10 537647 deleteinfobaseadditionalgrammar 9 537657 deleteinfobasespeechtotextmodel 9 537666 deleteitems 14 537675 deleteline 11 537689 deletelistitem 6 537700 deletelistitemdirectly 6 537706 deletemailbox 9 537712 deletemessage 19 537721 deletemessages 18 537740 deleteobjects 10 537758 deletepredefineddata 36 537768 deleterow 18 537804 deleteschema 9 537822 deleteservicesetting 15 537831 deletesessionadditionalgrammar 9 537846 deletetfoot 9 537855 deletethead 9 537864 deleteunuseditems 9 537873 deleteversions 45 537882 deleteviewstatusitem 9 537927 deletionmark 460 537936 delimeterchar 9 538396 deliverablenotification 49 538405 deliverablenotificationmanager 40 538454 deliverablenotifications 9 538494 deliverablenotificationsend 9 538503 deliverablenotificationsenderrortype 40 538512 deliverablenotificationsendingissueinformation 25 538552 deliverablenotificationsendmanager 20 538577 deliverablenotificationserviceconnectionerror 9 538597 deliverablenotificationserviceerror 9 538606 deliverablenotificationsubscriberid 26 538615 deliverablenotificationsubscribertype 35 538641 deliveryreceiptaddresses 9 538676 demo 4 538685 demos 4 538689 dendrogram 175 538693 dendrogramfield 9 538868 dendrogramitem 20 538877 dendrogramitemcollection 45 538897 dendrogramlink 20 538942 dendrogramlinkcollection 45 538962 dendrogramorientation 26 539007 dendrogramplotarea 90 539033 dendrogramscalekeeping 21 539123 dendrogramtitlearea 65 539144 denied 6 539209 deniedfrom 24 539215 deniedmessage 24 539239 deniedparameter 19 539263 deniedto 24 539282 deny 42 539306 denyincompletevalues 28 539348 department 14 539376 dependenceoncalculationtypes 9 539390 dependencies 9 539399 dependency 9 539408 depth 18 539417 derivationannotation 11 539435 derivationmethod 11 539446 desc 155 539457 descend 9 539612 descending 9 539621 descr 183 539630 description 759 539813 descriptionlength 54 540572 descriptorfilename 9 540626 design 9 540635 designer 29 540644 desktop 24 540673 desktopmode 11 540697 dest 4 540708 destinationdataset 20 540712 destinationexpression 20 540732 detach 9 540752 detachaftermessagesendhandler 9 540761 detachcallshandler 11 540770 detachdatachangehandler 11 540781 detachgeneratecommandshandler 9 540792 detachhandler 9 540801 detachidlehandler 31 540810 detachinstallationcompletehandler 9 540841 detachinternetconnectionchangehandler 9 540850 detachlicensingclientparametersrequesthandler 10 540859 detachlocationchangehandler 9 540869 detachmessageactionhandler 9 540878 detachmessagehandler 9 540887 detachmonitoredgeofencesborderscrossingdetectionhandler 9 540896 detachnewmessageshandlerasync 9 540905 detachnotificationhandler 19 540914 detachprovidersavailabilitychangehandler 9 540933 detachsmsmessagehandler 11 540942 detachstatechangehandler 9 540953 detail 242 540962 detaileddailyschedules 9 541204 detailedinformation 10 541213 detailedpresentation 11 541223 detailedsetting 11 541234 detailerrordescription 28 541245 detailfilltype 9 541273 detailprocessing 104 541282 detailrecord 9 541386 detailrecordstemplate 9 541395 details 236 541404 detailsareatemplateparameter 4 541640 detailsareatemplateparameterfieldexpression 4 541644 detailsdata 11 541648 detailsid 5 541659 detailsinformation 5 541664 detailsitemfields 5 541669 detailsitemgroup 5 541674 detailsparameter 22 541679 detailsprocessdescription 5 541701 detailsuse 11 541706 determineoptimalaggregates 11 541717 developer 20 541728 developerportal 9 541748 devicecameraresolution 19 541757 devicecameratype 20 541776 devicedatasharingtools 10 541796 devicedatasharingtoolsmanager 15 541806 deviceid 9 541821 devicetools 10 541830 devicetoolsmanager 18 541840 df 12 541858 di 8 541870 dialnumber 11 541878 dialogexclamation 11 541889 dialoginformation 11 541900 dialogquestion 11 541911 dialogreturncode 45 541922 dialogstop 11 541967 dib 7 541978 diena 9 541985 dienas 7 541994 dienos 9 542001 dienu 7 542010 diens 7 542017 difference 20 542024 differences 20 542044 differential 5 542064 digit 18 542069 digits 18 542087 digitsandpunctuation 9 542105 dim 28 542114 dimension 836 542142 dimensionattribute 10 542978 dimensionattributeplacementincolumns 20 542988 dimensionattributeplacementinrows 20 543008 dimensionattributeplacementtype 20 543028 dimensionitem 32 543048 dimensionitemclick 9 543080 dimensionitemexpanded 9 543089 dimensionitemhyperlink 9 543098 dimensionplacementtype 20 543107 dimensions 158 543127 dimensionsplacementoncolumns 20 543285 dimensionsplacementonrows 20 543305 dimensiontable 181 543325 dimensiontables 20 543506 dimensiontype 18 543526 dimensionvalues 45 543544 dimgray 12 543589 dir 6 543601 dire 6 543607 direct 9 543613 direction 20 543622 directive 11 543642 directives 11 543653 directly 27 543664 director 29 543691 directory 35 543720 disable 81 543755 disableallgeofencesmonitoring 9 543836 disablecontrol 9 543845 disabled 36 543854 disabledragandstretch 9 543890 disabledtext 11 543899 disableedit 9 543910 disablegeofencesmonitoring 9 543919 disablelocalspeechtotext 61 543928 disablestartupdialogs 5 543989 disablestretch 9 543994 disallow 14 544003 disallowed 10 544017 disallowedsubstitutions 11 544027 discard 4 544038 disconnect 107 544042 disconnected 36 544149 disconnectexternaldatasource 10 544185 disconnectiontime 9 544195 discrete 9 544204 discretefields 9 544213 dispatch 12 544222 dispatched 6 544234 displacementorder 6 544240 displacingcalculationtypes 158 544246 displacingcalculationtypesrow 24 544404 display 36 544428 displayareabegin 9 544464 displayareaend 9 544473 displaydefaultpicture 165 544482 displayed 36 544647 displayedtext 16 544683 displayimportance 107 544699 displayname 9 544806 disstt 6 544815 distance 9 544821 distancemetric 4 544830 distinct 50 544834 distributedinfobase 9 544884 distribution 6 544893 district 9 544899 div 27 544908 dj 12 544935 dk 148 544947 dl 9 545095 dlf 14 545104 dll 15 545118 dn 20 545133 do 51 545153 doasync 52 545204 doc 127 545256 dock 9 545383 docked 9 545392 docs 95 545401 doctype 13 545496 document 2825 545509 documentation 83 548334 documentations 11 548417 documentchange 6 548428 documentcomplete 20 548434 documentconversionerror 9 548454 documentelement 18 548463 documentfound 9 548481 documentfragment 67 548490 documentispasswordprotected 10 548557 documentispasswordprotectedasync 10 548567 documentjournal 152 548577 documentjournallist 30 548729 documentjournalmanager 30 548759 documentjournals 18 548789 documentjournalselection 54 548807 documentjournalsmanager 12 548861 documentlist 30 548873 documentlock 9 548903 documentmanager 114 548912 documentmap 9 549026 documentnumberperiodicity 39 549035 documentnumbertype 25 549074 documentnumerator 80 549099 documentnumerators 9 549179 documentobject 295 549188 documentpostingmode 15 549483 documentref 109 549498 documents 222 549607 documentscanning 9 549829 documentscanningcheckingquality 30 549838 documentscanningorientationdetectionmode 30 549868 documentscanningpage 26 549898 documentscanningparameters 45 549924 documentscanningprocessingfilter 20 549969 documentscanningqualityparameters 31 549989 documentscanningsupported 9 550020 documentsdir 10 550029 documentsdirasync 10 550039 documentselection 72 550049 documentsmanager 18 550121 documenttype 287 550139 documenttypedefinition 18 550426 documenturi 18 550444 documentwritemode 20 550462 docx 62 550482 dodgerblue 12 550544 doesnotsatisfycomplexityrequirements 9 550556 doesnotsatisfycompromisecheckrequirements 9 550565 doesnotsatisfyminlengthrequirements 9 550574 doesnotsatisfyreuselimitrequirements 9 550583 dollar 9 550592 dollars 7 550601 dom 2617 550608 domain 33 553225 domainname 10 553258 domattribute 190 553268 domattributemap 30 553458 dombuilder 24 553488 dombuilderaction 30 553512 dombuilderconfiguration 25 553542 domcanonicalization 14 553567 domcdatasection 200 553581 domcomment 220 553781 domconfig 27 554001 domdocument 319 554028 domdocumentconfiguration 25 554347 domdocumentfragment 165 554372 domdocumentposition 35 554537 domdocumenttype 199 554572 domelement 587 554771 domelementlist 15 555358 domentity 195 555373 domentitymap 30 555568 domentityreference 165 555598 domessagebox 10 555763 domessageboxasync 10 555773 domesticpartner 9 555783 domnamespaceresolver 22 555792 domnode 9 555814 domnodefilter 78 555823 domnodefilterparameters 70 555901 domnodeiterator 39 555971 domnodelist 15 556010 domnodereader 209 556025 domnodetype 70 556234 domnodewriter 109 556304 domnotation 175 556413 domnotationmap 30 556588 domodal 66 556618 domprocessinginstruction 175 556684 domstringlist 20 556859 domtext 220 556879 domtreewalker 64 557099 domwriter 19 557163 domwriterconfiguration 25 557182 domxpathresulttype 55 557207 done 18 557262 dong 7 557280 donotreduceonexcess 9 557287 donotverifysignature 9 557296 dontadd 9 557305 dontapply 9 557314 dontassign 9 557323 dontautoupdate 18 557332 dontchange 27 557350 dontchangebehavior 9 557377 dontcheck 36 557386 dontconnect 9 557422 dontdisplay 9 557431 dontdisturb 21 557440 dontfill 18 557461 dontimport 9 557479 dontinclude 9 557488 dontindex 9 557497 dontmove 9 557506 dontnotify 12 557515 dontorder 9 557527 dontoutput 36 557536 dontoverlapowner 9 557572 dontperformactionswithdatabase 9 557581 dontprocess 36 557590 dontrestore 18 557626 dontsend 9 557644 dontshow 162 557653 dontsimplify 9 557815 dontstandardize 9 557824 dontstorepath 18 557833 dontupdate 9 557851 dontuse 547 557860 dontusecopies 9 558407 donut 9 558416 donut3d 9 558425 donutchartinnerradius 30 558434 doquerybox 10 558464 doqueryboxasync 10 558474 dos 18 558484 dot 58 558502 dots 9 558560 dotted 45 558569 double 56 558614 doubleunderline 9 558670 down 9 558679 downarrow 9 558688 download 9 558697 downloadadbannerasync 9 558706 downloadavailable 9 558715 downloadfullscreenadasync 9 558724 downloading 9 558733 downloadrewardedvideoasync 9 558742 dpi 25 558751 dr 63 558776 draft 9 558839 drag 100 558848 dragaction 25 558948 dragallowedactions 25 558973 dragcheck 101 558998 dragend 100 559099 dragparameters 20 559199 dragstart 100 559219 draw 11 559319 drawgridmode 9 559330 drawing 22 559339 drawings 11 559361 drawingscale 9 559372 drawingselectionshowmode 30 559381 drawingtype 11 559411 drcrturnovers 17 559422 drilldown 20 559439 drop 6 559459 dropinfobase 21 559465 droplistbutton 9 559486 droplistisopen 9 559495 droplistwidth 10 559504 dt 14 559514 dtd 89 559528 dtoc 4 559617 dtos 4 559621 dtr 5 559625 dumpconfigfiles 288 559630 dumperror 36 559918 dumpfinish 36 559954 dumpstart 36 559990 duplexprinting 29 560026 duplexprintingtype 25 560055 duration 26 560080 durationall 28 560106 durationalldbms 28 560134 durationallservice 28 560162 durationcurrent 28 560190 durationcurrentdbms 28 560218 durationcurrentservice 28 560246 durationlast5min 28 560274 durationlast5mindbms 28 560302 durationlast5minservice 28 560330 duringrequest 9 560358 duringsession 9 560367 dynamic 190 560376 dynamicaddininstallationsupported 10 560566 dynamicdataread 9 560576 dynamiclist 140 560585 dynamiclistcellappearance 25 560725 dynamiclistcellappearances 15 560750 dynamiclistgrouprow 20 560765 dynamiclistkeytype 25 560785 dynamiclistrow 15 560810 dynamiclistrowkey 28 560825 dynamiclistrows 20 560853 dynamiclistsearchstringviewmode 25 560873 dynamiclistsusersettingsstorage 26 560898 dynamiclisttablesettings 29 560924 dynamiclistviewsettings 23 560953 dz 12 560976 döngY 9 560988 e 149 560997 e1c 26 561146 e1cib 29 561172 e2k 13 561201 each 8 561214 ean 4 561222 ean13 20 561226 ean8 20 561246 eastborderlongitude 20 561266 ebcdic 272 561286 ec 12 561558 ecdsa 4 561570 ecomclass 6 561574 ecs 44 561580 edge 40 561624 edgeauto 9 561664 edgeinside 9 561673 edgesconnection 9 561682 edit 92 561691 editasinterval 11 561783 editasperiod 11 561794 editasync 9 561805 editdatahistoryversioncomment 6 561814 editformat 155 561820 editindialog 12 561975 edititem 14 561987 editmessage 9 562001 editmode 29 562010 editparameters 30 562039 editstate 4 562069 edittext 10 562073 edittextchange 10 562083 edittextupdate 34 562093 edittype 201 562127 ee 24 562328 effect 11 562352 eg 12 562363 eku 4 562375 el 23 562379 electronic 12 562402 element 417 562414 elementdeclaration 9 562831 elementdeclarations 11 562840 elementformdefault 11 562851 elementformqualified 9 562862 elementname 9 562871 elements 19 562880 ellipse 18 562899 else 57 562917 elsif 8 562974 email 93 562982 emailaddress 8 563075 emailauthentication 18 563083 emailauthenticationfrom 36 563101 emailauthenticationheader 36 563137 emailauthenticationhtmlmessagetext 36 563173 emailauthenticationmaxunsuccessfulverificationcodevalidationattemptscount 36 563209 emailauthenticationmethod 65 563245 emailauthenticationsendername 36 563310 emailauthenticationsettings 95 563346 emailauthenticationsmtppasswordchanged 36 563441 emailauthenticationsmtpport 36 563477 emailauthenticationsmtpsecureauthenticationonly 36 563513 emailauthenticationsmtpserveraddress 36 563549 emailauthenticationsmtpuser 36 563585 emailauthenticationtokenauthenticationwhensendingverificationcode 36 563621 emailauthenticationusesslwhensendingverificationcode 36 563657 emailauthenticationverificationcodealphabet 36 563693 emailauthenticationverificationcodeeffectiveperiod 36 563729 emailauthenticationverificationcodelength 36 563765 emailauthenticationverificationcoderefreshrequestlockduration 36 563801 emails 14 563837 embed 36 563851 embedded 20 563887 embeddedintocell 11 563907 embeddedtablecollection 54 563918 embeddedtables 11 563972 embeddedworkplace 9 563983 embedtags 9 563992 embedB538 9 564001 emboss 9 564010 embossed 9 564019 emf 24 564028 eml 4 564052 employee 5 564056 empty 9 564061 emptyitemsarea 14 564070 emptykey 33 564084 emptyrecordndef 5 564117 emptyref 127 564122 emptyroutepointref 11 564249 emptyspace 18 564260 emptytable 6 564278 emulate 12 564284 emulated 12 564296 en 444 564308 en8sa 4 564752 enable 575 564756 enablechoice 9 565331 enablecontentchange 9 565340 enabled 519 565349 enabledrag 99 565868 enableedit 9 565967 enableeditmode 9 565976 enablegeofencesmonitoring 9 565985 enableperiodsetting 88 565994 enablestartdrag 99 566082 enabletotalsslicefirst 9 566181 enabletotalsslicelast 9 566190 enabletotalssplitting 18 566199 encname 40 566217 encode 296 566257 encodestring 10 566553 encoding 296 566563 encodingbitrate 9 566859 encodingmode 9 566868 encrypt 29 566877 encryptalgorithm 9 566906 encryptalgorithmdefinition 9 566915 encryptalgorithms 9 566924 encryptasync 9 566933 encrypted 20 566942 enctype 9 566962 end 351 566971 endangle 32 567322 endarrow 9 567354 endbegin 9 567363 endbookmark 55 567372 endcase 18 567427 endcolumnautogrouping 12 567445 endcolumngroup 12 567457 enddate 76 567469 enddates 6 567545 enddelete 5 567551 enddo 3 567556 endedit 11 567559 endeditcurrentarea 9 567570 endeditrow 30 567579 endelement 9 567609 endend 9 567618 endentity 9 567627 endexpirationdate 10 567636 endfunction 3 567646 endgaugeangle 9 567649 endif 8 567658 endincoming 9 567666 endingvariant 11 567675 endinsert 5 567686 enditem 18 567691 endleft 18 567709 endofactionperiod 66 567727 endofbaseperiod 66 567793 endofday 16 567859 endofdisplayperiod 11 567875 endofhalfyear 6 567886 endofhour 16 567892 endofitem 9 567908 endoflist 18 567917 endofminute 16 567935 endofmonth 16 567951 endofperiod 37 567967 endofquarter 16 568004 endofrepresentationperiod 18 568020 endoftendays 6 568038 endoftext 9 568044 endofweek 16 568053 endofwholeinterval 9 568069 endofwindow 18 568078 endofyear 16 568096 endoutgoing 9 568112 endoutput 22 568121 endpoins 9 568143 endpoint 9 568152 endpointurl 9 568161 endprocedure 3 568170 endread 11 568173 endregion 5 568184 endrowautogrouping 12 568189 endrowgroup 12 568201 endsenddate 9 568213 endside 18 568222 endtime 27 568240 endtop 18 568267 endtry 3 568285 endwrite 11 568288 energyconsumption 9 568299 english 9 568308 enhancesignature 9 568317 enhancesignatureasync 9 568326 ensr8 4 568335 enter 97 568339 enterkeybehavior 20 568436 enterkeybehaviortype 15 568456 enteroninput 9 568471 enterprise 290 568480 entities 21 568770 entity 121 568791 entityreference 76 568912 enum 232 568988 enumeration 161 569220 enumerationfacet 9 569381 enumerations 9 569390 enumlist 12 569399 enummanager 78 569411 enumref 18 569489 enums 19 569507 enumsmanager 18 569526 enumvalue 55 569544 enumvalues 9 569599 envelope 103 569608 environment 5 569711 eof 9 569716 eolsensitive 9 569725 epoch 4 569734 equal 34 569738 equalcolumnswidth 9 569772 equalitemswidth 9 569781 equals 7 569790 equationarea 9 569797 equationsinnodescolumn 9 569806 equationsinrelationscolumn 9 569815 equipmentlist 9 569824 er 12 569833 erasedata 36 569845 erasedataerror 36 569881 eraseinfobasedata 10 569917 eraseportrange 20 569927 error 109 569947 errorcategory 147 570056 errorcategoryforuser 9 570203 errorcode 9 570212 errordescr 4 570221 errordescription 28 570225 errordescriptionforuser 9 570253 errordisplayprocessing 10 570262 errorhandlermodule 9 570272 errorhandlerprocedurename 9 570281 errorinfo 75 570290 errorinforeportingmode 4 570365 errormessage 11 570369 errormessagedisplayvariant 26 570380 errormessageforuser 18 570406 errormessagestexts 30 570424 errormessagetexts 28 570454 erroronstartupprocessingserviceaddress 9 570482 erroronstartupprocessingsettings 25 570491 errorprocessing 9 570516 errorprocessingmanager 65 570525 errorprocessingserviceaddress 9 570590 errorprocessingsettings 140 570599 errorprocessingsettingsstorage 6 570739 errorreport 44 570745 errorreportingmode 25 570789 errorscountthreshold 14 570814 errorsdetected 9 570828 errorsnotdetected 9 570837 errortype 9 570846 es 62 570855 es256 13 570917 es384 13 570930 es512 13 570943 esc 42 570956 escape 50 570998 escapeampersand 9 571048 escapeanglebrackets 9 571057 escapecharacters 9 571066 escapelineterminators 9 571075 escapesinglequotes 9 571084 escapeslash 9 571093 esri 4 571102 estimatedupdatetime 9 571106 esA 4 571115 et 48 571119 etc 4 571167 eu 14 571171 euc 406 571185 euclidean 9 571591 euro 11 571600 european 12 571611 eval 10 571623 evaluate 9 571633 evaluatestoreduserpasswordvalue 10 571642 evaluatexpathexpression 9 571652 even 6 571661 evening 6 571667 event 113 571673 eventeditingsupported 9 571786 eventislogged 36 571795 eventlog 29 571831 eventlogaccessdeniedeventusedescription 23 571860 eventlogaccesseventusedescription 28 571883 eventlogbyuser 11 571911 eventlogdatastoragesplitperiod 40 571922 eventlogentrytransactionmode 15 571962 eventlogentrytransactionstatus 25 571977 eventlogeventpresentation 10 572002 eventlogeventuse 19 572012 eventlogformat 36 572031 eventloglevel 25 572067 eventlogreduce 42 572092 eventlogreduceerror 36 572134 eventlogservice 20 572170 eventlogsettingsupdate 36 572190 eventlogsettingsupdateerror 36 572226 eventname 36 572262 eventpresentation 8 572298 events 9 572306 eventshandlers 9 572315 eventsubscription 70 572324 eventsubscriptions 10 572394 exact 10 572404 exampl 4 572414 example 97 572418 examplecomobject 6 572515 exc 15 572521 excel 76 572536 except 3 572612 exceptionraisedfromscript 9 572615 exchange 702 572624 exchangedate 44 573326 exchangemessagereader 48 573370 exchangemessagewriter 48 573418 exchangeplan 308 573466 exchangeplancontent 20 573774 exchangeplancontentitem 15 573794 exchangeplanlist 30 573809 exchangeplanmanager 126 573839 exchangeplanobject 338 573965 exchangeplanref 121 574303 exchangeplans 19 574424 exchangeplanselection 84 574443 exchangeplansmanager 96 574527 exclamationpoint 9 574623 exclude 9 574632 excludedattributes 9 574641 excludefromsubscriberadministrators 9 574650 excluding 9 574659 exclusive 91 574668 exclusivemode 58 574759 exclusivemodechange 36 574817 exclusivemodechangeerror 36 574853 exclusivemodeparameters 19 574889 exclusivemodeterminationatsessionstart 6 574908 exe 10 574914 execute 187 574924 executeaction 23 575111 executeafterwritedatahistoryversionprocessing 90 575134 executeafterwriteversionprocessing 9 575224 executeafterwriteversionsprocessing 9 575233 executebackgroundjobwithdatabaseextensions 9 575242 executebackgroundjobwithoutextensions 9 575251 executebatch 7 575260 executebatchwithintermediatedata 7 575267 executechoicefromchoicelist 9 575274 executechoicefromdetailsmenu 9 575283 executechoicefromdroplist 9 575292 executechoicefromlist 9 575301 executechoicefrommenu 9 575310 executecommand 9 575319 executed 55 575328 executedelayedspeechtotext 9 575383 executeexchange 9 575392 executenavigation 10 575401 executeprocessing 9 575411 executeprocessinginfobaseusername 9 575420 executetask 22 575429 executetaskinteractively 11 575451 executioninformation 9 575462 executionrequired 9 575471 executive 9 575480 exemplar 5 575489 exist 9 575494 exists 9 575503 existsasync 9 575512 exit 10 575521 exp 34 575531 expand 71 575565 expandall 12 575636 expandalllevels 9 575648 expandautofields 11 575657 expanddimensionitem 9 575668 expanded 34 575677 expandentityreference 18 575711 expandpoint 9 575729 expandseries 9 575738 expandtoplevel 9 575747 expense 43 575756 expirationdate 9 575799 expirationtimeout 24 575808 explanation 227 575832 explicit 9 576059 explorer 162 576068 exponential 9 576230 exportxdtomodel 9 576239 exportxmlschema 9 576248 expression 176 576257 expressionareatemplateparameter 4 576433 expressionevaluation 36 576437 expressionindatasource 18 576473 ext 415 576491 extdata 4 576906 extdimension 79 576910 extdimensionaccountingflag 144 576989 extdimensionaccountingflags 9 577133 extdimensioncr 22 577142 extdimensiondr 22 577164 extdimensions 34 577186 extdimensionscr 22 577220 extdimensionsdr 22 577242 extdimensionsvalues 6 577264 extdimensiontype 22 577270 extdimensiontypecr 11 577292 extdimensiontypedr 11 577303 extdimensiontypes 59 577314 extend 16 577373 extended 11 577389 extendedconfigurationobject 612 577400 extendededit 111 578012 extendedlistpresentation 162 578123 extendedobjectpresentation 90 578285 extendedparameters 9 578375 extendedpresentation 36 578384 extendedrecordpresentation 27 578420 extendedreplacemode 22 578447 extendedtooltip 55 578469 extends 5 578524 extension 8411 578529 extensions 9 586940 external 1343 586949 externalaccesssupported 9 588292 externalappfullaccess 14 588301 externalapplicationsfullaccess 47 588315 externalconnection 30 588362 externalconnectionmodule 9 588392 externaldataprocessor 60 588401 externaldataprocessorconnect 42 588461 externaldataprocessorconnecterror 36 588503 externaldataprocessors 9 588539 externaldataprocessorsmanager 24 588548 externaldatasource 104 588572 externaldatasourceconnectionparameters 48 588676 externaldatasourcecube 11 588724 externaldatasourcecubedimensionstablesmanager 12 588735 externaldatasourcecubedimensiontable 11 588747 externaldatasourcecubedimensiontablemanager 60 588758 externaldatasourcecubedimensiontableobject 48 588818 externaldatasourcecubedimensiontableref 47 588866 externaldatasourcecubemanager 48 588913 externaldatasourcecuberecord 18 588961 externaldatasourcecuberecordkey 28 588979 externaldatasourcecuberecordmanager 30 589007 externaldatasourcecuberecordset 86 589037 externaldatasourcecubesmanager 12 589123 externaldatasourceerror 9 589135 externaldatasourcefunction 11 589144 externaldatasourcemanager 102 589155 externaldatasourceodbcservice 20 589257 externaldatasourcerecordset 6 589277 externaldatasources 18 589283 externaldatasourcesmanager 12 589301 externaldatasourcestate 15 589313 externaldatasourcetable 11 589328 externaldatasourcetabledatatype 25 589339 externaldatasourcetablemanager 90 589364 externaldatasourcetableobject 176 589454 externaldatasourcetablerecord 12 589630 externaldatasourcetablerecordkey 28 589642 externaldatasourcetablerecordmanager 48 589670 externaldatasourcetablerecordset 174 589718 externaldatasourcetableref 53 589892 externaldatasourcetablesmanager 18 589945 externaldatasourcetabletype 24 589963 externaldatasourcexmlaservice 20 589987 externalevent 22 590007 externalid 18 590029 externalintegrationserviceaddress 18 590047 externalintegrationservicechannelname 9 590065 externalintegrationserviceusername 9 590074 externalintegrationserviceuserpassword 9 590083 externallocationusesupported 9 590092 externalmodulefullaccess 47 590101 externalmodulehash 14 590148 externalobject 5 590162 externalonly 9 590167 externalreport 90 590176 externalreportconnect 42 590266 externalreportconnecterror 36 590308 externalreports 9 590344 externalreportsmanager 24 590353 externalsessioncontrol 10 590377 externalsessioncontrolsoap 10 590387 externalsessionmanagementconnectionstring 47 590397 externalsessionmanagementrequired 47 590444 externalsessionmanagerconnectionstring 24 590491 externalsessionmanagerrequired 24 590515 externalsessionmanagerservice 22 590539 externalsitewindow 9 590561 externalsitewindowmanager 25 590570 externalsystemparameters 9 590595 externalsystemtype 27 590604 externalsystemuserid 9 590631 externaltypendefrecord 29 590640 externeventprocessing 17 590669 extra 88 590686 extract 20 590774 extractall 20 590794 extractplaintext 9 590814 extralargetextfont 11 590823 eA;8 5 590834 f 39 590839 f0 6 590878 f1 39 590884 f10 14 590923 f11 18 590937 f12 12 590955 f2 15 590967 f3 6 590982 f4 57 590988 f6 18 591045 f8 4 591063 f9 4 591067 f94f 4 591071 fa 16 591075 fa32 6 591091 facerecognition 9 591097 facet 31 591106 facets 31 591137 factor 9 591168 factorsinnodescolumn 9 591177 factorsinrelationscolumn 9 591186 factory 27 591195 fail 18 591222 failed 18 591240 false 32 591258 family 13 591290 familyname 9 591303 fanfold 13 591312 fast 59 591325 fastinfosetreader 219 591384 fastinfosetwriter 114 591603 father 9 591717 faulttolerancelevel 11 591726 favorite 11 591737 favorites 11 591748 favoritespanel 4 591759 fc 12 591763 fcm 24 591775 fe10 6 591799 feedback 4 591805 feminine 6 591809 fen 8 591815 ff 34 591823 ff0000 6 591857 ffffff 5 591863 fi 66 591868 field 4407 591934 fieldalternativebackcolor 11 596341 fieldappearance 5 596352 fieldareasbackcolor 9 596357 fieldareastextcolor 9 596366 fieldareastransparent 9 596375 fieldbackcolor 99 596384 fieldenabled 11 596483 fieldexpressions 9 596494 fieldlist 34 596503 fieldname 27 596537 fields 338 596564 fieldsavailablefields 11 596902 fieldselectedtextcolor 11 596913 fieldselectionbackcolor 11 596924 fieldstitletype 22 596935 fieldsuse 9 596957 fieldtemplate 4 596966 fieldtemplates 11 596970 fieldtextcolor 88 596981 fieldtype 15 597069 fielduserestriction 4 597084 fieldvalue 14 597088 fieldvalues 5 597102 fieldvalueschange 5 597107 file 409 597112 fileaccess 20 597521 filecertificationauthoritycertificates 14 597541 fileclientcertificate 14 597555 filecompare 54 597569 filecomparemethod 20 597623 filecopy 10 597643 filed 12 597653 filedialog 89 597665 filedialogmode 20 597754 filedialogsection 30 597774 filedragmode 43 597804 fileextention 9 597847 fileid 18 597856 filename 104 597874 filenamefilter 9 597978 filenamesencodinginarchivefile 20 597987 filenamesencodinginzipfile 20 598007 fileopenmode 35 598027 fileref 59 598062 files 32 598121 filesize 9 598153 filestream 163 598162 filestreams 10 598325 filestreamsmanager 95 598335 filesystemfullaccess 61 598430 filetype 9 598491 filev 5 598500 filevariantbackgroundjob 48 598505 filevariantserverside 48 598553 filevariantwebsocket 48 598601 fill 277 598649 fillchecking 123 598926 fillcheckprocessing 245 599049 fillcheckprocessingatserver 10 599294 fillchecks 11 599304 filled 24 599315 filledonly 18 599339 fillfromfillingvalue 81 599357 filling 122 599438 fillingsigning 9 599560 fillingsigningannotation 9 599569 fillingtext 63 599578 fillingvalue 36 599641 fillingvalues 81 599677 fillonreopenfromotherserver 10 599758 fillpropertyvalues 10 599768 fillseriescolors 10 599778 fillsettings 18 599788 filltype 22 599806 fillvalue 9 599828 fillvalues 11 599837 fillér 7 599848 filter 848 599855 filterandsort 12 600703 filteravailablefields 55 600715 filterbycurrentvalue 12 600770 filterbydimensionparameter 11 600782 filterbyownerparameter 11 600793 filterbyrecorderparameter 44 600804 filterbytype 12 600848 filterbyvalueparameter 11 600860 filtercriteria 18 600871 filtercriteriamanager 12 600889 filtercriterion 133 600901 filtercriterionlist 18 601034 filtercriterionmanager 24 601052 filterhistory 12 601076 filterindex 18 601088 filteritem 66 601106 filteritemcomparison 5 601172 filteritemcontrol 18 601177 filteritemgroup 5 601195 filtermismatchmessage 9 601200 filteroutput 21 601209 filtersettings 213 601230 filtertype 11 601443 filtervalue 11 601454 final 39 601465 finaldefault 12 601504 find 1275 601516 findbyalias 17 602791 findbyattribute 88 602808 findbychangeddatacontent 11 602896 findbychangedindexescontent 11 602907 findbycode 55 602918 findbycolumnname 9 602973 findbydescription 66 602982 findbyexpression 18 603048 findbyfield 31 603066 findbyfilter 9 603097 findbyfullname 10 603106 findbyid 38 603116 findbykey 18 603154 findbylocation 9 603172 findbyname 44 603181 findbynumber 45 603225 findbyref 10 603270 findbyserialnumber 9 603280 findbyserialnumberasync 9 603289 findbysubject 9 603298 findbysubjectasync 9 603307 findbythumbprint 9 603316 findbythumbprintasync 9 603325 findbytype 10 603334 findbyuseddatacontent 11 603344 findbyusedindexescontent 11 603355 findbyuuid 29 603366 findbyvalue 20 603395 findcalendars 9 603415 findcontacts 9 603424 finddefaultbutton 9 603433 finddisallowedxmlcharacters 19 603442 findevents 9 603461 findfield 11 603470 findfiles 19 603481 findfilesasync 10 603500 findinhierarchy 8 603510 findinlist 12 603518 findintervalbyid 9 603530 findintree 12 603539 findkeycontainer 9 603551 findkeycontainerasync 9 603560 findmarkedfordeletion 10 603569 findnext 19 603579 findobject 108 603598 findobjects 99 603706 findparameter 10 603805 findparameters 15 603815 findparametervalue 151 603830 findpredefined 18 603981 findprevious 12 603999 findrecords 22 604011 findrows 95 604033 findtext 23 604128 findvalue 12 604151 findvaluebyid 9 604163 findwindowbyurl 10 604172 fingerprintparameters 9 604182 fingerprintrecognition 9 604191 finish 57 604200 finished 9 604257 finishuilogrecording 9 604266 firebase 19 604275 firebrick 11 604294 firedateuniversaltime 9 604305 firefox 58 604314 first 27 604372 firstattribute 27 604399 firstchild 387 604426 firstdayofweek 54 604813 firstdeclaration 27 604867 firstfile 9 604894 firstingroup 11 604903 firstitem 9 604914 firstname 23 604923 firstorderednode 9 604946 firstpagenumber 11 604955 firstpart 9 604966 firstsegment 9 604975 fitpagemode 29 604984 fittopage 11 605013 fix 198 605024 fixdimensionsheader 9 605222 fixed 198 605231 fixedarray 36 605429 fixedbackground 11 605465 fixedbottom 11 605476 fixedcollection 30 605487 fixedintable 4 605517 fixedleft 28 605521 fixedmap 25 605549 fixedright 11 605574 fixedsettings 47 605585 fixedstructure 41 605632 fixedtop 28 605673 fixingintable 38 605701 fixleft 5 605739 fixtable 11 605744 fixtimescaleheader 9 605755 fixtop 5 605764 flag 69 605769 flagged 20 605838 flash 9 605858 flashlightsupported 11 605867 flat 9 605878 flippagesleft 9 605887 flippagesup 9 605896 float 23 605905 floralwhite 12 605928 flowchart 9 605940 flowchartcontexttype 5 605949 flush 36 605954 flushasync 36 605990 fn 8 606026 fo 16 606034 folder 49 606050 folderchoiceform 15 606099 folderform 15 606114 folders 18 606129 foldersanditems 37 606147 foldersanditemsuse 20 606184 foldersontop 18 606204 folio 9 606222 follow 9 606231 following 9 606240 font 820 606249 fontchoosedialog 29 607069 fonttype 25 607098 fontuse 4 607123 footer 49 607127 footerbackcolor 31 607176 footerdatapath 9 607207 footerfont 31 607216 footerheight 20 607247 footerhorizontalalign 20 607267 footeronly 9 607287 footerpicture 20 607296 footersize 11 607316 footertemplate 53 607327 footertext 20 607380 footertextcolor 31 607400 for 5345 607431 forallusers 9 612776 forcedshutdown 9 612785 forceterminationtime 11 612794 forcurrentresult 9 612805 forecast 9 612814 forestgreen 11 612823 forfolder 9 612834 forfolderanditem 9 612843 forint 7 612852 foritem 9 612859 form 6951 612868 formallitems 40 619819 format 412 619859 formatdatatable 9 620271 formatofrows 11 620280 formatstringwizard 34 620291 formatted 149 620325 formatteddocument 126 620474 formatteddocumentbookmark 7 620600 formatteddocumentfield 9 620607 formatteddocumentfiletype 26 620616 formatteddocumentitemcollection 48 620642 formatteddocumentlinefeed 24 620690 formatteddocumentparagraph 48 620714 formatteddocumentparagraphtype 20 620762 formatteddocumentpicture 48 620782 formatteddocumentrange 19 620830 formatteddocumenttext 54 620849 formattedstring 36 620903 formattribute 34 620939 formattributetovalue 10 620973 formatuse 4 620983 formbackcolor 11 620987 formbutton 200 620998 formbuttonpicturelocation 20 621198 formbuttontype 25 621218 formcaption 9 621243 formcommand 55 621252 formcommandbar 9 621307 formcommandbarcreatebasedon 9 621316 formcommandbarimportant 9 621325 formcommandbarlabellocation 25 621334 formcommands 25 621359 formconversationsrepresentation 20 621384 formdatacollection 75 621404 formdatacollectionitem 25 621479 formdatasettingsloadform 12 621504 formdatasettingssaveform 12 621516 formdatasettingsstorage 20 621528 formdatastructure 20 621548 formdatastructureandcollection 85 621568 formdatatovalue 10 621653 formdatatree 15 621663 formdatatreeitem 30 621678 formdatatreeitemcollection 45 621708 formdecoration 145 621753 formdecorationtype 15 621898 formfield 245 621913 formfieldtype 105 622158 formgetprocessing 231 622263 formgroup 120 622494 formgrouptype 45 622614 formhelp 12 622659 formid 10 622671 formitemaddition 75 622681 formitemadditiontype 20 622756 formitemcommandbarlabellocation 25 622776 formitemorientation 15 622801 formitems 30 622816 formitemspacing 35 622846 formitemtitlelocation 35 622881 formname 18 622916 formnavigationpanel 9 622934 formnavigationpanelgoto 9 622943 formnavigationpanelimportant 9 622952 formnavigationpanelseealso 9 622961 formowner 20 622970 formpagesrepresentation 40 622990 formpagesstate 20 623030 forms 201 623050 formsettings 18 623251 formstandardurlvariant 55 623269 formtable 610 623324 formtextcolor 11 623934 formtype 34 623945 formwindowopeningmode 29 623979 foruser 9 624008 forward 21 624017 forwarded 10 624038 found 32 624048 foxbase 4 624080 foxpro 6 624084 fp 5 624090 fr 56 624095 fractiondigits 18 624151 fractiondigitsfacet 9 624169 fragment 52 624178 frame 13 624230 frameborder 18 624243 framecount 9 624261 frametags 9 624270 frameB538 9 624279 frequency 4 624288 frequencytable 9 624292 friend 9 624301 frmdtsettings 6 624310 from 96 624316 frombegin 9 624412 frombeginningofthishalfyear 9 624421 frombeginningofthismonth 9 624430 frombeginningofthisquarter 9 624439 frombeginningofthistendays 9 624448 frombeginningofthisweek 9 624457 frombeginningofthisyear 9 624466 fromend 9 624475 fromform 9 624484 fromlib 9 624493 fromxmltype 19 624502 front 9 624521 fruit 39 624530 fruits 24 624569 fs 8 624593 ftp 155 624601 ftpconnection 89 624756 ftpes 9 624845 ftpfile 60 624854 ftps 31 624914 ftpsecureconnectionusagelevel 30 624945 ftpA>548=5=85 99 624975 ftpD09; 65 625074 fuchsia 12 625139 full 37 625151 fullbackuppath 12 625188 fullcode 22 625200 fulldescr 44 625222 fullfilename 9 625266 fullname 760 625275 fullouter 9 626035 fullpresentation 14 626044 fullprivilegedmode 63 626058 fullscreenworkplace 9 626121 fulltextsearch 279 626130 fulltextsearcherror 9 626409 fulltextsearchlist 90 626418 fulltextsearchlistitem 25 626508 fulltextsearchmanager 95 626533 fulltextsearchmetadatause 15 626628 fulltextsearchmode 15 626643 fulltextsearchoninputbystring 102 626658 fulltextsearchrepresentationtype 15 626760 fulltextsearchservice 22 626775 fulltextsearchusing 9 626797 fulltextsearchversion 15 626806 function 108 626821 functionaloption 70 626929 functionaloptioncontent 30 626999 functionaloptioncontentitem 10 627029 functionaloptionparameters 10 627039 functionaloptions 10 627049 functionaloptionsparameter 70 627059 functionaloptionsparameters 10 627129 functionmenu 9 627139 functionmenucommand 12 627148 functions 9 627160 functionsfortechnicalspecialist 9 627169 funnel 9 627178 funnel3d 9 627187 funnelneckheight 9 627196 funnelneckwidth 10 627205 funnelspace 10 627215 furthestneighbor 9 627225 fuzzinessthreshold 9 627234 g 9 627243 g33992 6 627252 ga 14 627258 gainsboro 12 627272 gallery 9 627284 gantt 130 627293 ganttchart 281 627423 ganttchartbackgroundinterval 20 627704 ganttchartbackgroundintervalcollection 25 627724 ganttchartdatacolumn 20 627749 ganttchartdatacolumns 55 627769 ganttchartfield 9 627824 ganttchartinterval 65 627833 ganttchartintervalid 6 627898 ganttchartintervalrepresentation 26 627904 ganttchartintervalsselectionmode 26 627930 ganttchartintervaltextrepresentation 21 627956 ganttchartlegendarea 65 627977 ganttchartlink 25 628042 ganttchartlinktype 26 628067 ganttchartplotarea 110 628093 ganttchartpoint 70 628203 ganttchartpointcollection 50 628273 ganttchartscalekeeping 26 628323 ganttchartseries 65 628349 ganttchartseriescollection 50 628414 ganttcharttablelocation 26 628464 ganttcharttextplacementtype 21 628490 ganttcharttitlearea 65 628511 ganttchartvalue 80 628576 ganttchartvaluedata 20 628656 ganttchartvalueid 6 628676 ganttchartvaluesselectionmode 26 628682 ganttchartvaluetextrepresentation 16 628708 ganttchartverticalstretch 21 628724 gap 9 628745 gaudy 16 628754 gauge 9 628770 gaugebushcolor 10 628779 gaugebushthickness 10 628789 gaugechartqualityband 31 628799 gaugechartqualitybands 52 628830 gaugechartvaluerepresentation 25 628882 gaugechartvaluesscalelabelsarcdirection 10 628907 gaugechartvaluesscalelabelslocation 26 628917 gaugethickness 10 628943 gb 464 628953 gb18030 314 629417 gb2312 337 629731 gbk 335 630068 gcm 22 630403 gday 11 630425 ge 24 630436 general 12 630460 generalizedquality 9 630472 generatefromdatahistoryversionprocessing 112 630481 generatefromversion 9 630593 generateitems 11 630602 generatelicenseacquisitioncodestringchecksum 9 630613 generateonopen 9 630622 generatereport 12 630631 genitive 12 630643 geo 37 630655 geofence 34 630692 geofences 9 630726 geographical 75 630735 geographicalschema 205 630810 geographicalschemadatasourceorganizationtype 16 631015 geographicalschemafield 57 631031 geographicalschemalayer 90 631088 geographicalschemalayerdataseries 60 631178 geographicalschemalayerobjects 30 631238 geographicalschemalayers 50 631268 geographicalschemalayerseries 40 631318 geographicalschemalayerseriesimportmodetype 15 631358 geographicalschemalayerseriesshowmode 51 631373 geographicalschemalayerseriesvalue 30 631424 geographicalschemalegendarea 50 631454 geographicalschemalegenditem 40 631504 geographicalschemalegenditems 40 631544 geographicalschemalegenditemshowscaletype 16 631584 geographicalschemalineobjectsegments 30 631600 geographicalschemalinetype 36 631630 geographicalschemamarkertype 61 631666 geographicalschemamultipointobjectpoints 40 631727 geographicalschemaobjectfindtype 25 631767 geographicalschemaobjectmultipoint 80 631792 geographicalschemaobjectpoint 80 631872 geographicalschemaobjectpolygon 55 631952 geographicalschemaobjectpolyline 55 632007 geographicalschemaplotarea 30 632062 geographicalschemapointobjectdrawingtype 21 632092 geographicalschemapolygonobjectcontour 40 632113 geographicalschemapolygonobjectcontours 30 632153 geographicalschemapolylineobjectsegment 40 632183 geographicalschemaprojection 192 632223 geographicalschemarectangle 25 632415 geographicalschemashowedarea 30 632440 geographicalschemashowmode 21 632470 geographicalschematitlearea 50 632491 geographiccoordinates 25 632541 german 11 632566 get 2695 632577 getabsolute 18 635272 getaccesstoken 9 635290 getaccumulatedperformanceindicators 9 635299 getaccumulatedvalues 11 635308 getaction 91 635319 getactiononuserpasswordrequirementsviolationonauthentication 10 635410 getactive 9 635420 getactivewindow 9 635429 getadbannerid 9 635438 getadbannerrepresentation 9 635447 getaddition 11 635456 getadditionalindexesusage 10 635467 getaddressbylocation 10 635477 getadjustedeffectiveperiod 11 635487 getadministrators 11 635498 getadstatus 9 635509 getagentadmins 15 635518 getaggregates 11 635533 getaggregatesmode 11 635544 getaggregatesusing 11 635555 getall 18 635566 getallasync 9 635584 getallfilesmask 10 635593 getallowedaddins 11 635603 getallowedcomclass 11 635614 getallowedexternalapplications 11 635625 getallowedexternalmodules 11 635636 getallowedinternetresources 11 635647 getallowedvirtualdirectories 11 635658 getanalysis 9 635669 getanalyticssystemserveraddress 9 635678 getansweravailabilityendtime 9 635687 getansweravailabilityendtimeasync 9 635696 getappearancetemplate 10 635705 getapplication 10 635715 getapplicationdescription 9 635725 getarchivealways 9 635734 getarchivewhenrequired 9 635743 getarea 23 635752 getareatext 9 635775 getasbinarydata 9 635784 getasbinarydataasync 9 635793 getassignmentrules 26 635802 getasstream 9 635828 getasstring 9 635837 getasstringasync 9 635846 getasync 9 635855 getattachments 9 635864 getattachmentsasync 9 635873 getattribute 261 635882 getattributenode 234 636143 getattributes 10 636377 getaudioduration 9 636387 getauthenticationautosavesettings 9 636396 getavailablecountries 9 636405 getavailablefields 44 636414 getavailablekeys 9 636458 getavailablelocalecodes 10 636467 getavailablesettingssource 11 636477 getavailabletimezones 10 636488 getavailablevalues 30 636498 getbackgroundjob 9 636528 getbackgroundjobs 11 636537 getbackupcreationuniversaldate 9 636548 getbadge 9 636557 getbase 22 636566 getbase64binarydatabufferfrombinarydatabuffer 10 636588 getbase64binarydatafrombinarydata 10 636598 getbase64stringfrombinarydata 10 636608 getbase64stringfrombinarydatabuffer 10 636618 getbeginbookmark 11 636628 getbinarydata 47 636639 getbinarydataasync 9 636686 getbinarydatabuffer 9 636695 getbinarydatabufferasync 9 636704 getbinarydatabufferfrombase64binarydatabuffer 10 636713 getbinarydatabufferfrombase64string 10 636723 getbinarydatabufferfrombinarydata 10 636733 getbinarydatabufferfromhexbinarydatabuffer 10 636743 getbinarydatabufferfromhexstring 10 636753 getbinarydatabufferfromstring 10 636763 getbinarydatafrombase64binarydata 10 636773 getbinarydatafrombase64string 10 636783 getbinarydatafrombinarydatabuffer 10 636793 getbinarydatafromhexbinarydata 10 636803 getbinarydatafromhexstring 10 636813 getbinarydatafromstring 10 636823 getbinarydatastorageavailability 9 636833 getbinarydatastoragedatacopiesplacementmode 9 636842 getbinarydatastoragereadwritemode 9 636851 getbinarydatastorages 11 636860 getbinarydatastorageusemode 9 636871 getbodyasbinarydata 36 636880 getbodyasstream 45 636916 getbodyasstring 36 636961 getbodyfilename 27 636997 getbookmarkposition 11 637024 getbot 9 637035 getbots 9 637044 getbound 11 637053 getbounds 11 637064 getcalendar 9 637075 getcalendaraccounts 9 637084 getcalllog 11 637093 getcaption 9 637104 getcelltext 9 637113 getcertificates 9 637122 getcertificatesasync 9 637131 getcertificatesfromsignature 9 637140 getcertificatesfromsignatureasync 9 637149 getcertificatestore 9 637158 getcertificatestoreasync 9 637167 getchangeablefields 11 637176 getchildobjects 99 637187 getchoicedata 131 637286 getchoiceform 99 637417 getchoicelistpresentation 36 637516 getchoiceparameterlinks 20 637552 getchoiceparameters 20 637572 getclientallfilesmask 10 637592 getclientconnectionspeed 10 637602 getclientdisplaysinformation 10 637612 getclientpathseparator 10 637622 getclients 9 637632 getclipdata 5 637641 getclusteradministrators 11 637646 getclusteradmins 20 637657 getclustermanagers 31 637677 getclusters 112 637708 getclusterservices 17 637820 getcodeorder 22 637837 getcommandbar 54 637859 getcommandinterface 9 637913 getcommonappearancetemplate 9 637922 getcommonconnectionparameters 11 637931 getcommonform 10 637942 getcommonsettings 9 637952 getcommontemplate 10 637961 getcomobject 19 637971 getcompactdocument 12 637990 getcompositewordsseparationmode 9 638002 getcomputerfingerprintparameters 9 638011 getcomputersleepmodeprohibition 10 638020 getconfigurationid 10 638030 getconnectedcomponents 9 638040 getconnection 18 638049 getconnectionlocks 20 638067 getconnections 51 638087 getconnectionstate 9 638138 getconnectiontype 9 638147 getcontact 9 638156 getcontactaccounts 9 638165 getcontactcount 9 638174 getcontent 9 638183 getcontextmenu 45 638192 getconversation 10 638237 getconversationasync 10 638247 getconversationnotificationrepresentation 10 638257 getconversations 10 638267 getcopydatabaseuseinformation 9 638277 getcopyinfo 9 638286 getcryptomodleinformationasync 9 638295 getcryptomoduleinformation 18 638304 getcryptomoduleinformationasync 9 638322 getcryptosignaturescontainer 9 638331 getcryptosignaturescontainerasync 9 638340 getcurrentareaaddress 9 638349 getcurrentareafield 9 638358 getcurrentareatext 9 638367 getcurrentconnection 9 638376 getcurrentdirectory 9 638385 getcurrenterrorinfo 9 638394 getcurrentframenumber 9 638403 getcurrentinfobasesession 10 638412 getcurrentitem 18 638422 getcurrentlistsettingsurl 9 638440 getcurrentpage 18 638449 getcurrentreportsettingsurl 9 638467 getcurrentreportvarianturl 9 638476 getcurrentresultviewmode 9 638485 getcurrentsettings 11 638494 getcurrentstate 9 638505 getcurrentupdateaddress 11 638514 getcurrentuse 9 638525 getcurrentusernotifications 10 638534 getdata 16 638544 getdataareahorizontalsize 12 638560 getdataareaverticalsize 12 638572 getdataasync 19 638584 getdatabaseandbinarydatastoragedatasize 10 638603 getdatabaseconfigurationupdate 10 638613 getdatabasedatasize 10 638623 getdatadump 9 638633 getdatadumpaddress 9 638642 getdatadumpaddressasync 9 638651 getdatadumpasync 9 638660 getdatadumps 9 638669 getdatadumpsasync 9 638678 getdatafromsignature 9 638687 getdatafromsignatureasync 9 638696 getdatahistoryversioncomment 11 638705 getdatapresentation 9 638716 getdataprocessorurl 9 638725 getdataupdatetime 9 638734 getdatefrom 11 638743 getdateto 11 638754 getdbstoragestructureinfo 10 638765 getdefaultcalendar 9 638775 getdelayedspeechtotextresults 9 638784 getdescription 40 638793 getdescriptionprocessing 11 638833 getdetailrecordexpression 11 638844 getdetailrecordexpressionpresentation 11 638855 getdeveloperlicenseagreement 9 638866 getdeveloperlicenseusageavailability 9 638875 getdimensions 16 638884 getdisplayedtext 36 638900 getdocumentdataareahorizontalsize 9 638936 getdocumentdataareaverticalsize 9 638945 getdocumenthtml 18 638954 getedittext 18 638972 getelementbyid 18 638990 getelementbytagname 252 639008 getemailauthenticationsettings 9 639260 getendbookmark 11 639269 geterroronstartupprocessingsettings 9 639280 getevent 9 639289 geteventcalendar 9 639298 geteventlogdatastoragesplitperiod 10 639307 geteventlogeventuse 10 639317 geteventlogfiltervalues 10 639327 geteventlogperiod 10 639337 geteventlogusing 10 639347 getexcludedrecipients 9 639357 getexclusivemodeparameters 10 639366 getexpectedconnectionspeed 9 639376 getexternalaccessurl 10 639385 getexternalresourcesmode 10 639395 getexternalsystemdescription 10 639405 getexternalsystemtypes 10 639415 getexternalurl 10 639425 getfield 9 639435 getfields 11 639444 getfieldvalue 9 639455 getfile 10 639464 getfilefromserverasync 10 639474 getfiles 10 639484 getfilesarchivemode 15 639494 getfilesarchiveparameters 23 639509 getfilesdialogparameters 28 639532 getfilesfromserverasync 10 639560 getfirst 11 639570 getfirstdayofweek 9 639581 getflowchart 22 639590 getfolderchoiceform 22 639612 getform 527 639634 getformattedstring 11 640161 getformattedstringhyperlinkspresentations 18 640172 getformfunctionaloption 10 640190 getformfunctionaloptionparameters 10 640200 getforms 9 640210 getframecount 9 640219 getfromtempstorage 10 640228 getfullscreenadid 9 640238 getfulltextsearchmode 9 640247 getfulltextsearchversion 9 640256 getfunctionaloption 10 640265 getgraphdepth 9 640275 getgroups 9 640284 getheaders 9 640293 gethexbinarydatabufferfrombinarydatabuffer 10 640302 gethexbinarydatafrombinarydata 10 640312 gethexstringfrombinarydata 10 640322 gethexstringfrombinarydatabuffer 10 640332 gethibernatesessionterminatetime 10 640342 gethidden 18 640352 gethiddenasync 9 640370 gethtml 11 640379 gethtmldocument 9 640390 gethtmltext 9 640399 getid 29 640408 getidbyobject 218 640437 getimmutableuriref 9 640655 getinactivitytimeforterminatesession 10 640664 getinactivitytimeforterminatesessionnotification 10 640674 getinapppurchasereceipts 9 640684 getinapppurchasereceiptsdata 9 640693 getincomingpoints 11 640702 getindexingjobscount 9 640713 getinfobaseadditionalgrammars 9 640722 getinfobasebeginningofcentury 10 640731 getinfobasebinarydatastorages 15 640741 getinfobaseconnections 73 640756 getinfobaseexternalconnectionparameters 9 640829 getinfobaselocks 21 640838 getinfobasepredefineddata 10 640859 getinfobaseregionalsettings 10 640869 getinfobaseregistrationdata 9 640879 getinfobases 56 640888 getinfobasesessions 45 640944 getinfobasespeechprocessingdata 9 640989 getinfobasetimezone 10 640998 getinfobaseurl 10 641008 getinfobaseuserid 9 641018 getinformation 9 641027 getinputhint 9 641036 getintegration 10 641045 getintegrations 10 641055 getinterfacefunctionaloption 10 641065 getinterfacefunctionaloptionparameters 10 641075 getintermediatehypothesisvariants 9 641085 getintermediateresults 9 641094 getinvisiblefieldpresentations 9 641103 getinviteurltoconversation 10 641112 getitems 29 641122 getkeys 9 641151 getlast 11 641160 getlastlocation 9 641171 getlength 16 641180 getlicenseacquisitionavailability 9 641196 getlicensingcenteravailability 9 641205 getlicensingclientadditionalparameter 10 641214 getlicensingclientname 10 641224 getline 11 641234 getlink 11 641245 getlinkedwindow 9 641256 getlist 29 641265 getlistform 143 641294 getlisturl 9 641437 getloadform 11 641446 getlocalcalendaraccount 9 641457 getlocalcontactaccount 9 641466 getlocationbyaddress 10 641475 getlocks 35 641485 getlockwaittime 10 641520 getlowerbound 21 641530 getmailboxes 9 641551 getmailboxesbysubscription 9 641560 getmainsettingsbyusersettingid 11 641569 getmainwindowmode 9 641580 getmaxactionexecutiontime 9 641589 getmaximumnumberofparticipantsinvideoconference 10 641598 getmaxindexeddatasize 9 641608 getmaxtotalsperiod 11 641617 getmessage 10 641628 getmessageasync 9 641638 getmessagecount 9 641647 getmessages 10 641656 getmessagesflags 9 641666 getmessagetemplate 10 641675 getmessagetemplateasync 10 641685 getmessagetemplates 10 641695 getmessagetemplatesasync 10 641705 getmessageurl 9 641715 getmetadata 9 641724 getmintotalsperiod 22 641733 getminwritedatasize 9 641755 getmobileclientsignatureverificationmethod 10 641764 getmobiledevicelibraryfilepresentation 9 641774 getmobiledevicelibraryfilethumbnail 9 641783 getmobiledevicelibraryfilethumbnailasync 9 641792 getmodificationtime 27 641801 getmodificationtimeasync 9 641828 getmodificationuniversaltime 18 641837 getmodificationuniversaltimeasync 9 641855 getmonitoredgeofence 9 641864 getmonitoredgeofences 9 641873 getmostaccurateprovider 9 641882 getmostpowersavingprovider 9 641891 getnameditem 36 641900 getnetworkadaptersinformationasync 10 641936 getnewaccountform 11 641946 getnewadministrationkey 10 641957 getnewbusinessprocessform 11 641967 getnewcalculationtypeform 11 641978 getnewdocumentform 11 641989 getnewfolderform 22 642000 getnewitemform 22 642022 getnewnodeform 11 642044 getnewobjectref 99 642055 getnewtaskform 11 642154 getobject 308 642165 getobjectandformattributeconformity 10 642473 getobjectandformconformity 10 642483 getobjectbyid 218 642493 getobjecturl 63 642711 getoscaptionrepresentation 9 642774 getoutgoingpoint 11 642783 getoutgoingpoints 11 642794 getpalette 19 642805 getparameter 27 642824 getparameters 9 642851 getparent 90 642860 getparents 22 642950 getpassivesessionhibernatetime 10 642972 getpasswordcompromisechecksettings 9 642982 getpasswordrecoverysettings 9 642991 getpasswordsstoredvaluescount 9 643000 getpasswordsstoredvalueslist 9 643009 getpathseparator 10 643018 getperformingdatacompositionscheme 9 643028 getperformingdatacompositionsettings 9 643037 getpicture 64 643046 getpictures 9 643110 getplan 9 643119 getpolicies 9 643128 getportranges 15 643137 getpositionbookmark 11 643152 getpredefineddatainitialization 44 643163 getpredefineddataupdate 44 643207 getpredefinednames 40 643251 getpredefinedvaluefullname 10 643291 getpreferablemainserveruse 10 643301 getpresentation 9 643311 getpresenttotalsusing 22 643320 getprinterbottommarginsize 12 643342 getprinterleftmarginsize 12 643354 getprinterrightmarginsize 12 643366 getprintertopmarginsize 12 643378 getproperty 9 643390 getprovider 9 643399 getproviders 9 643408 getpurchasehistory 9 643417 getquery 18 643426 getquerytext 17 643444 getreadonly 18 643461 getreadonlyasync 9 643479 getreadonlystream 27 643488 getrealtimetimestamp 10 643515 getrecommendedreductionwidth 9 643525 getrecordeditingform 11 643534 getrecordmanager 11 643545 getrecordurl 18 643556 getref 110 643574 getreporttext 9 643684 getreporturl 9 643693 getrepresentation 9 643702 getrequireduse 9 643711 getresourceconsumptioncounters 11 643720 getresourceconsumptionlimits 11 643731 getrestrictionsforuseinfilter 9 643742 getrestrictionsforuseingroup 9 643751 getrestrictionsforuseinorder 9 643760 getresultviewmode 9 643769 getrewardedvideoid 9 643778 getroamingusage 9 643787 getrootsources 8 643796 getrows 9 643804 getrundata 9 643813 getsafemodedisabled 10 643822 getsaveform 11 643832 getscheduledata 22 643843 getscheduledjobs 9 643865 getschema 31 643874 getsecurityprofileaddins 15 643905 getsecurityprofileapplications 15 643920 getsecurityprofilecomclasses 15 643935 getsecurityprofileinternetresources 15 643950 getsecurityprofiles 26 643965 getsecurityprofileunsafeexternalmodules 15 643991 getsecurityprofilevirtualdirectories 15 644006 getselectedareas 9 644021 getselecteditems 20 644030 getselectedmultiplevalues 10 644050 getselectedrows 9 644060 getselectedtext 11 644069 getserverallfilesmask 10 644080 getserverpathseparator 10 644090 getserverworkingprocesses 30 644100 getservicedatadirectoriesfortransfer 12 644130 getservicedatadirsfortransfer 22 644142 getservices 11 644164 getservicesetting 11 644175 getservicesettingbyid 15 644186 getservicesettingbyparams 15 644201 getservicesettings 26 644216 getsessionadditionalgrammars 9 644242 getsessionapplicationissuesinformation 9 644251 getsessionconnectionparameters 11 644260 getsessionexternalconnectionparameters 9 644271 getsessionlocks 20 644280 getsessionregionalsettings 10 644300 getsessions 52 644310 getsessionslock 10 644362 getsettingactive 15 644372 getsettings 80 644387 getsettingsform 22 644467 getshortcaption 9 644489 getsignaturedescriptions 18 644498 getsignaturedescriptionsasync 18 644516 getslice 9 644534 getsmslog 11 644543 getsourcedata 9 644554 getsourcetext 9 644563 getspeechtotextmodelsdescription 9 644572 getspeechtotextmodeltotempstorage 9 644581 getstandardcommonsettingsstorage 10 644590 getstandarddynamiclistsusersettingsstorage 10 644600 getstandardformdatasettingsstorage 10 644610 getstandardodatainterfacecontent 10 644620 getstandardreplicationversion 9 644630 getstandardreportsusersettingsstorage 10 644639 getstandardreportsvariantsstorage 10 644649 getstandardurlexternaldatastorage 10 644659 getstate 29 644669 getstatepresentation 9 644698 getstoreddatacontent 9 644707 getstringdeclensions 10 644716 getstringdeclensionsbynumber 10 644726 getstringfrombinarydata 10 644736 getstringfrombinarydatabuffer 10 644746 getsubscriberapplicationlinks 10 644756 getsubscriberapplications 10 644766 getsupportedcameraresolutions 9 644776 gettbodies 9 644785 gettempfilename 10 644794 gettemplate 374 644804 gettemplates 9 645178 gettext 69 645187 gettextselectionbounds 50 645256 gettexttospeechavailablevoices 9 645306 gettextwithplaceholders 9 645315 gettooltiptext 45 645324 gettotalrecalcjobcount 10 645369 gettotalrecordexpression 11 645379 gettotalrecordexpressionpresentation 11 645390 gettotalsperiod 11 645401 gettotalssplittingmode 22 645412 gettotalsusing 33 645434 gettype 16 645467 getuidl 9 645483 getunsafeactionprotectiondisabled 10 645492 getupdateaddress 11 645502 getupperbound 21 645513 geturl 42 645534 geturlspresentations 10 645576 getusedserver 10 645586 getuser 10 645596 getuserappearancetemplate 9 645606 getuserconnectionparameters 11 645615 getuserdata 378 645626 getuserid 9 646004 getusermessages 21 646013 getusermessagetexts 9 646034 getuserpasswordcompromisecheck 10 646043 getuserpasswordexpirationnotificationperiod 10 646053 getuserpasswordhashalgorithmtype 10 646063 getuserpasswordmaxeffectiveperiod 10 646073 getuserpasswordmineffectiveperiod 10 646083 getuserpasswordminlength 10 646093 getuserpasswordreuselimit 10 646103 getuserpasswordstrengthcheck 10 646113 getusers 19 646123 getusersettings 9 646142 getusing 9 646151 getusingasdefaultstorage 9 646160 getuuidwithcompatibilitysupport 10 646169 getvalue 70 646179 getvalues 22 646249 getversion 11 646271 getversiondata 9 646282 getversiondiff 9 646291 getviewstatusitemtexts 9 646300 getwatchmode 10 646309 getwindows 10 646319 getworkingprocesses 26 646329 getworkingservers 20 646355 getworkprocesses 11 646375 getworkservers 11 646386 getwsdefinitions 9 646397 getxdto 18 646406 getxdtovalue 9 646424 getxmltype 19 646433 ghostwhite 12 646452 ghz 6 646464 gif 38 646470 givenname 9 646508 gl 16 646517 global 3813 646533 globalcalendareventkey 9 650346 globalcalendarkey 18 650355 globalcalendarskeyssupported 9 650373 globalcontactkey 9 650382 globalcontactskeyssupported 9 650391 globaleventskeyssupported 9 650400 globalsearch 9 650409 globalsearchhistory 5 650418 globalsearchmanager 40 650423 globalsearchplan 49 650463 globalsearchplanitem 48 650512 globalsearchresult 49 650560 globalsearchresultitem 39 650609 globalsearchresultitemaction 20 650648 globalsearchresultitemactioncollection 50 650668 globalstandardcommands 9 650718 gmonth 11 650727 gmonthday 11 650738 gmt 66 650749 gn 5 650815 gnome 12 650820 go 9 650832 goback 32 650841 goforward 32 650873 gold 11 650905 goldenrod 11 650916 good 6 650927 google 67 650933 googleplayinappbilling 12 651000 gooneleveldown 9 651012 goonelevelup 9 651021 goto 18 651030 gotobegin 12 651048 gotodate 9 651060 gotoend 12 651069 gotoexternalurl 12 651081 gotofirstrow 9 651093 gotolastrow 9 651102 gotonextitem 18 651111 gotonextmonth 9 651129 gotonextrow 9 651138 gotonextwindow 9 651147 gotonextyear 9 651156 gotopreviousitem 18 651165 gotopreviousmonth 9 651183 gotopreviousrow 9 651192 gotopreviouswindow 9 651201 gotopreviousyear 9 651210 gotorow 9 651219 gotostartpage 9 651228 gotourl 99 651237 gotourlerror 9 651336 gotovalue 9 651345 gprs 4 651354 gr 12 651358 gradient 57 651370 gradientpaletteendcolor 19 651427 gradientpalettemaxcolors 9 651446 gradientpalettestartcolor 19 651455 grammar 9 651474 grammarpresentation 15 651483 grant 5 651498 graph 65 651503 graphical 90 651568 graphicalrepresentationtype 9 651658 graphicalrepresentationtypeinchart 5 651667 graphicalschema 154 651672 graphicalschemafield 92 651826 graphicalschemagriddrawmode 25 651918 graphicalschemaitemactivity 115 651943 graphicalschemaitemcompletion 105 652058 graphicalschemaitemcondition 105 652163 graphicalschemaitemconnectionline 95 652268 graphicalschemaitemdecoration 95 652363 graphicalschemaitemdecorativeline 105 652458 graphicalschemaitemjoin 105 652563 graphicalschemaitempicturelocation 30 652668 graphicalschemaitemprocessing 105 652698 graphicalschemaitems 34 652803 graphicalschemaitemsplit 105 652837 graphicalschemaitemstart 105 652942 graphicalschemaitemsubbusinessprocess 105 653047 graphicalschemaitemswitch 110 653152 graphicalschemaitemswitchcase 20 653262 graphicalschemaitemswitchcases 20 653282 graphicalschemashapes 75 653302 graphicalschemeelementsidetype 30 653377 graphscheme 5 653407 grass 9 653412 gray 21 653421 grayedall 11 653442 grayscale 9 653453 great 27 653462 greater 27 653489 greaterorequal 18 653516 greek 136 653534 green 36 653670 greenyellow 11 653706 gridenabled 9 653717 gridhorizontalstep 9 653726 gridline 9 653735 gridlinecolor 9 653744 gridlinesshowmode 9 653753 gridverticalstep 9 653762 grosz 8 653771 grosze 8 653779 groszy 8 653787 group 693 653795 groupavailablefields 11 654488 groupbackcolor 11 654499 groupbox 60 654510 groupby 66 654570 groupconversation 11 654636 groupedby 6 654647 groupfields 54 654653 groupfields1 9 654707 groupfields2 9 654716 groupfieldsavailablefields 11 654725 groupfieldsplacement 20 654736 groupfilter 33 654756 groupfilterhierarchyonly 33 654789 groupfilterwithhierarchy 33 654822 groupfooter 5 654855 groupheader 5 654860 groupheadertemplates 11 654865 grouping 10 654876 groupitemauto 6 654886 groupitemfield 5 654892 groupitems 5 654897 groupname 19 654902 groupname1 9 654921 groupname2 9 654930 groupoutputparametervalues 6 654939 grouppercent 5 654945 grouppercentincolumnorpoint 6 654950 grouppercentinroworseries 6 654956 groupplacement 20 654962 groups 20 654982 groupserialnumber 5 655002 grouptemplate 30 655007 grouptemplates 11 655037 grouptextcolor 11 655048 grouptotal 9 655059 grouptype 33 655068 groupusevariant 16 655101 groupvalues 9 655117 grs 8 655126 gt 12 655134 gu 14 655146 gui 6 655160 guid 14 655166 gyear 11 655180 gyearmonth 11 655191 gzip 13 655202 gün 9 655215 h 119 655224 half 18 655343 halfyear 77 655361 halfyearperiod 77 655438 halfyearsincebeginofperiod 9 655515 halfyearsincebeginofperiod445 9 655524 handler 54 655533 handlers 9 655587 hans 22 655596 hant 26 655618 hasattribute 241 655644 hasattributes 378 655885 haschildnodes 378 656263 hashalgorithm 18 656641 hashalgorithmdefinition 9 656659 hashalgorithms 9 656668 hashfunction 45 656677 hashsum 155 656722 hasitemconditionalappearance 11 656877 hasitemfilter 11 656888 hasitemorder 11 656899 hasitemoutputparameters 11 656910 hasitemselection 11 656921 hasname 27 656932 hasp 12 656959 hasvalue 27 656971 have 11 656998 having 5 657009 he 150 657014 head 45 657164 headasync 9 657209 header 187 657218 headeradditionalpicture 11 657405 headerandfooter 9 657416 headerbackcolor 33 657425 headerdatapath 9 657458 headerfont 22 657467 headerformat 9 657489 headerheight 20 657498 headerhorizontalalign 29 657518 headerpicture 29 657547 headers 74 657576 headersize 11 657650 headertemplate 55 657661 headertext 20 657716 headertextcolor 33 657736 headertooltip 11 657769 heading 9 657780 headtask 44 657789 height 465 657833 heightcontrolvariant 18 658298 heightinmonths 9 658316 heightintablerows 9 658325 help 234 658334 helpsettings 12 658568 helptext 9 658580 helpurl 54 658589 helvetica 18 658643 hex 44 658661 hexbinary 4 658705 hh 91 658709 hhc 4 658800 hht 4 658804 hi 14 658808 hibernate 14 658822 hibernatesession 11 658836 hibernatesessionterminatetime 25 658847 hidden 53 658872 hiddenrepresentationtitlebackcolor 9 658925 hide 71 658934 hidebasevalue 33 659005 hideitemsbyimportance 9 659038 hidepage 9 659047 hidepassword 12 659056 hierarchical 27 659068 hierarchicalbody 33 659095 hierarchicalfooter 9 659128 hierarchicalgroupfooter 5 659137 hierarchicalgroupheader 5 659142 hierarchicalheader 9 659147 hierarchicallist 9 659156 hierarchicalorder 33 659165 hierarchicalview 44 659198 hierarchy 62 659242 hierarchyascending 9 659304 hierarchycheckdataset 10 659313 hierarchycheckdatasetparameter 10 659323 hierarchydataset 11 659333 hierarchydescending 9 659344 hierarchyfoldersanditems 9 659353 hierarchyfootertemplate 9 659362 hierarchynameindatasource 9 659371 hierarchyofitems 9 659380 hierarchyonly 45 659389 hierarchypanellocation 9 659434 hierarchytemplate 9 659443 hierarchytype 33 659452 high 51 659485 highbound 14 659536 highbounddefault 14 659550 highest 9 659564 highlight 11 659573 highlighttext 11 659584 history 61 659595 historypanel 4 659656 hk 18 659660 hkscs 319 659678 hmac 12 659997 hn 12 660009 holidaycolor 11 660021 home 66 660032 homefax 9 660098 homepage 36 660107 homepageforms 19 660143 homepagesettings 30 660162 homepageworkarea 10 660192 honeycomb 9 660202 honeydew 12 660211 horizontal 63 660223 horizontalaccuracy 9 660286 horizontalalign 277 660295 horizontalalignincolumn 11 660572 horizontalaligningroup 54 660583 horizontalbrackets 9 660637 horizontalchartpointsorder 4 660646 horizontaldensity 9 660650 horizontalifpossible 9 660659 horizontallevel 5 660668 horizontallines 29 660673 horizontallinesindatatable 9 660702 horizontally 27 660711 horizontalmerge 5 660738 horizontaloverallplacement 15 660743 horizontalscalekeeping 9 660758 horizontalscalelabelsorientation 9 660767 horizontalscaletoplevelcount 9 660776 horizontalscalevaluecount 9 660785 horizontalscalevalueminwidth 9 660794 horizontalscrollbar 40 660803 horizontalspacing 27 660843 horizontalstretch 248 660870 host 58 661118 hosted 8 661176 hostname 87 661184 hotpink 12 661271 hour 102 661283 hourperiod 79 661385 hoursincebeginofperiod 9 661464 house 23 661473 hp 136 661496 hpk 16 661632 hr 16 661648 href 76 661664 hreflang 18 661740 hs 4 661758 hs256 13 661762 hs384 13 661775 hs512 13 661788 hspace 29 661801 hta 4 661830 htm 17 661834 html 3067 661851 html3 12 664918 html4 28 664930 html5 24 664958 htmlanchorelement 255 664982 htmlappletelement 250 665237 htmlattribute 165 665487 htmlattributemap 30 665652 htmlbodyelement 35 665682 htmlbuttonelement 230 665717 htmlcollection 20 665947 htmlcomment 195 665967 htmlcontentcategory 80 666162 htmldivelement 200 666242 htmldocument 293 666442 htmldocumentfield 87 666735 htmldocumentfieldmode 15 666822 htmldocumentfieldprintsettings 6 666837 htmldocumentshell 30 666843 htmldom 696 666873 htmlelement 195 667569 htmlembedelement 225 667764 htmlformelement 235 667989 htmlframeelement 235 668224 htmlframesetelement 205 668459 htmlheadelement 200 668664 htmlhrelement 200 668864 htmlhtmlelement 200 669064 htmliframeelement 245 669264 htmlimageelement 250 669509 htmlinputelement 275 669759 htmllinkelement 240 670034 htmlmailtext 36 670274 htmlmessagetext 18 670310 htmlmetaelement 215 670328 htmlnodelist 15 670543 htmlobjectelement 275 670558 htmlpreelement 200 670833 htmlreader 29 671033 htmlscriptelement 225 671062 htmltablecaptionelement 200 671287 htmltablecellelement 260 671487 htmltablecolelement 215 671747 htmltableelement 290 671962 htmltablerowelement 230 672252 htmltext 204 672482 htmlwriter 29 672686 html4>:C<5=B 13 672715 htmlB5:AB 14 672728 http 2930 672742 httpauthenticationrequest 9 675672 httpauthenticationrequestmethod 9 675681 httpconnection 128 675690 httpequiv 9 675818 httpmethod 122 675827 httprequest 63 675949 httpresponse 35 676012 https 221 676047 httpsconn 5 676268 httpservice 128 676273 httpserviceconnection 8 676401 httpservicemethod 15 676409 httpservicerequest 50 676424 httpserviceresponse 59 676474 httpservices 9 676533 httpserviceurltemplate 65 676542 http70?@>A 169 676607 http70?@>A=00CB5=B8D8:0F8N 13 676776 http70?@>A=0?@>25@:C@57C;LB0B00CB5=B8D8:0F88 9 676789 http<5B>4 135 676798 http>B25B 99 676933 httpA5@28A 309 677032 httpA5@28A70?@>A 54 677341 httpA5@28A>B25B 72 677395 httpA5@28AK 9 677467 httpA>548=5=85 158 677476 htw 4 677634 htx 4 677638 hu 39 677642 huawei 20 677681 huaweiinapppurchase 12 677701 hy 20 677713 hyperlink 210 677733 hyperthreading 4 677943 hz 379 677947 i 164 678326 i1 5 678490 i2 5 678495 i386 4 678500 i4 40 678504 i8 5 678544 iana 8 678549 iassignmentrule 36 678557 iat 5 678593 ibconnmode 14 678598 ibdesc 8 678612 ibinarydatastorageinfo 18 678620 ibm 1568 678638 ibm01140 136 680206 ibm01141 136 680342 ibm01142 136 680478 ibm01143 136 680614 ibm01144 136 680750 ibm01145 136 680886 ibm01146 136 681022 ibm01147 136 681158 ibm01148 136 681294 ibm01149 136 681430 ibm037 136 681566 ibm1026 136 681702 ibm1047 136 681838 ibm278 136 681974 ibm280 136 682110 ibm284 136 682246 ibm285 136 682382 ibm290 136 682518 ibm297 136 682654 ibm367 136 682790 ibm420 136 682926 ibm424 136 683062 ibm500 136 683198 ibm870 136 683334 ibm871 136 683470 ibm918 136 683606 ibmdb2 21 683742 ibseance 4 683763 ice 9 683767 iclusterinfo 109 683776 iclustermanagerinfo 36 683885 iclusterserviceinfo 30 683921 ico 19 683951 icon 33 683970 iconnectionshort 55 684003 icq 4 684058 icu 12 684062 id 393 684074 iddoc 4 684467 ide 10 684471 identificationkind 7 684481 identifier 17 684488 identity 12 684505 identityconstraintdefinition 9 684517 identityconstraintdefinitions 11 684526 identityconstraints 11 684537 idispatch 6 684548 idref 12 684554 idrefs 12 684566 idxcname 5 684578 idxcode 10 684583 ie 16 684593 ietf 80 684609 iexplore 5 684689 iextwndssupport 5 684694 if 14 684699 ifilter 4 684713 iframe 17 684717 iframetags 9 684734 iframeB538 13 684743 ignore 27 684756 ignorecertificaterevocationstatus 9 684783 ignorecomments 9 684792 ignoredocumenttype 9 684801 ignoreincompletevalues 4 684810 ignorenullvalues 10 684814 ignorepasswordcompromisecheckserviceerrors 45 684824 ignoreprocessinginstructions 9 684869 ignoreservercertificateschainrevocationsoftfail 4 684878 ignoresignaturevalidity 9 684882 ignoretimevalidity 9 684891 ignorewhitespace 27 684900 ignorexmldeclaration 9 684927 iif 10 684936 iii 4 684946 iinfobaseconnectioninfo 223 684950 iinfobaseinfo 163 685173 iinfobaseshort 19 685336 iis 8 685355 il 12 685363 ilicenseinfo 78 685375 image 33 685453 imagedata 9 685486 images 9 685495 imap 287 685504 imappassword 9 685791 imapport 9 685800 imapsecureauthenticationonly 9 685809 imapserveraddress 9 685818 imapuser 9 685827 imapusessl 9 685836 img 16 685845 immutableuriref 4 685861 implappid 8 685865 implementationspecific 9 685873 implicit 9 685882 import 14 685891 importall 9 685905 importance 18 685914 important 27 685932 importantcolor 11 685959 importattributes 9 685970 importnode 18 685979 importxdtomodel 10 685997 import0B@81CBK 9 686007 impossible 13 686016 in 341 686029 inaccessible 9 686370 inactive 9 686379 inactiveborder 11 686388 inactivetitlebar 11 686399 inactivetitlebartext 11 686410 inadditionalsubmenu 9 686421 inapppurchase 30 686430 inapppurchasereceipt 20 686460 inapppurchasereceiptdata 30 686480 inapppurchases 18 686510 inapppurchaseservice 31 686528 inapppurchasesmanager 85 686559 inapppurchasesvalidation 10 686644 inapppurchasesvalidationmanager 15 686654 inapppurchasetype 15 686669 inbox 12 686684 inbrowserwindow 9 686696 inbytesall 28 686705 inbytescurrent 28 686733 inbyteslast5min 28 686761 incell 9 686789 include 42 686798 includecertificate 10 686840 includecertificatesinsignature 9 686850 includechainwithoutroot 9 686859 includeconfigurationextensions 9 686868 included 9 686877 includedatainsignature 9 686886 includedattributes 9 686895 includedetailerrordescriptioninreport 9 686904 includedetailerrordescriptioninreportonclient 9 686913 includedetailerrordescriptioninreportonserver 9 686922 includedinmergedarea 9 686931 includedwholly 9 686940 includehelpincontents 198 686949 includeinavailablefields 10 687147 includeincommandinterface 9 687157 includeinfobaseinformationinreport 9 687166 includeinfobaseinformationinreportonclient 9 687175 includeinfobaseinformationinreportonserver 9 687184 includes 13 687193 includesubjectcertificate 9 687206 includeswholly 9 687215 includesysteminfoinreport 9 687224 includesysteminfoinreportonclient 9 687233 includeusernameinreport 9 687242 includeusernameinreportonclient 9 687251 includeusernameinreportonserver 9 687260 includewholechain 9 687269 includewindowspictureinreport 9 687278 includewindowsscreenshotinreportonclient 9 687287 including 9 687296 inclusive 44 687305 incoming 18 687349 incomingsharerequestcommanddescription 29 687367 incomingsharerequestcommandgenerateprocessing 10 687396 incomingsharerequests 9 687406 incomingsharerequeststandardcommand 25 687415 incommandbar 9 687440 incommandbarandinadditionalsubmenu 9 687449 incompletechoicemode 36 687458 increasearea 9 687494 increasediameter 9 687503 increasevalue 9 687512 indent 79 687521 indentattributes 9 687600 indentchars 9 687609 indented 9 687618 independent 27 687627 independently 9 687654 independentlyandsimultaneously 9 687663 index 188 687672 indexedfields 9 687860 indexes 35 687869 indexexpressions 8 687904 indexfield 10 687912 indexing 83 687922 indexof 1911 688005 indexstoragetablespace 6 689916 indextrue 9 689922 indexupdatecomplete 9 689931 indexwithadditionalorder 9 689940 indialog 18 689949 indianred 11 689967 indicator 9 689978 indicatorinchart 10 689987 indigo 11 689997 inetcfg 8 690008 info 6 690016 infobas 6 690022 infobase 613 690028 infobaseconnection 40 690641 infobaseconnectionnumber 10 690681 infobaseconnectionstring 10 690691 infobaseid 78 690701 infobaselocalecode 10 690779 infobasename 90 690789 infobaseregionalsettings 80 690879 infobaseregistered 9 690959 infobases 30 690968 infobasesession 45 690998 infobasesessionnumber 10 691043 infobasesperworkingprocesslimit 14 691053 infobaseuser 180 691067 infobaseuserauthenticationlock 30 691247 infobaseuserauthenticationlockmanager 20 691277 infobaseuserauthenticationlocksettings 20 691297 infobaseuserauthenticationmethod 40 691317 infobaseuserid 9 691357 infobaseusername 24 691366 infobaseuserpasswordrecoverymethod 25 691390 infobaseusers 10 691415 infobaseusersmanager 30 691425 information 1035 691455 informationregister 256 692490 informationregisterlist 30 692746 informationregistermanager 126 692776 informationregisterperiodicity 58 692902 informationregisterrecord 72 692960 informationregisterrecordkey 49 693032 informationregisterrecordmanager 114 693081 informationregisterrecordset 224 693195 informationregisters 20 693419 informationregisterselection 66 693439 informationregistersmanager 12 693505 informationregistertotalsoptions 6 693517 infoset 50 693523 inhierarchy 18 693573 initdetails 18 693591 initialize 33 693609 initializeasync 36 693642 initializedpredefineddataincatalog 6 693678 initializedpredefineddatainchartofaccounts 6 693684 initializedpredefineddatainchartofcalculationtypes 6 693690 initializedpredefineddatainchartofcharacteristictypes 6 693696 initializepredefineddata 10 693702 initiallistview 40 693712 initialtreeview 40 693752 initialupdateinprogress 9 693792 initialupdatetablescount 9 693801 inlist 36 693810 inlistbyhierarchy 18 693846 inner 23 693864 inout 18 693887 input 135 693905 inputandpredictable 9 694040 inputarea 9 694049 inputbystring 87 694058 inputcolumnssetting 36 694145 inputdate 10 694181 inputdateasync 10 694191 inputdocumenthtml 18 694201 inputencoding 54 694219 inputfield 9 694273 inputfieldautofillhint 100 694282 inputfieldcalculator 12 694382 inputfieldcalendar 12 694394 inputfieldchoosetype 12 694406 inputfieldclear 12 694418 inputfieldcommanddescription 34 694430 inputfieldcommandgenerateparameters 15 694464 inputfieldcommandsource 15 694479 inputfieldmultiplevaluepictureshape 20 694494 inputfieldmultiplevaluepicturesize 25 694514 inputfieldopen 12 694539 inputfieldselect 12 694551 inputfieldstandardcommand 60 694563 inputhint 9 694623 inputnumber 10 694632 inputnumberasync 10 694642 inputonbasis 11 694652 inputstring 10 694663 inputstringasync 10 694673 inputtext 27 694683 inputvalue 10 694710 inputvalueasync 10 694720 insert 1396 694730 insertafter 9 696126 insertarea 12 696135 insertbefore 387 696147 insertcell 9 696534 insertdata 45 696543 insertline 11 696588 insertportrange 25 696599 insertrow 9 696624 inside 27 696633 insidedragcheck 9 696660 insidescale 9 696669 installaddin 10 696678 installaddinasync 10 696688 installcomputerinformationextensionasync 10 696698 installcryptoextension 10 696708 installcryptoextensionasync 10 696718 installfilesystemextension 10 696728 installfilesystemextensionasync 10 696738 installpackages 9 696748 instance 18 696757 instandalonewindow 9 696775 instantmessageaddresses 5 696784 instantmessagingaddresses 9 696789 instantmessagingtype 9 696798 instrumental 12 696807 int 24 696819 integrate 4 696843 integrated 4 696847 integration 100 696851 integrationdataservice 22 696951 integrationservice 70 696973 integrationserviceactiveupdate 36 697043 integrationservicechannel 75 697079 integrationservicechannelmanager 25 697154 integrationservicechannelmessagedirection 16 697179 integrationservicechannelreceivingqueue 6 697195 integrationservicechannelsendingqueue 6 697201 integrationservicechannelstate 15 697207 integrationserviceexternalmessagebody 6 697222 integrationservicemanager 35 697228 integrationservicemessage 50 697263 integrationservicemessagebody 6 697313 integrationservices 20 697319 integrationservicesettings 31 697339 integrationservicesettingsupdate 36 697370 integrationservicesmanager 20 697406 intel64 8 697426 intent 19 697434 interactiveactivate 6 697453 interactiveactivationprocessing 33 697459 interactivechangeofposted 5 697492 interactivecleardeletionmark 5 697497 interactivecleardeletionmarkpredefineddata 6 697502 interactivedelete 5 697508 interactivedeletemarked 5 697513 interactivedeletemarkedpredefineddata 6 697518 interactivedeletepredefineddata 6 697524 interactiveexecute 6 697530 interactiveinsert 5 697536 interactivemodeuse 9 697541 interactiveopenextdataprocessors 6 697550 interactiveopenextreports 6 697556 interactiveposting 5 697562 interactivepostingregular 5 697567 interactivesetdeletionmark 5 697572 interactivesetdeletionmarkpredefineddata 6 697577 interactivestart 6 697583 interactiveundoposting 5 697589 interclusterdistances 9 697594 interface 106 697603 interfacecompatibilitymode 44 697709 interfacecontrolitem 18 697753 interfacecontrolitemcollection 42 697771 interfacelanguagecode 9 697813 interfaces 9 697822 interleaved 4 697831 internal 12 697835 internalsettingsstorage 6 697847 internalsubset 9 697853 internet 162 697862 internetconnection 29 698024 internetconnectioninformation 39 698053 internetconnectiontype 25 698092 internetfullaccess 14 698117 internetmail 124 698131 internetmailaddress 30 698255 internetmailaddresses 30 698285 internetmailattachment 40 698315 internetmailattachmentencodingmode 15 698355 internetmailattachments 30 698370 internetmailmessage 174 698400 internetmailmessageflags 44 698574 internetmailmessageimportance 30 698618 internetmailmessagenonasciisymbolsencodingmode 20 698648 internetmailmessageparsestatus 15 698668 internetmailprofile 129 698683 internetmailprotocol 20 698812 internetmailtext 30 698832 internetmailtextprocessing 15 698862 internetmailtexts 30 698877 internetmailtexttype 25 698907 internetproxy 59 698932 internetresourcesfullaccess 47 698991 interruptcurrentservercall 35 699038 intersection 8 699073 interval 31 699081 intervalboundvariant 45 699112 intervalincludingbounds 9 699157 intervalincludinglowerbound 9 699166 intervalincludingupperbound 9 699175 intervalrepresentation 9 699184 intervalsselectionmode 9 699193 intervaltextrepresentation 9 699202 into 6 699211 invalidcopydatabaseusevariant 9 699217 invaliditeratorstate 9 699226 invalidpassword 9 699235 invert 9 699244 invertedbackcolor 9 699253 invite 10 699262 iobjectlock 37 699272 ios 327 699309 ip 274 699636 ipaddress 9 699910 iphone 13 699919 iportrangeinfo 19 699932 ipv4 7 699951 ipv6 7 699958 ip04@5A 9 699965 ip04@5A035=B0 40 699974 ip04@5A:;85=B0 20 700014 iq 12 700034 ir 12 700046 iregserverinfo 5 700058 ireguserinfo 48 700063 irisrecognition 9 700111 irrelevance 9 700120 is 113 700129 isblankstring 10 700242 ischangerecorded 11 700252 ischaracters 27 700263 iscircular 55 700290 isconnected 9 700345 iscurrentadapter 9 700354 isdefaultattribute 27 700363 isdefaultnamespace 117 700390 isdescendant 18 700507 isdirectory 18 700525 isdirectoryasync 9 700543 isecurityprofile 108 700552 isecurityprofileaddin 24 700660 isecurityprofileapplication 24 700684 isecurityprofilecomclass 36 700708 isecurityprofileexternalmodule 24 700744 isecurityprofileinternetresource 36 700768 isecurityprofilevirtualdirectory 36 700804 iselementcontentwhitespace 36 700840 isemptiable 11 700876 isempty 172 700887 isenable 14 701059 isequalnode 378 701073 iserrorofcategory 9 701451 iserveragentconnection 522 701460 iservicedatadirfortransferinfo 30 701982 iservicesetting 30 702012 isessioninfo 288 702042 isetool 12 702330 isfile 18 702342 isfileasync 9 702360 isfolder 106 702369 isglobal 22 702475 isid 18 702497 isinputavailable 20 702515 isinrole 10 702535 isinstalled 9 702545 islocked 117 702554 ismain 18 702671 ismap 9 702689 isnew 99 702698 isnull 5 702797 iso 1684 702802 isolate 9 704486 isolated 9 704495 isopen 41 704504 isreference 44 704545 isrequired 11 704589 isresizable 22 704600 isrvrprocessinfo 5 704622 iss 5 704627 issamenode 378 704632 issecure 9 705010 isset 9 705019 issubset 11 705028 issuedbyserver 14 705039 issuer 20 705053 istempstorageurl 10 705073 isunread 9 705083 isversionactual 9 705092 iswhitespace 27 705101 iswildcardsubset 11 705128 it 40 705139 italic 9 705179 item 1082 705188 itemcount 27 706270 itemheight 18 706297 itemheightcontrolvariant 20 706315 itemhorizontallocation 25 706335 itemminwidth 9 706360 items 586 706369 itemsandtitlesalign 27 706955 itemsandtitlesalignvariant 35 706982 itemsbehaviorwhenspaceinsufficient 9 707017 itemsettings 11 707026 itemslefttitlesleft 9 707037 itemslefttitlesright 9 707046 itemsrighttitlesleft 9 707055 itemsrighttitlesright 9 707064 itemstimerepresentation 9 707073 itemtitleheight 18 707082 itemtype 20 707100 itemtypedefinition 11 707120 itemtypename 11 707131 itemverticalalign 25 707142 itemwidth 18 707167 iteratenext 9 707185 iterationcount 9 707194 itf 20 707203 itunes 15 707223 iunknown 6 707238 iv8agentconnection 6 707244 iv8serverconnection 5 707250 ivory 12 707255 iworkingprocessconnection 102 707267 iworkingprocessinfo 126 707369 iworkingserverinfo 126 707495 j 11 707621 ja 152 707632 japanese 35 707784 java 22 707819 javascript 17 707841 javascripttags 9 707858 javascriptB538 14 707867 jd 4 707881 jis 373 707885 jm 14 708258 jo 12 708272 job 66 708284 jobschedule 90 708350 jobscheduler 13 708440 jobtitle 14 708453 join 45 708467 joins 9 708512 jointype 9 708521 jour 14 708530 journal 209 708544 jours 7 708753 jp 474 708760 jpeg 47 709234 jpg 16 709281 json 391 709297 jsoncharactersescapemode 20 709688 jsondateformat 20 709708 jsondatewritingvariant 20 709728 jsonlinebreak 25 709748 jsonreader 59 709773 jsonserializersettings 24 709832 jsonvaluetype 60 709856 jsonwriter 74 709916 jsonwritersettings 58 709990 justify 9 710048 k 4 710057 k7mdeng 5 710061 ka 38 710066 kaku 17 710104 kb 9 710121 ke 18 710130 keepmappingtoextendedconfigurationobjectsbyids 10 710148 kerberos 10 710158 key 364 710168 keyandvalue 19 710532 keycode 45 710551 keyfield 18 710596 keyfields 27 710614 keyid 9 710641 keyref 9 710650 keyseries 20 710659 keysindatatable 9 710679 keytype 9 710688 khaki 12 710697 killbymemorywithdump 14 710709 killproblemprocesses 14 710723 kiosk 9 710737 kit 8 710746 kk 53 710754 kl 14 710807 kmeans 9 710821 kn 14 710830 ko 126 710844 koi8 426 710970 kok 14 711396 kr 487 711410 kro05 5 711897 kroon 7 711902 krooni 7 711909 ksc 340 711916 kw 12 712256 ky 16 712268 kz 36 712284 l 66 712320 label 339 712386 labelangle 9 712725 labelarea 18 712734 labelbackcolor 10 712752 labelborder 10 712762 labelbordercolor 10 712772 labelcolor 9 712782 labeldelimiter 19 712791 labelfield 9 712810 labelfont 19 712819 labelformat 9 712838 labellocation 19 712847 labelorientation 9 712866 labelpercentformat 19 712875 labelpicturelocation 41 712894 labels 20 712935 labeltext 27 712955 labeltextcolor 19 712982 labeltype 39 713001 labelvalueformat 19 713040 lan 9 713059 landscape 18 713068 lang 55 713086 language 138 713141 languagecode 132 713279 languages 10 713411 large 27 713421 largedashed 9 713448 largestep 20 713457 largetextfont 11 713477 last 27 713488 last7days 9 713515 lastactiveat 14 713524 lastactivitytime 11 713538 lastchild 387 713549 lastclearingdate 18 713936 lastdbmscalltime 11 713954 lasthalfyear 9 713965 lasthalfyeartillsamedate 9 713974 lastjob 9 713983 lastlevelvalues 9 713992 lastmonth 9 714001 lastmonthtillsamedate 9 714010 lastname 23 714019 lastquarter 9 714042 lastquartertillsamedate 9 714051 lasttendays 9 714060 lasttendaystillsamedaynumber 9 714069 lastweek 9 714078 lastweektillsameweekday 9 714087 lastyear 9 714096 lastyeartillsamedate 9 714105 lati 8 714114 latitude 9 714122 latitudeshift 9 714131 latn 36 714140 lats 8 714176 latu 8 714184 launch 9 714192 launcher 4 714201 launchexecuted 9 714205 launchparameter 9 714214 launchsharerequestdata 9 714223 launchurl 9 714232 launchurlnavigationdata 9 714241 lavender 11 714250 lavenderblush 11 714261 lawngreen 11 714272 lax 9 714283 layer 54 714292 layers 9 714346 lb 12 714355 lbound 6 714367 ldap 4 714373 leadingcalculationtypes 158 714377 leadingcalculationtypesrow 24 714535 leadingregisterdata 9 714559 leafcount 9 714568 leave 466 714577 ledger 9 715043 left 466 715052 leftarrow 9 715518 leftborder 22 715527 leftbottom 27 715549 leftcenter 9 715576 leftcolumn 9 715585 lefthorizontal 9 715594 leftmargin 70 715603 leftnarrow 9 715673 leftnarrowest 9 715682 leftouter 9 715691 leftrightarrow 9 715700 lefttext 11 715709 lefttop 27 715720 lefttoright 9 715747 leftvalue 11 715756 leftvertical 9 715767 leftwide 9 715776 leftwidest 9 715785 legal 13 715794 legendarea 36 715807 legendplacement 23 715843 lei 8 715866 lemonchiffon 11 715874 length 108 715885 lengthfacet 9 715993 less 18 716002 lessorequal 18 716020 letter 21 716038 leu 11 716059 level 288 716070 levelcount 29 716358 leveldown 12 716387 levelfootertemplates 9 716399 levelingroup 5 716408 levelinselection 33 716413 levelnumber 9 716446 levels 36 716455 leveltemplates 9 716491 levelup 12 716500 lexicalnamespaceconstraint 11 716512 lexicalvalue 174 716523 lf 31 716697 lgd 6 716728 li 14 716734 library 10 716748 lic 4 716758 licdstr 5 716762 license 65 716767 licenseacquisition 10 716832 licenseacquisitionavailability 15 716842 licenseacquisitioncomputerfingerprintparameters 35 716857 licenseacquisitionkeyfingerprintparameters 30 716892 licenseacquisitionlicensingcenteravailability 15 716922 licenseacquisitionmanager 100 716937 licenseacquisitionrequest 139 717037 licensedistributionallowed 19 717176 licensefilename 9 717195 licenses 27 717204 licenseservice 23 717231 licensetype 14 717254 licensingcenteraddress 9 717268 licensingcenteremail 9 717277 licensingcenterphonenumber 9 717286 licensingcenterpresentation 9 717295 lifetime 11 717304 lifetimelimit 14 717315 light 19 717329 lightblue 11 717348 lightcoral 12 717359 lightcyan 12 717371 lightgoldenrod 12 717383 lightgoldenrodyellow 12 717395 lightgray 12 717407 lightgreen 12 717419 lightpink 12 717431 lightsalmon 11 717443 lightseagreen 12 717454 lightskyblue 12 717466 lightslateblue 12 717478 lightslategray 12 717490 lightsteelblue 11 717502 lightyellow 12 717513 like 59 717525 lime 11 717584 limegreen 11 717595 limit 9 717606 limited 9 717615 limitlevelcount 9 717624 limitsearchstring 69 717633 line 158 717702 linear 27 717860 linecolor 67 717887 linecount 11 717954 lineinchart 10 717965 linen 11 717975 linenumber 447 717986 linenumberlength 9 718433 lines 9 718442 lineseparator 11 718451 linespacing 11 718462 linesplitter 18 718473 linetype 9 718491 link 43 718500 linkbytype 54 718543 linkconditionexpression 20 718597 linkedvaluechangemode 16 718617 linkitem 19 718633 linklines 18 718652 linklinescolor 9 718670 links 18 718679 linktable 9 718697 linktags 9 718706 linktype 20 718715 linkB538 9 718735 linux 230 718744 linuxcertificationauthoritycertificates 9 718974 linuxclientcertificate 9 718983 list 1771 718992 listbox 84 720763 listchoicemode 21 720847 listcolumn 18 720868 listcolumns 54 720886 listcurrentrowobject 9 720940 listcurrentrowrecord 9 720949 listdetail 6 720958 listeditmode 15 720964 listform 15 720979 listgroupfooter 6 720994 listgroupheader 5 721000 listhierarchicalgroupfooter 6 721005 listhierarchicalgroupheader 6 721011 listitemtype 9 721017 listpresentation 162 721026 lists 70 721188 listsettings 12 721258 listvaluetype 11 721270 listverticaloverall 6 721281 listviewmode 12 721287 listviewmodehierarchicallist 12 721299 listviewmodelist 12 721311 listviewmodetree 12 721323 listwithcurrentsettings 9 721335 listwithcurrentsettingsandrow 9 721344 litai 8 721353 litas 8 721361 little 66 721369 littlecircle 9 721435 littleendian 39 721444 littlesquare 9 721483 littletriangle 9 721492 lits 8 721501 lmbcs 398 721509 load 232 721907 loadaddin 10 722139 loadbalancingmode 25 722149 loadbinarydatastoragedifferentialbackup 15 722174 loadbinarydatastoragefullbackup 15 722189 loadcolumn 154 722204 loaddatadump 9 722358 loaddatadumpasync 9 722367 loaddefaultsetting 11 722376 loaddifferentialbackup 20 722387 loadfixedsettings 11 722407 loadform 18 722418 loadfullbackup 20 722436 loading 9 722456 loadlicenseacquisitionrequest 9 722465 loadprocessing 11 722474 loadreportsettings 11 722485 loadsettings 11 722496 loadusersettings 11 722507 loadvalues 11 722518 loadxslstylesheet 9 722529 loadxslstylesheetfromfile 9 722538 loadxslstylesheetfromnode 9 722547 loadxslstylesheetfromstring 9 722556 local 55 722565 localcalendareventkey 5 722620 localcalendarkey 5 722625 localcontactkey 5 722630 localdate 9 722635 localdatewithoffset 9 722644 locale 212 722653 localecode 54 722865 localecodepresentation 10 722919 localfileaccesserror 9 722929 localhost 24 722938 localityname 8 722962 localname 428 722970 localnotifications 9 723398 localonly 9 723407 locate 202 723416 located 202 723618 location 159 723820 locationdata 36 723979 locationdatauseenabled 9 724015 locationincommandbar 9 724024 locationproviderinformation 60 724033 locationrelativetogeofence 15 724093 locationtools 110 724108 locationurl 9 724218 lock 129 724227 lockapplication 10 724356 lockbegintime 67 724366 lockdataforedit 10 724433 lockdescr 14 724443 lockduration 9 724457 lockedat 14 724466 lockendtime 47 724480 lockformdataforedit 10 724527 lockforupdate 22 724537 lockmessage 47 724559 lockownerwindow 9 724606 lockparameter 47 724615 lockscheduledjobs 47 724662 lockwholeinterface 9 724709 log 34 724718 log10 29 724752 logarithmic 9 724781 logform 36 724790 loggedfields 9 724826 logginglevel 4 724835 login 9 724839 logo 9 724848 logoff 18 724857 logon 18 724875 long 16 724893 longdesc 30 724909 longitude 9 724939 longitudeshift 9 724948 lookupnamespaceuri 135 724957 lookupprefix 153 725092 low 105 725245 lowbound 14 725350 lowbounddefault 14 725364 lower 15 725378 lowerbound 20 725393 lowest 9 725413 lt 114 725422 lte 4 725536 ltrim 5 725540 lu 16 725545 lv 42 725561 ly 12 725603 m 234 725615 m4a 4 725849 ma 12 725853 mac 482 725865 macaddress 9 726347 macintosh 379 726356 macos 136 726735 macoscertificateselectmode 24 726871 macoscertificationauthoritycertificates 9 726895 macosclientcertificate 18 726904 mac04@5A 9 726922 magenta 12 726931 magnifier 12 726943 maibox1 8 726955 maibox2 8 726963 mail 29 726971 mailaddress 20 727000 mailaddresses 30 727020 mailattachment 15 727050 mailattachments 30 727065 mailbox 112 727095 mailmessage 54 727207 mailto 10 727261 mailtools 25 727271 main 72 727296 mainaction 20 727368 mainaddressingattribute 9 727388 mainclientapplicationwindowmode 40 727397 maindatacompositionschema 9 727437 mainfilter 9 727446 mainfilteronperiod 9 727455 maininterface 9 727464 mainmanager 25 727473 mainmanagerport 11 727498 mainonly 14 727509 mainport 77 727523 mainsection 7 727600 mainsectioncommandinterface 9 727607 mainsectionpicture 9 727616 mainserver 23 727625 mainserveraccess 5 727648 mainserveravailable 10 727653 mainstyle 9 727663 maintable 9 727672 mainwindow 9 727681 mainwindowmodeembeddedworkplace 6 727690 mainwindowmodefullscreenworkplace 6 727696 mainwindowmodekiosk 6 727702 mainwindowmodenormal 6 727708 mainwindowmodeworkplace 6 727714 makeaudiorecording 9 727720 makedisable 9 727729 makephoto 9 727738 maketagreadonlyasync 9 727747 makevideorecording 9 727756 manage 246 727765 managed 246 728011 managedapplication 9 728257 managedapplicationmodule 9 728266 managedlocksessionnumber 22 728275 manager 48 728297 manager1 4 728345 manager2 4 728349 managerids 11 728353 managermodule 198 728364 map 71 728562 mapi 12 728633 maprepresentationsupported 10 728645 maps 10 728655 marginheight 18 728665 marginwidth 18 728683 mark 4 728701 markcolor 5 728705 marker 54 728710 markerfound 9 728764 markerinchart 10 728773 markerindex 9 728783 markincomplete 78 728792 markingappearance 20 728870 markingstep 20 728890 marknegatives 187 728910 marktodelete 12 729097 marktype 5 729109 maroon 12 729114 masculine 6 729126 mask 156 729132 master 9 729288 masternode 20 729297 masternodeupdate 36 729317 matchesregex 6 729353 matchingkey 22 729359 matrix 13 729381 max 20 729394 maxbubblesize 32 729414 maxconnections 14 729446 maxdepth 4 729460 maxexclusive 9 729464 maxexclusivefacet 9 729473 maxextdimensioncount 9 729482 maxheight 205 729491 maxheightintablerows 9 729696 maxicode 21 729705 maximize 9 729726 maximized 9 729735 maximum 51 729744 maxinclusive 9 729795 maxinclusivefacet 9 729804 maxinterval 4 729813 maxintervalrepetition 4 729817 maxintervals 9 729821 maxintervalunit 4 729830 maxlabelrows 9 729834 maxlength 18 729843 maxlengthfacet 9 729861 maxmemorysize 14 729870 maxmemorytimelimit 25 729884 maxoccurs 11 729909 maxscheduledjobsstartshiftwithoutactiveusers 61 729920 maxseries 30 729981 maxseriescount 9 730011 maxseriespercent 9 730020 maxsize 9 730029 maxsoftwarelicenseusers 11 730038 maxunsuccessfulattemptscount 9 730049 maxunsuccessfulverificationcodevalidationattemptscount 54 730058 maxusers 20 730112 maxusersall 14 730132 maxuserscur 19 730146 maxvalue 119 730165 maxvaluedetectionmethod 9 730284 maxwidth 223 730293 mb 4 730516 mc 14 730520 mcc 4 730534 md 4 730538 md5 38 730542 mddistr 6 730580 me 22 730586 mean 9 730608 media 9 730617 median 9 730626 mediarecordndef 19 730635 medium 18 730654 mediumaquamarine 11 730672 mediumblue 12 730683 mediumgray 12 730695 mediumgreen 12 730707 mediumorchid 12 730719 mediumpurple 12 730731 mediumseagreen 12 730743 mediumslateblue 12 730755 mediumspringgreen 12 730767 mediumturquoise 12 730779 mediumvioletred 12 730791 member 18 730803 members 18 730821 membertypedefinitions 11 730839 membertypenames 11 730850 membertypes 9 730861 memo 4 730870 memoryall 28 730874 memorycurrent 28 730902 memoryexcesstime 14 730930 memorylast5min 28 730944 memorysize 14 730972 memorystream 167 730986 memoryusage 33 731153 memoryusagecurrent 11 731186 memoryusageexcesstime 11 731197 memoryusagelast5min 11 731208 memoryusagetotal 11 731219 menubar 11 731230 menuitemtext 11 731241 menumode 11 731252 merge 34 731263 mergefiles 10 731297 message 172 731307 messagebuttonpanelbuttonactionsupported 9 731479 messagedirection 9 731488 messagedisplayvariant 9 731497 messageeditingavailable 9 731506 messagefromexternalsite 15 731515 messagehistory 12 731530 messageid 9 731542 messagendef 19 731551 messageno 176 731570 messagerecipient 9 731746 messages 6 731755 messagestatus 35 731761 messagetemplate 9 731796 messagetemplateplaceholdersvalues 9 731805 messagetext 18 731814 messagetoexternalsite 14 731832 messagetype 11 731846 messaging 31 731857 meta 4 731888 metadata 539 731892 metadataobject 9165 732431 metadataobjectcollection 35 741596 metadataobjectenumeratedproperties 350 741631 metadataobjectpropertyvaluecollection 15 741981 metadatapresentation 8 741996 metadatause 9 742004 method 44 742013 methodname 35 742057 methods 9 742092 metric 48 742101 metrics 48 742149 mh 14 742197 microphone 9 742211 microsoft 158 742220 mid 10 742378 middle 9 742388 middlename 32 742397 midnightblue 12 742429 miesic 7 742441 miesica 7 742448 miesice 7 742455 miesicy 7 742462 mime 128 742469 mimetype 47 742597 mimetypes 18 742644 min 16 742662 minbubblesize 32 742678 mincasecount 4 742710 mincolumnwidth 9 742714 minconfidence 4 742723 minexclusive 9 742727 minexclusivefacet 9 742736 minheight 16 742745 minimize 9 742761 minimized 9 742770 minimportance 4 742779 minimum 36 742783 minimumwidth 18 742819 mininclusive 9 742837 mininclusivefacet 9 742846 mininterval 4 742855 minintervalrepetition 4 742859 minintervals 9 742863 minintervalunit 4 742872 minlength 13 742876 minlengthfacet 9 742889 minoccurs 11 742898 minrowheight 9 742909 minscheduledjobsstartperiodwithoutactiveusers 61 742918 minsupport 8 742979 mintcream 11 742987 minute 93 742998 minuteperiod 77 743091 minutesincebeginofperiod 9 743168 minvalue 119 743177 minvaluedetectionmethod 9 743296 minwidth 16 743305 minwritedatasize 9 743321 mirroronleft 9 743330 mirrorontop 9 743339 miscellaneousapianglobular1projection 9 743348 miscellaneousaugustepicycloidalprojection 9 743357 miscellaneousbaconglobularprojection 9 743366 miscellaneousnicolosiglobularprojection 9 743375 miscellaneousorteliusovalprojection 9 743384 miscellaneousvandergrinten1projection 9 743393 miscellaneousvandergrinten2projection 9 743402 miscellaneousvandergrinten3projection 9 743411 miss 14 743420 missed 9 743434 missing 5 743443 mistyrose 12 743448 mix 20 743460 mixed 20 743480 mk 16 743500 mkcol 13 743516 ml 14 743529 mm 106 743543 mmm 6 743649 mmmm 14 743655 mms 16 743669 mmsattachment 24 743685 mmssendingsupported 11 743709 mms2;>65=85 30 743720 mngsrv 33 743750 mnt 12 743783 mo 21 743795 mob 71 743816 mobile 46 743887 mobileappbackgroundjob 48 743933 mobileappclient 62 743981 mobileapplicationfunctionalities 195 744043 mobileapplicationfunctionalitysupported 10 744238 mobileapplicationnavigationadditionaldata 9 744248 mobileapplicationurls 9 744257 mobileappserver 53 744266 mobileclient 73 744319 mobileclientdataexchange 6 744392 mobileclientsignature 10 744398 mobileclientsignatureverificationmethod 20 744408 mobileclientwindowsettings 11 744428 mobiledeviceapplicationrun 79 744439 mobiledeviceapplicationrunadditionaldata 29 744518 mobiledeviceapplicationrunadditionaldataitem 20 744547 mobiledeviceapplicationrunchoiceparameters 39 744567 mobiledeviceapplicationrunclipdata 49 744606 mobiledeviceapplicationrunclipdataitem 29 744655 mobiledeviceapplicationrunresult 35 744684 mobiledevicecommandbarcontent 9 744719 mobiledeviceformcommandbarcontent 40 744728 mobiledevicelibrarydir 10 744768 mobiledevicelibrarydirasync 10 744778 mobiledevicelibrarydirtype 20 744788 mobileplatformwindowsettings 10 744808 mobilestandaloneserver 53 744818 moccasin 11 744871 modalityusemode 39 744882 modalmode 20 744921 mode 49 744941 model 51 744990 modelgroup 20 745041 modelgroupdefinition 9 745061 modelgroupdefinitions 11 745070 modelid 9 745081 moderate 9 745090 modern 11 745099 modification 10 745110 modificationaccesspermissions 9 745120 modificationtime 11 745129 modified 227 745140 modifiesdata 40 745367 modifiesdatastructure 9 745407 modifiesstoreddata 9 745416 modify 227 745425 module 380 745652 modulename 10 746032 modulesavailableforextension 66 746042 modulesnotavailableforextension 61 746108 moment 6 746169 monarch 9 746175 mono 9 746184 month 197 746193 monthday 9 746390 monthdayweekday 9 746399 monthfrombegofquarter 9 746408 monthfrombegofyear 9 746417 monthly 9 746426 monthname 6 746435 monthperiod 77 746441 months 18 746518 monthsincebeginofperiod 9 746536 monthsincebeginofperiod445 9 746545 monthsperiod 9 746554 mother 9 746563 move 1369 746572 moveboundaryonposting 33 747941 movedown 12 747974 movefile 10 747986 movefileasync 10 747996 moveitem 12 748006 moveitemsbyimportance 9 748018 moveleft 12 748027 moveright 12 748039 moveto 81 748051 movetocontent 27 748132 movetomailbox 9 748159 moveup 12 748168 mozilla 36 748180 mp3 9 748216 mp4 24 748225 mpeg 4 748249 mpeg4aac 20 748253 mr 18 748273 mrs 4 748291 ms 179 748295 ms535128 6 748474 msdn 9 748480 mssqlserver 33 748489 msword 7 748522 mt 20 748529 mta 5 748549 multiline 130 748554 multimediadata 29 748684 multimediarecordingstopbuttonplacement 55 748713 multimediatools 130 748768 multimediatoolserror 9 748898 multiple 36 748907 multiplechoice 47 748943 multiplevalue 9 748990 multiplevalueopening 10 748999 multiplevaluepicturedatapath 9 749009 multiplevaluepictureshape 10 749018 multiplevaluepicturesize 9 749028 multiplevaluepresentationdatapath 9 749037 multiplevaluesadd 10 749046 multiplevaluesbackcolor 10 749056 multiplevaluesdelete 10 749066 multiplevaluesextendededit 10 749076 multiplevaluesfont 10 749086 multiplevalueshyperlink 9 749096 multiplevalueskeyfield 9 749105 multiplevaluesorderfield 9 749114 multiplevaluespicture 9 749123 multiplevaluesseparator 5 749132 multiplevaluestextcolor 10 749137 multiplevaluesusefield 9 749147 multiplevalueurlprocessing 10 749156 multiplevaluevaluedatapath 9 749166 multirow 9 749175 multithreaded 6 749184 musiclibrary 9 749190 mx 12 749199 mxl 72 749211 mxl7 35 749283 my 59 749318 myca 10 749377 mycomputername 4 749387 myphoto 4 749391 mysplitteddata 11 749395 mysql 5 749406 n 263 749411 na 20 749674 name 16641 749694 namecontains 7 766335 nameditem 9 766342 nameequals 7 766351 namefield 9 766358 nameindatasource 36 766367 namematchesregex 8 766403 nameprefix 19 766411 namespace 34 766430 namespaceconstraint 11 766464 namespaceconstraintcategory 11 766475 namespacecontext 54 766486 namespacemappings 18 766540 namespaces 4 766558 namespaceuri 320 766562 namespaceuris 9 766882 namestartswith 7 766891 namesuffix 9 766898 nap 61 766907 napa 22 766968 nape 8 766990 native 45 766998 navajowhite 11 767043 navigate 11 767054 navigationbyurlprocessing 10 767065 navigationcolor 11 767075 navigationpanel 21 767086 navigationpanelimportant 9 767107 navigationpanelordinary 9 767116 navigationpanelseealso 9 767125 navigationpoint 12 767134 navigationprocessing 10 767146 navy 12 767156 nb 14 767168 nbf 5 767182 nbsp 11 767187 nd 21 767198 ndef 49 767219 ndeftags 9 767268 nds 22 767277 near 20 767299 nearestneighbor 9 767319 neb8vb0wmkrcdozwven9ea6bcow 8 767328 need 10 767336 needed 5 767346 needle 9 767351 needs 5 767360 negativeassertion 36 767365 negativenumberpresentation 54 767401 negativetextcolor 11 767455 negotiate 28 767466 nesteddatacompositionschema 30 767494 nesteddatacompositionschemas 70 767524 nesteddatasets 33 767594 nesteditemslayout 11 767627 nestedparametervalues 21 767638 nestedtable 11 767659 net 19 767670 networkadapterinformation 25 767689 networkerror 9 767714 networkkey 20 767723 new 104 767743 newcolumn 9 767847 newconversation 12 767856 newerror 36 767868 newfolder 6 767904 newitemstexttype 9 767910 newlines 9 767919 newobject 36 767928 newobjectwriteprocessing 24 767964 newpassword 9 767988 newplanneritemstexttype 15 767997 newpredefineddata 36 768012 newrowshowcheck 209 768048 newrowshowcheckvariant 15 768257 newversion 36 768272 newwindow 12 768308 newwriteprocessing 20 768320 next 251 768340 next7days 9 768591 nextattribute 27 768600 nextbyfieldvalue 7 768627 nextdeclaration 27 768634 nexthalfyear 9 768661 nexthalfyeartillsamedate 9 768670 nextmonth 9 768679 nextmonthtillsamedate 9 768688 nextnode 18 768697 nextpart 9 768715 nextquarter 9 768724 nextquartertillsamedate 9 768733 nextseries 9 768742 nextsibling 387 768751 nexttendays 9 769138 nexttendaystillsamedaynumber 9 769147 nextweek 9 769156 nextweektillsameweekday 9 769165 nextyear 9 769174 nextyeartillsamedate 9 769183 nf 6 769192 nfc 66 769198 nfctools 20 769264 nfd 22 769284 ng 24 769306 ngs 22 769330 ngày 7 769352 ni 12 769359 nickname 23 769371 nil 20 769394 nillable 56 769414 nl 18 769470 nlz 16 769488 nm 6 769504 nmtoken 12 769510 nmtokens 12 769522 nn 28 769534 no 43 769562 noaddition 9 769605 noconnection 9 769614 node 335 769623 nodecount 9 769958 nodedatasource 9 769967 nodeiterator 10 769976 nodename 383 769986 nodes 9 770369 nodeset 48 770378 nodetype 413 770426 nodevalue 378 770839 noembed 4 771217 noembedtags 9 771221 noembedB538 9 771230 noexpand 9 771239 nomenclature 10 771248 nominative 12 771258 nonasciisymbolsencodingmode 9 771270 none 687 771279 nonnegative 9 771966 nonnumericchartvaluesuse 4 771975 nonnumericchartvalueuse 20 771979 nonnumericvaluesuse 23 771999 nonnumericvalueuse 9 772022 nonobjectdata 9 772031 nonperiodical 36 772040 nonselectedpicturetext 29 772076 nop 143 772105 nopermissiontousefunctionality 9 772248 noresize 9 772257 normal 114 772266 normalizationvalues 9 772380 normalize 378 772389 normalizedarea 9 772767 normalizedbar 9 772776 normalizedbar3d 9 772785 normalizedcolumn 9 772794 normalizedcolumn3d 9 772803 normalizedfunnel 9 772812 normalizedfunnel3d 9 772821 normalizedocument 9 772830 normalseparation 9 772839 normaltextfont 11 772848 northborderlatitude 20 772859 not 164 772879 notactive 9 773043 notapplicable 9 773052 notasciisymbols 9 773061 notation 108 773070 notationdeclaration 9 773178 notationdeclarations 11 773187 notationname 36 773198 notations 9 773234 notautofree 9 773243 notbeginswith 9 773252 notcontains 18 773261 notdefined 9 773279 notdownloaded 9 773288 note 32 773297 notequal 18 773329 notfilled 9 773347 notfinished 9 773356 notgroup 9 773365 notification 42 773374 notificationbodyerror 9 773416 notificationprocessing 22 773425 notifications 12 773447 notificationslimitexceeded 9 773459 notificationwindow 9 773468 notify 22 773477 notifyactivate 10 773499 notifyactivateobject 11 773509 notifychanged 10 773520 notifychoice 21 773530 notifywritenewobject 11 773551 notifywritingnew 10 773562 notinhierarchy 18 773572 notinlist 18 773590 notinlistbyhierarchy 18 773608 notisolated 9 773626 notlike 9 773635 notstarted 9 773644 notused 63 773653 novalidate 9 773716 nowrap 9 773725 np 6 773734 ns 33 773740 nshomedirectory 10 773773 nsidirectoryserviceprovider 10 773783 nsp 54 773793 nss 5 773847 nss1 4 773852 nss2 4 773856 nssdb 4 773860 nsssecureconnection 5 773864 nstr 10 773869 nt 49 773879 ntfs 20 773928 ntlm 41 773948 null 417 773989 num 26 774406 num0 12 774432 num9 12 774444 numadd 12 774456 number 286 774468 numberallowedlength 36 774754 numberdialing 9 774790 numberdialingsupported 11 774799 numberedlist 9 774810 numberfrombinarystring 10 774819 numberfromhexstring 10 774829 numberinwords 16 774839 numberlength 36 774855 numberperiodicity 27 774891 numberqualifiers 34 774918 numbersdecimalseparator 54 774952 numbersdigitgroupformat 60 775006 numbersdigitgroupseparator 54 775066 numbertype 36 775120 numbervalue 9 775156 numberwithending 6 775165 numdecimal 12 775171 numdivide 12 775183 numerationservice 24 775195 numerator 9 775219 numericvaluetype 15 775228 numericvalueuse 4 775243 nummultiply 12 775247 numsubtract 12 775259 nvu34lbq5tqfqrawqm3wpvc8imm 8 775271 nz 24 775279 o 32 775303 oauth 4 775335 oauth2 29 775339 object 459 775368 objectactivationprocessing 12 775827 objectautonumerationmode 34 775839 objectbelonging 646 775873 objectcount 45 776519 objectdata 9 776564 objectdeletion 31 776573 objectend 9 776604 objectfield 18 776613 objectform 15 776631 objectid 22 776646 objectkey 65 776668 objectmodule 108 776733 objectname 21 776841 objectpresentation 90 776862 objectproperties 10 776952 objects 124 776962 objectstart 9 777086 objectstype 9 777095 objecttags 9 777104 objecttype 25 777113 objectuuid 25 777138 objectB538 9 777163 ocsp 42 777172 octet 16 777214 odata 74 777230 odataconnection 8 777304 odatainterface 48 777312 odbc 20 777360 odc 4 777380 odf 4 777384 ods 50 777388 oem 39 777438 oemfixedfont 11 777477 oemH@8DB<>=>H8@8==K9 11 777488 of 3367 777499 offbalance 44 780866 office 7 780910 ogg 4 780917 oid 51 780921 ok 118 780972 okcancel 9 781090 oldlace 12 781099 oldpin 9 781111 ole 4 781120 olive 12 781124 olivedrab 12 781136 om 20 781148 on 15 781168 onactionperiod 9 781183 onactivate 67 781192 onactivatearea 11 781259 onactivatecell 22 781270 onactivatecolumn 12 781292 onactivatedate 20 781304 onactivatefield 10 781324 onactivateinterval 18 781334 onactivaterow 33 781352 onactivatevalue 18 781385 onaddtocollaborationsystemconversation 9 781403 onautocreatenewnode 11 781412 once 15 781423 onchange 85 781438 onchangeareacontent 11 781523 onchangeareacontentevent 9 781534 onchangedisplaysettings 27 781543 oncheckchange 23 781570 oncheckexecuteprocessing 11 781593 oncheckexecutionprocessing 11 781604 onclick 13 781615 onclientapplicationresume 10 781628 onclientapplicationsuspend 10 781638 onclose 22 781648 oncloseconnection 9 781670 onclosehandler 9 781679 oncollaborationsystemmessageactionchoice 10 781688 oncollaborationsystemmessagebuttonpanelbuttonclick 10 781698 oncomplete 11 781708 oncomposeresult 22 781719 oncopy 102 781741 oncreateatserver 10 781843 oncreatecollaborationsystemconversation 9 781853 oncreatesubbusinessprocesses 11 781862 oncreatetask 11 781873 oncurrentpagechange 20 781884 oncurrentparentchange 22 781904 oncurrentrepresentationperiodchange 9 781926 ondatachange 88 781935 ondataget 12 782023 ondeletefromcollaborationsystemconversation 9 782035 oneandhalf 9 782044 oneditend 31 782053 onenterpressed 9 782084 onerror 9 782093 onerrorhandler 9 782102 onetimecode 9 782111 onexecute 23 782120 onexit 24 782143 ongetdataatserver 9 782167 onglobalsearch 10 782176 onglobalsearchresultactionchoice 10 782186 onglobalsearchresultchoice 10 782196 onintervaleditend 18 782206 online 12 782224 onlinefc 10 782236 onloaddatafromsettingsatserver 10 782246 onloadusersettingsatserver 18 782256 onloadvariantatserver 9 782274 only 36 782283 onlyinallactions 9 782319 onmainserveravailabilitychange 20 782328 onmainserverunavalablebehavior 74 782348 onmessage 9 782422 onmessagehandler 9 782431 onnextrow 9 782440 onopen 22 782449 onopenconnection 9 782471 onopenhandler 9 782480 onpastefromclipboard 20 782489 onperiodoutput 20 782509 onreadatserver 99 782529 onreceivedatafrommaster 12 782628 onreceivedatafromslave 12 782640 onreceivenodedatafrommaster 12 782652 onregistrationperiod 9 782664 onreopen 22 782673 onreopenformfillparameters 15 782695 onreopenfromotherserver 10 782710 onrowoutput 12 782720 onsavedatainsettingsatserver 10 782732 onsaveusersettingsatserver 18 782742 onsavevariantatserver 9 782760 onscreenkeyboardreturnkeytext 60 782769 onsenddatatomaster 12 782829 onsenddatatoslave 12 782841 onsendnodedatatoslave 12 782853 onsetnewcode 35 782865 onsetnewnumber 35 782900 onsettingsunavailability 11 782935 onstart 24 782946 onstartedit 22 782970 ontop 9 782992 onunavailabilitydatacompositionsettingsaction 15 783001 onupdateusersettingsetatserver 27 783016 onvalue 18 783043 onvaluechange 9 783061 onvalueedit 10 783070 onwrite 348 783080 onwriteatserver 99 783428 open 238 783527 openasync 27 783765 openattachment 9 783792 openbutton 31 783801 opencloseaverage 9 783832 openconnection 9 783841 opendroplist 9 783850 openfile 93 783859 openforappend 9 783952 openforappendasync 9 783961 openform 10 783970 openformhelp 21 783980 openformmodal 10 784001 openforread 9 784011 openforreadasync 9 784020 openforwrite 9 784029 openforwriteasync 9 784038 openfrommainserver 12 784047 openfromstandaloneserver 12 784059 openhelp 10 784071 openhelpcontent 10 784081 openhelpindex 10 784091 openhighlowclose 9 784101 openid 118 784110 openid2 24 784228 openid2providercontextservice 24 784252 openidauthentication 66 784276 openidconnectauthentication 66 784342 openidprovider 55 784408 openidproviderurl 36 784463 openidprovideruserid 36 784499 opening 41 784535 openingbalance 42 784576 openingbalancecr 22 784618 openingbalancedr 22 784640 openingsplittedbalancecr 22 784662 openingsplittedbalancedr 22 784684 openitemspanel 4 784706 openlevelcount 20 784710 openoffice 15 784730 openorcreate 9 784745 openssl 98 784754 opensslsecureconnection 24 784852 openstream 72 784876 openstreamforread 27 784948 openstreamforreadasync 9 784975 opentype 18 784984 openvalue 30 785002 openvalueasync 10 785032 operation 28 785042 operations 18 785070 operator 9 785088 operators 9 785097 oppositeendian 158 785106 optimal 18 785264 option 18 785282 optional 9 785300 optionaljoinsgroupbegin 9 785309 options 18 785318 opus 4 785336 or 59 785340 oracle 28 785399 oracledatabase 33 785427 orange 42 785460 orangered 12 785502 orchid 12 785514 order 583 785526 orderavailablefields 22 786109 ordered 9 786131 orderednodeiterator 9 786140 orderednodesnapshot 9 786149 orderexpression 4 786158 orderexpressions 20 786162 orderingitem 36 786182 orderingitemcontrol 18 786218 orderitemauto 6 786236 orderlength 9 786242 orderport 5 786251 orders 5 786256 orderservice 5 786261 ordersetting 207 786266 ordertype 21 786473 ordinal 15 786494 ordinary 18 786509 ordinaryapplication 9 786527 ordinaryapplicationmodule 9 786536 org 532 786545 org8a 4 787077 org8b 4 787081 organization 23 787085 organizationname 8 787108 organizationunitname 8 787116 organizer 13 787124 orgl8 4 787137 orgroup 9 787141 orientation 127 787150 orientationdetectionmode 9 787277 origin 9 787286 original 9 787295 originalbasename 20 787304 originalextension 20 787324 originalfullname 20 787344 originalname 20 787364 originalpath 20 787384 os 9 787404 osauthentication 88 787413 osbackup 9 787501 oscertificateselectmode 24 787510 oscertificationauthoritycertificates 9 787534 osclientcertificate 18 787543 osencodingwithutf8 18 787561 ostaskbar 9 787579 ostaskbarmanager 25 787588 osuser 86 787613 osuserdata 9 787699 osusers 10 787708 osversion 10 787718 osx 10 787728 other 67 787738 othererror 9 787805 otherfax 9 787814 otherfieldsuse 18 787823 othername 5 787841 ou 8 787846 out 18 787854 outboundwholeintervalcolor 9 787872 outbytesall 28 787881 outbytescurrent 28 787909 outbyteslast5min 28 787937 outer 14 787965 outgo 18 787979 outgoing 18 787997 outline 62 788015 output 198 788077 outputbyref 9 788275 outputbyvalue 9 788284 outputitem 22 788293 outputlist 11 788315 outputparameters 77 788326 outputpercent 11 788403 outside 27 788414 oval 9 788441 over 4 788450 overall 24 788454 overallfooter 9 788478 overallheader 9 788487 overallpercent 5 788496 overallsplacement 5 788501 overallstemplate 20 788506 overflow 9 788526 overlappedintervalshatch 9 788535 overline 9 788544 owner 109 788553 ownerdocument 384 788662 ownerelement 27 789046 ownerobject 9 789073 owners 9 789082 ownertype 9 789091 owningproperty 18 789100 p 67 789118 p100 424 789185 p12 22 789609 pa 18 789631 pack 9 789649 package 59 789658 packages 23 789717 paddingsymbols 9 789740 page 155 789749 pagebottom 11 789904 pagecount 21 789915 pageheight 11 789936 pagenumber 23 789947 pageorientation 44 789970 pageplacementalternation 45 790014 pages 64 790059 pagesize 20 790123 pagesrepresentation 9 790143 pagestotal 5 790152 pagetop 11 790157 pagewidth 21 790168 paid 9 790189 paintingreferencepointposition 51 790198 palegoldenrod 11 790249 palegreen 11 790260 palette32 9 790271 palette8 9 790280 paleturquoise 11 790289 palevioletred 11 790300 panel 203 790311 panelpage 48 790514 panelpages 60 790562 panelpicturelocation 41 790622 papayawhip 12 790663 paragraphtype 11 790675 parameter 520 790686 parameteravailablefields 31 791206 parameterdirection 9 791237 parameterenabled 11 791246 parameterlistallowed 20 791257 parameternames 27 791277 parameters 323 791304 parametersdescriptions 9 791627 parameterssetting 9 791636 parametersupdate 42 791645 parametersupdateerror 36 791687 parametertype 9 791723 parameterusagemode 18 791732 parametervalue 14 791750 parametervalues 44 791764 parcelable 6 791808 parent 1132 791814 parentconfigurations 10 792946 parentdimension 10 792956 parentfield 9 792966 parentgrouping 9 792975 parentnode 387 792984 parentsessionnumber 11 793371 parentwindow 5 793382 parsestatus 9 793387 partial 9 793396 participant 8 793405 particle 25 793413 particles 11 793438 partner 9 793449 passive 9 793458 passivemode 9 793467 passivesessionhibernatetime 25 793476 password 156 793501 passwordauthallowed 14 793657 passwordchanged 48 793671 passwordchangeerror 42 793719 passwordcompromisecheck 9 793761 passwordcompromisechecklist 9 793770 passwordcompromisechecklistmanager 35 793779 passwordcompromisechecklistupdate 36 793814 passwordcompromisechecklistupdateerror 36 793850 passwordcompromisecheckserviceerror 36 793886 passwordcompromisecheckserviceerroronauthentication 36 793922 passwordcompromisecheckservicerequesttimeout 45 793958 passwordcompromisecheckserviceurl 45 794003 passwordcompromisechecksettings 39 794048 passworddoesnotsatisfyrequirements 57 794087 passwordexpirationnotificationperiod 57 794144 passwordhashalgorithmtype 9 794201 passwordisset 68 794210 passwordmaxeffectiveperiod 57 794278 passwordmineffectiveperiod 57 794335 passwordminlength 57 794392 passwordmode 120 794449 passwordpolicycompliancecheckresult 25 794569 passwordpolicyname 57 794594 passwordrecoveryaccesstokenchanged 42 794651 passwordrecoveryattempt 42 794693 passwordrecoveryattempterror 42 794735 passwordrecoveryfrom 36 794777 passwordrecoverymethod 45 794813 passwordrecoverysettings 109 794858 passwordrecoverysmtpsecureauthenticationonly 36 794967 passwordrecoverytokenauthenticationwhensendingverificationcode 36 795003 passwordrecoveryurl 45 795039 passwordrequirementsviolationonauthentication 36 795084 passwordreuselimit 57 795120 passwordsettingdate 57 795177 passwordstrengthcheck 57 795234 paste 9 795291 pastel 9 795300 patch 50 795309 patchasync 9 795359 path 141 795368 pattern 40 795509 pattern1 9 795549 pattern10 9 795558 pattern11 9 795567 pattern12 9 795576 pattern13 9 795585 pattern14 9 795594 pattern15 9 795603 pattern16 9 795612 pattern17 9 795621 pattern2 9 795630 pattern3 9 795639 pattern4 9 795648 pattern5 9 795657 pattern6 9 795666 pattern7 9 795675 pattern8 9 795684 pattern9 9 795693 patterncolor 23 795702 patternfacet 9 795725 patterns 9 795734 pauseuilogrecording 9 795743 payload 11 795752 payment 6 795763 pbkdf2 8 795769 pbkdf2sha256 24 795777 pcm 4 795801 pcs 6 795805 pdf 774 795811 pdf417 20 796585 pdfattachment 25 796605 pdfattachmentcollection 44 796630 pdfattachmentrelationshiptype 30 796674 pdfdocument 119 796704 pdfdocumentfield 15 796823 pdfdocumentfiletype 25 796838 pdfmodificationaccesspermissions 20 796863 pdfpage 45 796883 pdfpagescollection 20 796928 pdfreader 107 796948 pdfrepresentationobjectdescription 44 797055 pdfsignaturedescription 64 797099 pdfsignaturetype 15 797163 pdfwriter 117 797178 pe 12 797295 peachpuff 12 797307 pem 40 797319 per 113 797359 percent 18 797472 percentincolumnorpoint 6 797490 percentinhierarchy 5 797496 percentinhierarchyincolumnorpoint 6 797501 percentinhierarchyinroworseries 6 797507 percentinroworseries 5 797513 percentlabelformat 19 797518 performance 4 797537 performer 16 797541 performerror 36 797557 period 513 797593 periodaddition 16 798106 periodadditionavailablefields 11 798122 periodadditionbegin 9 798133 periodadditionend 9 798142 periodadditiontype 9 798151 periodadjustment 165 798160 periodadjustmentlength 9 798325 periodajustment 11 798334 periodappearance 40 798345 periodfield 9 798385 periodicity 71 798394 periodicvariantrepetition 18 798465 periodicvariantunit 18 798483 periodnumber 10 798501 periodpresentation 10 798511 periods 6 798521 periodsettings 101 798527 periodsettingsvariant 15 798628 periodtype 10 798643 periodvalue 11 798653 periodvariant 71 798664 permission 5 798735 permissionchange 36 798740 permissioncode 24 798776 perpage 12 798800 personal 14 798812 personalcertificates 9 798826 personalcomputerfileexchange 9 798835 personaldata 5 798844 perspectivedistortion 9 798849 peru 12 798858 pfx 12 798870 pg 5 798882 pgdn 10 798887 pgup 10 798897 ph 12 798907 phone 136 798919 phonenumber 47 799055 phonenumbers 25 799102 phoneticfirstname 14 799127 phoneticlastname 14 799141 phoneticmiddlename 14 799155 photo 9 799169 photostamp 24 799178 photosupported 9 799202 phrase 9 799211 phraserecognitioncompleted 9 799220 phrasesdata 9 799229 phrasewords 9 799238 physicalpath 14 799247 pi 58 799261 pi1 7 799319 pi2 8 799326 piblicid 12 799334 picture 953 799346 pictureandtext 18 800299 pictureandvideolibraries 9 800317 picturebox 138 800326 picturedata 22 800464 picturefield 9 800486 pictureformat 56 800495 picturehorizontalalign 21 800551 pictureindex 11 800572 picturelib 1785 800583 picturelocation 110 802368 pictureonleftandtext 9 802478 pictureontopandtext 9 802487 pictureoutput 4 802496 pictureparameter 11 802500 pictureprocessor 19 802511 pictures 18 802530 picturesize 229 802548 picturesizetextpositionrelativetopicture 9 802777 picturetext 9 802786 picturetype 20 802795 picturevalue 11 802815 pictureverticalalign 20 802826 pid 28 802846 pie 18 802874 pie3d 9 802892 pin 18 802901 pingperiod 32 802919 pingtimeout 33 802951 pink 12 802984 pivotchart 217 802996 pivotchartfield 45 803213 pivotchartfieldcollection 55 803258 pivotchartlabelsorientation 20 803313 pivotchartlegendarea 45 803333 pivotchartplotarea 65 803378 pivotchartscalekeeping 20 803443 pivotcharttitlearea 45 803463 pivotcharttype 25 803508 pivotchartvaluesshowmode 15 803533 pivottable 156 803548 pivottablecolumntotalposition 15 803704 pivottablefield 54 803719 pivottablefieldcollection 66 803773 pivottablelinesshowtype 15 803839 pivottablerowtotalposition 15 803854 pk 16 803869 pkcs 72 803885 pkcs1 4 803957 pl 44 803961 place 22 804005 placeholderspresentations 9 804027 placement 124 804036 placementtable 9 804160 plain 9 804169 plaintext 9 804178 plan 694 804187 planner 384 804881 planneractionclick 9 805265 plannerbackgroundinterval 41 805274 plannerbackgroundintervalcollection 50 805315 plannerbackgroundintervallabel 31 805365 plannerbackgroundintervallabelcollection 50 805396 plannercommanddescription 34 805446 plannercommandgenerateparameters 50 805480 plannercommandsource 75 805530 plannercurrentrepresentationperiodcollection 50 805605 plannerdimension 40 805655 plannerdimensioncollection 50 805695 plannerdimensionitem 45 805745 plannerdimensionitemcollection 50 805790 plannerfield 9 805840 plannerfieldcommanddescription 34 805849 plannerfieldcommandgenerateparameters 50 805883 plannerinsidedragaction 25 805933 plannerinsidedragboundarychangevariant 20 805958 plannerinsidedragparameter 25 805978 planneritem 110 806003 planneritemaction 50 806113 planneritemactioncollection 50 806163 planneritemactionlocation 15 806213 planneritemcollection 55 806228 planneritemenableeditmode 25 806283 planneritemsbehavioroncompression 4 806308 planneritemsbehavioronlackofspace 15 806312 planneritemschedule 60 806327 planneritemscheduledialog 29 806387 planneritemstimerepresentation 21 806416 plannerreplacementitemcollection 50 806437 plannerrepresentationperiod 16 806487 plannerstandardcommand 105 806503 platformendian 158 806608 platformtype 100 806766 platinum 9 806866 play 24 806875 playaudio 9 806899 playsoundalert 9 806908 playtext 9 806917 plotarea 54 806926 plum 12 806980 plus 13 806992 pm 20 807005 png 78 807025 point 143 807103 pointconnectionacrossskippedchartvaluestype 4 807246 pointconnectionacrossskippedvalues 23 807250 pointcount 9 807273 pointertype 9 807282 pointexpanded 9 807291 pointintime 216 807300 pointintimewithperiodadjustment 35 807516 pointlines 11 807551 pointnumber 9 807562 pointoftimewithperiodadjustment 6 807571 pointpercent 9 807577 points 103 807586 pointsaxis 32 807689 pointsaxisseries 33 807721 pointsaxisvaluessource 9 807754 pointsconnection 33 807763 pointsconnectionacrossskippedchartvaluestype 25 807796 pointsconnectionacrossskippedvalues 10 807821 pointsize 9 807831 pointsreferencebands 32 807840 pointsreferencelines 32 807872 pointsscale 32 807904 pointsselection 9 807936 pointsvaluesshowmode 9 807945 pointvalue 18 807954 pointvaluepercent 9 807972 pointvaluesize 9 807981 policies 7 807990 policy 7 807997 polygon 9 808004 polynomial 9 808013 poolcapacity 14 808022 pooltimeout 14 808036 pop3 110 808050 pop3authentication 9 808160 pop3authenticationmode 5 808169 pop3beforesmtp 9 808174 pop3port 9 808183 pop3secureauthenticationonly 9 808192 pop3serveraddress 9 808201 pop3usessl 9 808210 pop3?5@54smtp 9 808219 pop3A5@25@ 4 808228 popup 62 808232 port 152 808294 portable 4 808446 portionsize 9 808450 portionupdatecompletedsuccessfully 9 808459 portrait 18 808468 portranges 11 808486 position 18 808497 positioninstream 20 808515 positiveassertion 36 808535 post 195 808571 postalcode 9 808766 postasync 9 808775 postcard 15 808784 postdate 10 808799 postdating 10 808809 posted 66 808819 postgres 5 808885 postgresql 41 808890 posting 58 808931 postingdate 9 808989 postingdateoffset 9 808998 postingmodeuse 20 809007 postmessage 9 809027 pot 4 809036 pow 28 809040 powderblue 12 809068 power 9 809080 pps 4 809089 ppt 22 809093 pr 12 809115 prc 49 809127 precede 9 809176 preceding 9 809185 precision 9 809194 predefine 372 809203 predefined 372 809575 predefineddatainitialization 36 809947 predefineddatainitializationdatanotfound 36 809983 predefineddataname 176 810019 predefineddataupdate 122 810195 predefinedvalue 10 810317 predictable 27 810327 predictablefieldvalues 9 810354 prediction 37 810363 predictionmodel 9 810400 predictionmodelassociationrules 35 810409 predictionmodelclusterization 35 810444 predictionmodelcolumn 39 810479 predictionmodelcolumns 25 810518 predictionmodelcolumntype 21 810543 predictionmodeldecisiontree 35 810564 predictionmodelinputcolumnsetting 15 810599 predictionmodelinputcolumnssetting 30 810614 predictionmodelresultcolumn 15 810644 predictionmodelresultcolumns 50 810659 predictionmodelsequentialpatterns 35 810709 preferusecopies 9 810744 prefix 444 810753 prefixes 9 811197 prepositional 12 811206 prequery 5 811218 presentation 1194 811223 presentationadding 18 812417 presentationadditiontype 15 812435 presentationexpression 20 812450 presentationfield 18 812470 presentationfieldsgetprocessing 110 812488 presentationgetprocessing 110 812598 preserve 18 812708 prev 9 812726 preview 9 812735 previous 12 812744 previousnode 18 812756 previouspart 9 812774 previoussibling 387 812783 price 21 813170 primaryaddressstring 9 813191 primitivetypedefinition 11 813200 principal 10 813211 print 102 813221 printable 4 813323 printaccuracy 35 813327 printarea 11 813362 printdialogusemode 15 813373 printererror 9 813388 printername 29 813397 printimmediately 12 813426 printparameterskey 11 813438 printparametersname 11 813449 printscale 11 813460 printsettings 17 813471 priority 25 813488 private 6 813513 privatekeyaccesspassword 9 813519 privilege 9 813528 privileged 9 813537 privilegedgetmode 9 813546 privilegedmode 10 813555 privilegedmodeinsafemodeallowed 11 813565 privilegedmoderoles 11 813576 privilegedpostingmode 9 813587 privilegedunpostingmode 9 813596 prmod 7 813605 probability 17 813612 procedure 18 813629 procedurename 27 813647 proceedwithcall 10 813674 process 1178 813684 process0 8 814862 processbots 9 814870 processbybot 9 814879 processcontents 11 814888 processerrorcountlimit 11 814899 processes 138 814910 processid 55 815048 processing 25 815103 processingfilters 9 815128 processinginprogress 9 815137 processinginstruction 128 815146 processingpercent 9 815274 processingpicture 68 815283 processings 10 815351 processingtempdata 11 815361 processingvariant 9 815372 processjobs 10 815381 processmemorylimit 11 815391 processonclient 9 815402 processor 138 815411 processrecursively 18 815549 processrestartperiod 11 815567 processsafearray 6 815578 processtexts 9 815584 processuserinterruption 18 815593 product 12 815611 products 4 815623 profile 22 815627 profiles 4 815649 progid 25 815653 programdata 4 815678 programfiles 5 815682 programmatic 5 815687 progress 75 815692 progressbar 78 815767 progressbarfield 9 815845 progressbarsmoothingmode 20 815854 progressivewebapplication 10 815874 progressivewebapplicationmanager 35 815884 progressivewebapplicationmode 15 815919 prohibit 14 815934 prohibited 14 815948 prohibitedsubstitutions 11 815962 project 6 815973 projection 9 815979 promise 5 815988 properties 30 815993 property 127 816023 propertyname 36 816150 propfind 13 816186 proportionally 18 816199 proppatch 13 816217 protection 42 816230 protocol 38 816272 protocols 13 816310 proxy 44 816323 prunerulestype 4 816367 ps 14 816371 ps256 13 816385 ps384 13 816398 ps512 13 816411 pseudocylindricalboggseumorphicprojection 9 816424 pseudocylindricaleckert1projection 9 816433 pseudocylindricaleckert2projection 9 816442 pseudocylindricaleckert3projection 9 816451 pseudocylindricaleckert4projection 9 816460 pseudocylindricaleckert5projection 9 816469 pseudocylindricaleckert6projection 9 816478 pseudocylindricalhatanoasymetricalequalareaprojection 9 816487 pseudocylindricalloximutalprojection 9 816496 pseudocylindricalmcbrydethomasflatpolarparabolicprojection 9 816505 pseudocylindricalmcbrydethomasflatpolarquarticprojection 9 816514 pseudocylindricalmcbrydethomasflatpolarsinusoidalprojection 9 816523 pseudocylindricalmollweideprojection 9 816532 pseudocylindricalputninp2projection 9 816541 pseudocylindricalputninp5projection 9 816550 pseudocylindricalrobinsonprojection 9 816559 pseudocylindricalsinusoidalprojection 9 816568 pseudocylindricalwinkel1projection 9 816577 pss 4 816586 pt 18 816590 public 6 816608 publicid 65 816614 publickey 9 816679 publickeyalgorithm 9 816688 pullfrombottom 9 816697 pullfromtop 18 816706 pullfromtoporbottom 9 816724 purchas 4 816733 purchase 21 816737 purchaseacknowledgementsupported 9 816758 purchaseasync 9 816767 purchaseconsumingsupported 9 816776 purchased 9 816785 purchasedate 9 816794 purchasehistorysupported 9 816803 purchaseid 9 816812 purchases 4 816821 purchasessupported 9 816825 purple 12 816834 purpose 123 816846 purposeusekey 36 816969 push 74 817005 pushnotifications 9 817079 pushC254><;5=8O 9 817088 put 86 817097 putasync 9 817183 putdataasync 19 817192 putdetailrecords 9 817211 putfile 10 817220 putfilecanceled 9 817230 putfiles 10 817239 putfilesdialogparameters 33 817249 putfilestoserverasync 10 817282 putfiletoserverasync 10 817292 puthorizontalpagebreak 12 817302 putonpointsaxis 4 817314 putoveralls 9 817318 putreportfooter 9 817327 putreportheader 9 817336 puttablefooter 9 817345 puttableheader 9 817354 puttotempstorage 10 817363 putverticalpagebreak 12 817373 pwd 5 817385 px 4 817390 pxf 4 817394 py 12 817398 pyramidgraph 9 817410 q 12 817419 qa 12 817431 qname 4 817443 qr 44 817447 qrcode 20 817491 qrcodeauthentication 66 817511 qualified 18 817577 qualify 18 817595 qualitycheck 9 817613 qualityparameters 9 817622 quarter 155 817631 quarterfrombegofyear 9 817786 quarterperiod 77 817795 quartersincebeginofperiod 9 817872 quartersincebeginofperiod445 9 817881 quarto 9 817890 query 85 817899 querybatch 8 817984 querybuilder 79 817992 querybuilderdimension 25 818071 querybuilderdimensions 50 818096 querybuilderdimensiontype 20 818146 querybuilderfield 20 818166 querybuilderfields 50 818186 queryexecutionerror 9 818236 queryoptions 9 818245 queryparameterdescription 12 818254 queryparametersdescription 16 818266 queryrecordtype 25 818282 queryresult 32 818307 queryresultcolumn 16 818339 queryresultcolumnscollection 24 818355 queryresultiteration 20 818379 queryresultselection 52 818399 queryschema 33 818451 queryschemaavailablefield 25 818484 queryschemaavailablefields 45 818509 queryschemaavailablenestedtable 14 818554 queryschemaavailabletable 20 818568 queryschemaavailabletableparameter 30 818588 queryschemaavailabletableparameters 25 818618 queryschemaavailabletableparametertype 35 818643 queryschemaavailabletables 25 818678 queryschemaavailabletablesgroup 15 818703 queryschemacolumn 20 818718 queryschemacolumnfields 25 818738 queryschemacolumns 45 818763 queryschemadatacompositioncharacteristic 60 818808 queryschemadatacompositioncharacteristics 40 818868 queryschemadatacompositionfilterexpression 19 818908 queryschemadatacompositionfilterexpressions 40 818927 queryschemadatacompositionselectionfield 20 818967 queryschemadatacompositionselectionfields 50 818987 queryschemaexpression 19 819037 queryschemaexpressions 45 819056 queryschemafieldrole 15 819101 queryschemafields 37 819116 queryschemaindex 14 819153 queryschemaindexes 45 819167 queryschemaindexexpression 10 819212 queryschemaindexexpressions 50 819222 queryschemajointype 25 819272 queryschemanestedquery 20 819297 queryschemanestedtable 15 819317 queryschemanestedtablecolumn 20 819332 queryschemaoperators 45 819352 queryschemaorderdirection 25 819397 queryschemaorderexpression 15 819422 queryschemaorderexpressions 50 819437 queryschemaperiodadditiontype 60 819487 queryschemaquerybatch 50 819547 queryschemaquerysourcejoin 30 819597 queryschemaquerysourcejoins 45 819627 queryschemaselectoperator 60 819672 queryschemaselectquery 95 819732 queryschemasource 15 819827 queryschemasources 54 819842 queryschematable 30 819896 queryschematabledatacompositionparameters 20 819926 queryschematabledropquery 10 819946 queryschematableforupdate 10 819956 queryschematableparameter 10 819966 queryschematableparameters 25 819976 queryschematablesforupdate 40 820001 queryschematemptabledescription 20 820041 queryschematotalcalculationfield 35 820061 queryschematotalcalculationfields 55 820096 queryschematotalcalculationfieldtype 20 820151 queryschematotalexpression 14 820171 queryschematotalexpressions 45 820185 queryschemauniontype 15 820230 querytemptable 16 820245 querytemptablecolumn 12 820261 querytemptablecolumns 24 820273 querytemptables 20 820297 querytext 9 820317 querywizard 43 820326 querywizardcreatenestedquery 12 820369 querywizardcreatetemptabledescription 12 820381 querywizardcreatetemptabledropquery 12 820393 querywizardnestedquery 12 820405 querywizardreplacetable 12 820417 querywizardshowchangestables 12 820429 querywizardtableparameters 12 820441 querywizardtemptable 12 820453 querywizardtemptabledescription 12 820465 querywizardtemptablesgroup 12 820477 questiondialogmode 35 820489 questionmark 9 820524 queue 9 820533 queued 9 820542 quick 4 820551 quickaccess 18 820555 quickchange 9 820573 quickchoice 266 820582 quickedititem 14 820848 quote 4 820862 quoted 4 820866 quotedprintable 12 820870 quotemessage 9 820882 qwerty 13 820891 qwmdnmjxewdwc 8 820904 r 425 820912 r1 16 821337 r1c1 54 821353 r1c2 22 821407 r2 13 821429 r2c1 7 821442 r2c2 29 821449 r2c5 6 821478 r3 6 821484 r3c5 6 821490 r4 11 821496 r4c4 5 821507 r8 5 821512 radararea 9 821517 radarchartscaletype 25 821526 radarline 9 821551 radarnormalizedarea 9 821560 radarstackedarea 9 821569 radarstackedline 9 821578 radio 80 821587 radiobutton 111 821667 radiobuttonfield 9 821778 radiobuttontype 29 821787 radius 9 821816 ragent 9 821825 ragentportdefault 14 821834 raise 9 821848 ram 32 821857 ramanddisk 9 821889 randomnumber 9 821898 randomnumbergenerator 18 821907 randompassword 9 821925 randompasswordgenerator 14 821934 range 45 821948 rar 13 821993 rare 13 822006 ras 173 822019 rate 12 822192 rawdata 49 822204 read 602 822253 readandwrite 18 822855 readasync 65 822873 readattribute 27 822938 readbyte 9 822965 readbyteasync 9 822974 readchanges 23 822983 readchangesdescription 11 823006 readchars 9 823017 readcharsasync 9 823026 readcommitted 9 823035 readcompleted 9 823044 readconfigurationandconfigurationextensionschanges 11 823053 readdatahistory 6 823064 readdatahistoryofmissingdata 6 823070 readdataresult 55 823076 readdiskdatasize 22 823131 readdiskdatasizecurrent 11 823153 readdiskdatasizelast5min 11 823164 readdiskdatasizetotal 11 823175 readingallowed 11 823186 readint16 18 823197 readint16async 9 823215 readint32 18 823224 readint32async 9 823242 readint64 18 823251 readint64async 9 823269 readintobinarydatabuffer 9 823278 readintobinarydatabufferasync 9 823287 readjson 28 823296 readjsondate 10 823324 readjsonvalue 10 823334 readline 18 823344 readlineasync 9 823362 readme 8 823371 readonly 237 823379 readreceiptaddresses 9 823616 readto 9 823625 readtoasync 9 823634 readuncommitted 9 823643 readwithcontext 9 823652 readwritemode 9 823661 readxdto 9 823670 readxml 28 823679 readytodisplay 9 823707 real 9 823716 realsize 9 823725 realsizeignorescale 9 823734 realtime 18 823743 realtimeposting 33 823761 reaperpointposition 18 823794 rear 9 823812 reason 9 823821 rebuildaggregatesusing 11 823830 rec 57 823841 recalcpresenttotals 22 823898 recalcsmanager 12 823920 recalctotals 33 823932 recalctotalsforperiod 22 823965 recalculation 310 823987 recalculationmanager 12 824297 recalculationobject 33 824309 recalculationrecord 30 824342 recalculationrecordset 158 824372 recalculations 20 824530 recall 9 824550 reccount 14 824559 recdeleted 9 824573 receipt 41 824582 receive 22 824623 received 13 824645 receivedno 66 824658 receivenotificationsubscriberid 9 824724 receiver 4 824733 receivercode 10 824737 receivesms 9 824747 receivingmessagehandler 9 824756 recent 18 824765 recipient 60 824783 recipientcertificates 9 824843 recipientcode 9 824852 recipients 49 824861 recno 14 824910 recommendation 8 824924 record 728 824932 recordautonumber 5 825660 recordchanges 11 825665 recorder 510 825676 recorderposition 9 826186 recordersubordinate 9 826195 recordform 15 826204 recordid 45 826219 recordpresentation 27 826264 records 83 826291 recordscount 75 826374 recordset 210 826449 recordsetmodule 72 826659 recordsfilter 55 826731 recordspercent 76 826786 recordswithextdimensions 12 826862 recordtype 93 826874 rect 18 826967 rectangle 18 826985 rectangulardocument 9 827003 recurrence 9 827012 red 11 827021 redefine 9 827032 reduce 4 827041 reducealways 9 827045 reducetominimumonexcess 9 827054 redundant 9 827063 ref 615 827072 reference 89 827687 reference31 7 827776 referencebandinchart 5 827783 referencebandscolorpalettedescription 32 827788 referencebandsinchart 5 827820 referenced 6 827825 referencedkey 11 827831 referencedkeyname 11 827842 referencelineinchart 5 827853 referencelinesinchart 5 827858 referenceoptions 6 827863 references 9 827869 referrer 9 827878 refpresentation 6 827887 refresh 291 827893 refreshdatarepresentation 10 828184 refreshdisplay 12 828194 refreshenabled 29 828206 refreshinprogress 9 828235 refreshinterface 10 828244 refreshobjectsnumbering 10 828254 refreshrequest 9 828264 refreshrequestmethod 25 828273 refreshrequestprocessing 10 828298 refreshreusablevalues 10 828308 refreshrows 11 828318 refs 6 828329 regagentadmin 20 828335 regassignmentrule 15 828355 regcluster 20 828370 regclusteradmin 21 828390 regexp 4 828411 region 34 828415 regionalsettingschange 48 828449 regionalsettingschangeerror 36 828497 regionalsettingsupdate 36 828533 register 3399 828569 registerdatadump 9 831968 registerdatadumpasync 9 831977 registerdimension 9 831986 registereddocuments 9 831995 registerinfobase 18 832004 registerinfobaseasync 9 832022 registerrecords 34 832031 registerrecordsandperiodboundaries 5 832065 registerrecordscollection 42 832070 registerrecordsdeletion 39 832112 registerrecordsmap 9 832151 registerrecordswritingonpost 24 832160 registersession 9 832184 registertype 9 832193 registerwritemode 24 832202 registrationcompleted 9 832226 registrationdata 8 832235 registrationfields 9 832243 registrationnumber 9 832252 registrationperiod 82 832261 registry 5 832343 regsecurityprofile 15 832348 regsecurityprofileaddin 15 832363 regsecurityprofileapplication 16 832378 regsecurityprofilecomclass 16 832394 regsecurityprofileinternetresource 16 832410 regsecurityprofileunsafeexternalmodule 16 832426 regsecurityprofilevirtualdirectory 16 832442 regservicesetting 16 832458 regular 27 832474 regworkingserver 21 832501 reindex 9 832522 rel 23 832531 relationdatasource 9 832554 relationship 9 832563 relationships 9 832572 relationshiptype 9 832581 relative 9 832590 relativefrequency 4 832599 relativeurl 18 832603 relevant 9 832621 relyingpartyurl 42 832630 rem 5 832672 reminder 9 832677 reminders 9 832686 remotedebugger 8 832695 remove 60 832703 removeattribute 234 832763 removeattributenode 234 832997 removebadge 9 833231 removechild 378 833240 removed 60 833618 removehandler 6 833678 removenameditem 36 833684 removeparameter 9 833720 rename 12 833729 renamemailbox 9 833741 renamenode 18 833750 reopenfromotherserver 10 833768 repeatableread 9 833778 repeatcount 9 833787 repeatinterval 9 833796 repeatoncolumnprint 11 833805 repeatonrowprint 11 833816 repeatpause 9 833827 repeatperiodinday 9 833836 repetition 11 833845 replace 46 833856 replacechild 378 833902 replacechildren 9 834280 replacedata 45 834289 replaceline 11 834334 replacementdate 9 834345 replacementitems 9 834354 replacementmode 30 834363 replacemode 4 834393 replacewholetext 36 834397 replicationtype 9 834433 replyto 9 834442 report 583 834451 reportbuilder 234 835034 reportbuilderdetailsfilltype 20 835268 reportbuilderdimension 55 835288 reportbuilderdimensions 50 835343 reportbuilderdimensiontype 20 835393 reportbuilderfield 20 835413 reportbuilderfields 50 835433 reportbuildersettings 5 835483 reportfootertemplate 9 835488 reportformtype 30 835497 reportgroup1backcolor 11 835527 reportgroup2backcolor 11 835538 reportheaderbackcolor 11 835549 reportheadertemplate 9 835560 reportlinecolor 11 835569 reportmanager 30 835580 reportobject 84 835610 reportresult 11 835694 reportresultviewmode 26 835705 reports 232 835731 reportsappearance 9 835963 reportsappearancemanager 25 835972 reportsettings 12 835997 reportsmanager 12 836009 reportssettings 6 836021 reportsusersettingsstorage 20 836027 reportsvariantsstorage 20 836047 reportusersettingsloadform 12 836067 reportusersettingssaveform 12 836079 reportvariant 9 836091 reportvariants 6 836100 reportvariantsloadform 12 836106 reportvariantssaveform 12 836118 reportwithcurrentsettings 9 836130 reposting 5 836139 repostonwrite 20 836144 representabledocumentbatch 86 836164 representabledocumentbatchfiletype 46 836250 representabledocumentbatchitem 16 836296 representabledocumentbatchitems 45 836312 representation 146 836357 representdatachange 10 836503 request 11 836513 requestdeliveryreceipt 9 836524 requestlocation 9 836533 requestphone 9 836542 requestreadreceipt 9 836551 requesttime 9 836560 requestuserpermission 10 836569 requestuserpermissionasync 10 836579 requestuserpresentation 9 836589 require 46 836598 required 37 836644 requireddatarelevance 44 836681 requireddatarelevancetime 24 836725 requireddatasets 22 836749 requiredjoin 9 836771 requiredmobileapplicationpermissions 10 836780 requireforcontrol 9 836790 requirehigh 9 836799 requiremediumwarnbelowhigh 9 836808 requirepasswordchange 9 836817 reread 12 836826 reserve 9 836838 reserveworkingprocesses 47 836847 reset 44 836894 resize 23 836938 resolveattributedeclaration 11 836961 resolveattributegroupdefinition 11 836972 resolvedschema 33 836983 resolveelementdeclaration 11 837016 resolvemodelgroupdefinition 11 837027 resolvereference 44 837038 resolvetypedefinition 11 837082 resource 433 837093 resourceaddress 9 837526 resourcegroup 11 837535 resourceplacement 22 837546 resources 54 837568 resourcesautoposition 21 837622 resourcesdetail 6 837643 resourcesgroupfooter 6 837649 resourcesgroupheader 6 837655 resourceshierarchicalgroupfooter 6 837661 resourceshierarchicalgroupheader 6 837667 resourcesplacement 23 837673 resourcestotaldetail 6 837696 resourcestotalgroupfooter 6 837702 resourcestotalgroupheader 6 837708 resourcestotalhierarchicalgroupfooter 6 837714 resourcestotalhierarchicalgroupheader 6 837720 resourcetemplate 33 837726 resourcetotaltemplate 11 837759 resourcevalue 9 837770 response 4 837779 restartcountonfailure 18 837783 restartintervalonfailure 18 837801 restartnotrequirederrortext 9 837819 restartrequirederrortext 9 837828 restartschedule 50 837837 restorationstatus 9 837887 restore 49 837896 restorecurrentrow 141 837945 restoreerror 36 838086 restorefinish 36 838122 restorestart 36 838158 restorevalue 10 838194 restorevalues 11 838204 restorevaluesonopen 22 838215 restoring 9 838237 restrict 5 838246 restriction 177 838251 restrictionbycondition 9 838428 restrictions 48 838437 restrictiontemplates 48 838485 result 59 838533 resultcode 9 838592 resultcolumns 36 838601 resultcompositionmode 21 838637 resultofsearchbyregularexpression 25 838658 resultofsearchbyregularexpressiongroup 20 838683 resultreductionwidthmobileclient 6 838703 resultreductionwidthmobileplatform 6 838709 resultreductionwidththinclient 6 838715 resultreductionwidthwebclient 6 838721 results 9 838727 resulttype 9 838736 resultviewmode 15 838745 resultviewmodemobileclient 6 838760 resultviewmodemobileplatform 6 838766 resultviewmodethinandwebclient 6 838772 resumeuilogrecording 9 838778 retrievedbyserver 11 838787 retrievedrecordscount 9 838798 retry 9 838807 retrycancel 9 838816 return 16 838825 returnvalue 18 838841 returnvaluesreuse 38 838859 reuse 105 838897 reusesessions 18 839002 rev 18 839020 reverse 18 839038 reversingentry 66 839056 reverttodefaultmode 12 839122 revise 14 839134 revised 14 839148 rewardtype 4 839162 rewardvalue 4 839166 rfc 77 839170 rfc2518 28 839247 rfc2616 49 839275 rfc2822 12 839324 rfc4122 9 839336 rfc5789 4 839345 rfc7159 10 839349 rfc7230 9 839359 rhomb 18 839368 rich 4 839386 richtext 9 839390 right 403 839399 rightarrow 9 839802 rightborder 22 839811 rightbottom 27 839833 rightcenter 9 839860 rightcolumn 9 839869 rightextension 14 839878 rightextensiondefinitionroles 26 839892 righthorizontal 9 839918 rightmargin 70 839927 rightouter 9 839997 rightpresentation 10 840006 rights 57 840016 righttext 11 840073 righttoleft 9 840084 righttop 27 840093 rightvalue 11 840120 rightvertical 9 840131 rle 7 840140 rls 11 840147 rmcm 4 840158 rmngr 20 840162 rmngraddress 14 840182 rmngrpid 14 840196 rmngrport 14 840210 rmngrportdefault 14 840224 rms 12 840238 rncn 4 840250 ro 42 840254 roam 4 840296 roaming 4 840300 roamingstate 14 840304 roamingusage 20 840318 role 157 840338 roles 67 840495 roleupdate 36 840562 rollback 38 840598 rollbacktransaction 21 840636 rolledback 9 840657 roman 4 840666 roman8 136 840670 root 18 840806 rootcertificates 9 840824 rootcontainer 352 840833 rootnodes 18 841185 rootproperties 9 841203 roottype 22 841212 rooturl 9 841234 rose 6 841243 roses 6 841249 rosybrown 12 841255 rotate 83 841267 rotateclockwise 12 841350 rotatecounterclockwise 12 841362 rotated 65 841374 roub 6 841439 round 30 841445 round15as10 9 841475 round15as20 9 841484 rounded 9 841493 roundmode 15 841502 route 12 841517 routepoint 55 841529 routepoints 17 841584 routepointsallrefstype 11 841601 row 121 841612 rowappearance 47 841733 rowappearances 18 841780 rowdata 32 841798 rowdimensions 9 841830 rowfilter 73 841839 rowfiltersettings 55 841912 rowgotodirection 15 841967 rowgrouplevelcount 12 841982 rowheaderarea 11 841994 rowheight 11 842005 rowindex 9 842016 rowinputmode 21 842025 rowkey 9 842046 rownumber 9 842055 rownumberinafterchangeversion 5 842064 rownumberinbeforechangeversion 5 842069 rowpicturedatapath 10 842074 rows 73 842084 rowselectionmode 21 842157 rowspan 9 842178 rowspicture 9 842187 rowspictures 11 842196 rowstotalplacement 11 842207 rowstotaltemplate 11 842218 rowtotalposition 11 842229 royalblue 11 842240 rphost 14 842251 rr 23 842265 rs 22 842288 rs256 13 842310 rs384 13 842323 rs512 13 842336 rsassa 8 842349 rss14 20 842357 rssexpanded 20 842377 rtf 6 842397 ru 2482 842403 rub 4 844885 rule 27 844889 ruleid 11 844916 rules 27 844927 ruletype 14 844954 run 34 844968 runapp 10 845002 runappasync 10 845012 runasync 9 845022 runcallback 10 845031 runmode 57 845041 runmodemanagedapplication 11 845098 runmodeordinaryapplication 11 845109 running 25 845120 runningsupported 9 845145 runsystem 10 845154 runtime 14 845164 runwithoutwaiting 9 845178 russian 9 845187 rustore 16 845196 rustoreinapppurchase 12 845212 s 93 845224 s3 25 845317 s3hostwithbucketinpath 9 845342 s3virtualhost 9 845351 sa 12 845360 saddlebrown 11 845372 safari 23 845383 safe 10 845406 safearray 6 845416 safearrayredim 6 845422 safecallmemorylimit 19 845428 safemode 145 845447 safemodeprofile 87 845592 safemodesecurityprofile 47 845679 safemodesecurityprofilename 19 845726 safeworkingprocessesmemorylimit 19 845745 sale 21 845764 sales 21 845785 salmon 11 845806 samecolumn 9 845817 samplecolor 9 845826 samplefont 9 845835 sampletext 9 845844 samplingrate 9 845853 sand 9 845862 sandbox 4 845871 sandybrown 12 845875 sant+mi 7 845887 sant+ms 7 845894 sant+mu 7 845901 save 67 845908 saveattachment 9 845975 saveauthenticationforreauthenticationbydefault 36 845984 savebydefault 11 846020 savecolors 23 846031 savecolorskey 23 846054 savedatacompositionappearance 30 846077 savedatainsettings 9 846107 savedauthentication 42 846116 savedauthenticationlifetime 47 846158 savedefaultsetting 11 846205 savedinsettingsdatamodified 9 846216 savedpicturesdensity 26 846225 savefile 12 846251 saveform 18 846263 saveformdatainsettings 15 846281 savelicenseacquisitionrequest 9 846296 saveprocessing 11 846305 savereportappearence 4 846316 savereportsettings 12 846320 saveuserdata 6 846332 saveusersettings 10 846338 savevalue 10 846348 savevalues 12 846358 saveviewproperties 11 846370 sbd 4 846381 sbf 4 846385 scale 65 846389 scalecolor 59 846454 scaledefined 9 846513 scaleitemcount 9 846522 scalekeeping 29 846531 scalelabellocation 9 846560 scaleline 9 846569 scalelinecolor 9 846578 scalelines 59 846587 scalelocation 9 846646 scalemarklocation 9 846655 scalerangebegin 9 846664 scalerangeend 9 846673 scalestep 9 846682 scandocumentsasync 9 846691 scanner 18 846700 scanopos 7 846718 scanseries 9 846725 scatter 9 846734 schedule 54 846743 scheduledata 6 846797 scheduledate 9 846803 scheduledjob 198 846812 scheduledjobdialog 29 847010 scheduledjobs 32 847039 scheduledjobsdenied 19 847071 scheduledjobsmanager 25 847090 schedulevalue 9 847115 schema 629 847124 schemaforschema 11 847753 schemaforschemanamespaceuri 11 847764 schemaforschemaprefix 11 847775 schemalocation 44 847786 scheme 9 847830 schjobdn 6 847839 scope 154 847845 screenunlockrequired 9 847999 script 11 848008 scriptcompileerror 9 848019 scriptruntimeerror 9 848028 scriptuseerror 9 848037 scriptvariant 33 848046 scroll 45 848079 scrollbar 11 848124 scrollbaruse 20 848135 scrolling 45 848155 scrollingtext 11 848200 scrollingtextmode 35 848211 scrollpagemode 11 848246 scsu 132 848257 sd 12 848389 sdcard 12 848401 sdk 12 848413 se 12 848425 sea 16 848437 seagreen 12 848453 search 119 848465 searcharea 9 848584 searchcontrol 31 848593 searchcontrollocation 29 848624 searchdirection 15 848653 searcheverywhere 9 848668 searchform 18 848677 searchintableoninput 20 848695 searchoninput 9 848715 searchresultbyregularexpression 4 848724 searchstring 145 848728 searchstringlocation 44 848873 searchstringmodeoninputbystring 108 848917 searchstringrepresentation 18 849025 searchstringviewmode 9 849043 searchtype 18 849052 seashell 12 849070 sec10 13 849082 second 96 849095 secondary 11 849191 secondauthenticationfactorsetting 15 849202 secondauthenticationfactorsettings 9 849217 secondauthenticationfactorsettingsprocessing 9 849226 secondauthenticationfactorsettingsprocessingtype 15 849235 secondauthenticationfactorsettingstemplates 10 849250 secondauthenticationfactorsettingstemplatesmanager 20 849260 secondauthenticationfactorsettingtemplate 40 849280 secondauthenticationfactortemplatedelete 36 849320 secondauthenticationfactortemplatenew 36 849356 secondauthenticationfactortemplateupdate 36 849392 secondcolor 27 849428 secondfile 9 849455 seconditem 9 849464 secondperiod 79 849473 secret 8 849552 secretkey 27 849560 section 552 849587 sectionpanel 5 850139 sections 19 850144 sectionspanel 10 850163 sectionspanelrepresentation 39 850173 sector 9 850212 secure 9 850221 secureconnection 27 850230 secureonconnect 9 850257 securestorage 9 850266 securestorageaccessprotectionmethod 20 850275 securestoragemanager 45 850295 security 4 850340 securitylevel 28 850344 securityprofile 173 850372 securityprofilechange 36 850545 securityprofilename 19 850581 see 20 850600 seek 27 850620 seekasync 27 850647 seen 20 850674 segment 25 850694 segments 9 850719 selbuttonpicture 22 850728 select 354 850750 selectall 9 851104 selectallowed 9 851113 selectallrows 9 851122 selectarea 9 851131 selectbyrecorder 44 851140 selectbyrefs 88 851184 selectchanges 11 851272 selectdefaultsettings 11 851283 selectdimensionitem 14 851294 selectdistinct 9 851308 selected 137 851317 selectedareas 11 851454 selecteddatecollection 42 851465 selecteddates 20 851507 selectedfields 27 851527 selectedfiles 9 851554 selectedintervals 9 851563 selecteditemauto 6 851572 selecteditemfield 5 851578 selecteditemfolder 5 851583 selecteditems 9 851588 selectedrows 20 851597 selectedtext 49 851617 selectedvalues 9 851666 selectforupdate 9 851675 selecthierarchically 33 851684 selection 268 851717 selectionavailablefields 22 851985 selectionbackcolor 22 852007 selectionmode 74 852029 selectionpresentation 9 852103 selectionpresentationandchoice 9 852112 selectionshowmode 40 852121 selectionsize 14 852161 selectiontextcolor 22 852175 selectionvalue 11 852197 selectkeyarea 18 852208 selectmessages 9 852226 selectobjects 9 852235 selectoption 9 852244 selector 22 852253 selectslice 11 852275 selecttimescaleitem 14 852286 selectvalue 5 852300 selectversions 9 852305 selectwrappedtimescaleheader 14 852314 semitransparencymode 33 852328 semitransparencypercent 28 852361 send 92 852389 sendcrashreport 9 852481 sendcrashreportonclient 9 852490 sendcrashreportonclienttoplatformerrorregistrationservice 9 852499 sendcrashreportonserver 9 852508 sendcrashreportonservertoplatformerrorregistrationservice 9 852517 sendcrashreporttoplatformerrorregistrationservice 9 852526 senddate 9 852535 sender 26 852544 sendercode 19 852570 sendername 63 852589 sendevent 11 852652 sendexternalaccessurl 9 852663 sendingsupported 9 852672 sendmessage 39 852681 sendmessagewithdata 9 852720 sendnotification 9 852729 sendreport 15 852738 sendreportonclient 9 852753 sendreportonserver 9 852762 sendscreen 11 852771 sendsms 11 852782 sendtemporarycode 9 852793 sendverificationcodebysetparameters 60 852802 sendverificationcodebystandardservice 54 852862 sendverificationcodethroughstandardservice 36 852916 sent 20 852952 sentence 9 852972 sentences 9 852981 senti 7 852990 sentno 44 852997 separate 52 853041 separatebypage 11 853093 separateddatause 9 853104 separately 36 853113 separatelyandintotalsonly 18 853149 separator 15 853167 sequence 403 853182 sequenceboundaries 6 853585 sequencecount 9 853591 sequenced 9 853600 sequencefilling 33 853609 sequencemanager 48 853642 sequencerecord 36 853690 sequencerecordset 146 853726 sequences 20 853872 sequencesmanager 18 853892 sequentialpatterns 18 853910 serializable 9 853928 serializearraysasobjects 9 853937 serialnumber 14 853946 series 154 853960 seriescount 9 854114 seriesexpanded 9 854123 seriesgroupname 9 854132 seriesinrows 10 854141 seriesorderinlegend 33 854151 seriespercent 9 854184 seriespoint 9 854193 seriespointpercent 9 854202 seriespointsize 9 854211 seriespointvalue 9 854220 seriespointvaluepercent 9 854229 seriespointvaluesize 9 854238 seriesscale 32 854247 seriessize 9 854279 seriesvalue 9 854288 seriesvaluepercent 9 854297 seriesvaluesdrawingmode 16 854306 seriesvaluesize 9 854322 seriesvaluesshowmode 9 854331 server 221 854340 server1 8 854561 serveraddress 38 854569 serveradministration 47 854607 servercall 9 854654 servername 44 854663 serverport 11 854707 servertlscertificaterevocationcheckmode 43 854718 serverurl 27 854761 serverversion 9 854788 service 169 854797 servicecallduration 22 854966 servicecalldurationcurrent 11 854988 servicecalldurationlast5min 11 854999 servicecalldurationtotal 11 855010 servicedatadir 25 855021 servicedatadirfortransfer 30 855046 servicename 50 855076 serviceprincipalname 25 855126 services 35 855151 servicesetting 48 855186 session 231 855234 sessionapplied 9 855465 sessionbeginningofcentury 10 855474 sessioncontrol 10 855484 sessioncount 22 855494 sessiondataseparation 30 855516 sessiondataseparationpresentation 8 855546 sessiondataseparationvalues 7 855554 sessiondataservice 34 855561 sessiondisabled 9 855595 sessionerror 9 855604 sessionfaulttolerancelevel 14 855613 sessionid 50 855627 sessionlockchange 48 855677 sessionlockchangeerror 36 855725 sessionmaxage 18 855761 sessionmodule 9 855779 sessionnumber 40 855788 sessionosauthenticationchange 6 855828 sessionparameter 60 855834 sessionparameters 34 855894 sessionparameterssetting 10 855928 sessionregionalsettings 65 855938 sessionreusemode 29 856003 sessionreuseservice 24 856032 sessionsdenied 19 856056 sessionslock 39 856075 sessionslockenabled 47 856114 sessionstandardauthenticationchange 6 856161 sessionstarted 18 856167 sessionstartpermissioncode 47 856185 sessiontimezone 10 856232 set 524 856242 setaction 92 856766 setactiononuserpasswordrequirementsviolationonauthentication 10 856858 setactive 53 856868 setadbannerid 9 856921 setadbannerrepresentation 9 856930 setadditionalindexesusage 10 856939 setaggregatesmode 11 856949 setaggregatesusing 11 856960 setall 9 856971 setallowaccessrightauditeventsrecording 16 856980 setanalyticssystemserveraddress 9 856996 setapplicationchoiceparameters 9 857005 setapplicationdescription 9 857014 setattribute 234 857023 setattributenode 234 857257 setauthenticationautosavesettings 9 857491 setavailablefields 44 857500 setavailablevalues 30 857544 setbadge 18 857574 setbinarydata 18 857592 setbinarydatastoragedatacopiesplacementmode 9 857610 setbinarydatastoragereadwritemode 9 857619 setbinarydatastorageusemode 9 857628 setbit 10 857637 setbodyfilename 18 857647 setbodyfrombinarydata 18 857665 setbodyfromstring 18 857683 setbound 11 857701 setbuttons 9 857712 setcaption 9 857721 setchangeablefields 11 857730 setcheck 20 857741 setclipdata 5 857761 setclusterrecycling 16 857766 setclusterrecyclingbymemory 16 857782 setclusterrecyclingbytime 16 857798 setclusterrecyclingerrorscountthreshold 16 857814 setclusterrecyclingexpirationtimeout 16 857830 setclusterrecyclingkillproblemprocesses 16 857846 setclustersecuritylevel 16 857862 setcolordepth 9 857878 setcommonappearancetemplate 9 857887 setcommonconnectionparameters 11 857896 setcommonsettings 9 857907 setcompositewordsseparationmode 9 857916 setcomputersleepmodeprohibition 10 857925 setcontent 9 857935 setcontrol 34 857944 setconversationnotificationrepresentation 10 857978 setcopydatabaseusebythiscopy 9 857988 setcurrentarea 9 857997 setcurrentdirectory 9 858006 setcurrentframenumber 9 858015 setcurrentuser 10 858024 setcurrentusersettings 9 858034 setcurrentvariant 9 858043 setdata 10 858052 setdatadumpdescription 10 858062 setdatadumpdescriptionasync 10 858072 setdatahistoryversioncomment 121 858082 setdataseparationsafemode 10 858203 setdateinterval 12 858213 setdeletionmark 88 858225 setdensity 9 858313 setdescription 31 858322 setdescriptionprocessing 11 858353 setdetailrecordexpressionpresentation 11 858364 setdocument 11 858375 setdocumenthtml 9 858386 setemailauthenticationsettings 9 858395 seterroronstartupprocessingsettings 9 858404 seteventhandlersexecution 10 858413 seteventlogdatastoragesplitperiod 10 858423 seteventlogeventuse 10 858433 seteventlogusing 10 858443 setexclusivemode 10 858453 setexecutionaftereventhandlers 10 858463 setexpressions 11 858473 setexpressionspresentation 11 858484 setfield 9 858495 setfieldstowrite 11 858504 setfieldvalue 9 858515 setfiledialogresult 9 858524 setfiletype 11 858533 setformat 9 858544 setformattedstring 11 858553 setformfunctionaloptionparameters 10 858564 setforms 9 858574 setfrombinarydata 9 858583 setfromstring 9 858592 setfullscreenadid 9 858601 setfulltextmode 9 858610 setfulltextsearchmode 9 858619 setfulltextsearchversion 9 858628 sethibernatesessionterminatetime 10 858637 sethidden 9 858647 sethiddenasync 9 858656 sethorizontalstretch 12 858665 sethtml 11 858677 setidattribute 234 858688 setidattributenode 234 858922 setidentifier 11 859156 setinactivitytimeforterminatesession 10 859167 setinactivitytimeforterminatesessionnotification 10 859177 setindexingjobscount 9 859187 setinfobaseadditionalgrammar 9 859196 setinfobasebeginningofcentury 10 859205 setinfobaseexternalconnectionparameters 9 859215 setinfobasepredefineddataupdate 10 859224 setinfobaseregionalsettings 10 859234 setinfobaseregistrationdata 10 859244 setinfobasespeechprocessingdata 9 859254 setinfobasespeechtotextmodel 9 859263 setinfobasetimezone 10 859272 setinputhint 9 859282 setinterfacefunctionaloptionparameters 10 859291 setitem 9 859301 setlicensingclientparameters 10 859310 setlink 11 859320 setlistfrompasswords 9 859331 setlistfrompasswordsstoredvalues 9 859340 setlistitemdeletionmark 6 859349 setlockwaittime 10 859355 setmainwindowmode 9 859365 setmasternode 11 859374 setmaxactionexecutiontime 9 859385 setmaxindexeddatasize 9 859394 setmaxtotalsperiod 22 859403 setmessagesflags 9 859425 setmessagetemplatepresentations 10 859434 setmessagetemplatepresentationsasync 10 859444 setminandmaxtotalsperiods 22 859454 setmintotalsperiod 22 859476 setminwritedatasize 9 859498 setmobileclientsignatureverificationmethod 10 859507 setmode 11 859517 setmodificationtime 9 859528 setmodificationtimeasync 9 859537 setmodificationuniversaltime 9 859546 setmodificationuniversaltimeasync 9 859555 setnameditem 36 859564 setnamespacemapping 9 859600 setnewcode 33 859609 setnewnumber 33 859642 setnewobjectref 99 859675 setobject 11 859774 setobjectandformattributeconformity 10 859785 setobjectandformconformity 10 859795 setorder 9 859805 setoscaptionrepresentation 9 859814 setpalette 19 859823 setparameter 34 859842 setparametervalue 151 859876 setpassivesessionhibernatetime 10 860027 setpasswordcompromisechecksettings 9 860037 setpasswordrecoverysettings 9 860046 setperiod 11 860055 setpicture 11 860066 setplan 9 860077 setpoint 19 860086 setpredefineddatainitialization 80 860105 setpredefineddataupdate 80 860185 setpreferablemainserveruse 10 860265 setpresenttotalsusing 22 860275 setprivilegedmode 10 860297 setpropertyforobjects 9 860307 setquerytext 17 860316 setreadonly 18 860333 setreadonlyasync 9 860351 setrequireduse 9 860360 setrestrictionsforuseinfilter 9 860369 setrestrictionsforuseingroup 9 860378 setrestrictionsforuseinorder 9 860387 setresultviewmode 9 860396 setrewardedvideoid 9 860405 setrightsforattributesandtabularsectionsbydefault 36 860414 setrightsfornewobjects 36 860450 sets 6 860486 setsafemode 10 860492 setsafemodedisabled 10 860502 setschema 33 860512 setselectedareas 9 860545 setselecteditems 20 860554 setselectedmultiplevalues 10 860574 setselector 4 860584 setseries 19 860588 setsessionadditionalgrammar 9 860607 setsessionconnectionparameters 11 860616 setsessionexternalconnectionparameters 9 860627 setsessionslock 10 860636 setsessiontimezone 10 860646 setsettings 69 860656 setshortcaption 9 860725 setsize 36 860734 setsizeasync 27 860770 setsourcedata 9 860797 setstandardodatainterfacecontent 46 860806 setstandardreplicationversion 9 860852 setstoreddatacontent 9 860861 setstring 54 860870 setsubscriberapplicationlinks 10 860924 setsubscriberemail 10 860934 settemplate 11 860944 settext 33 860955 settextselectionbounds 50 860988 setthreadlowpriority 9 861038 settime 45 861047 setting 506 861092 settingactive 11 861598 settingid 25 861609 settings 441 861634 settingschoice 23 862075 settingscomposer 37 862098 settingsdescription 41 862135 settingsform 18 862176 settingskey 38 862194 settingsmode 11 862232 settingsmodified 9 862243 settingsnameditemdetailedrepresentation 40 862252 settingsobjectowner 5 862292 settingsservice 24 862297 settingsstorage 111 862321 settingsstoragemanager 78 862432 settingsstorages 20 862510 settingsstoragesmanager 12 862530 settingtemplatename 9 862542 settingvariants 11 862551 settotalrecalcjobcount 10 862562 settotalrecordexpression 11 862572 settotalrecordexpressionpresentation 11 862583 settotalssplittingmode 22 862594 settotalsusing 33 862616 setunsafeactionprotectiondisabled 10 862649 setupdateaddress 11 862659 setusedserver 10 862670 setuserappearancetemplate 9 862680 setuserconnectionparameters 11 862689 setuserdata 378 862700 setuserpasswordcompromisecheck 10 863078 setuserpasswordexpirationnotificationperiod 10 863088 setuserpasswordhashalgorithmtype 10 863098 setuserpasswordmaxeffectiveperiod 10 863108 setuserpasswordmineffectiveperiod 10 863118 setuserpasswordminlength 10 863128 setuserpasswordreuselimit 10 863138 setuserpasswordstrengthcheck 10 863148 setusersettings 9 863158 setusing 9 863167 setusingasdefaultstorage 9 863176 setvalue 59 863185 setwatchmode 10 863244 setwholeinterval 9 863254 sevenzip 12 863263 severity 9 863275 sg 18 863284 sha 63 863302 sha1 61 863365 sha256 45 863426 sha512 29 863471 shadedsurface 9 863500 shape 36 863509 shapebasecolor 9 863545 shapecolor 9 863554 shapecolorhue 9 863563 shapefile 4 863572 shaperepresentation 18 863576 shapesize 9 863594 share 9 863603 shareattachment 9 863612 shared 9 863621 sharedata 9 863630 shareinconversation 9 863639 sharemessage 9 863648 sharerequestdata 30 863657 sharerequestdataprocessingvariant 15 863687 sheet 13 863702 shift 459 863715 short 13 864174 shortcut 162 864187 shortcuttype 4 864349 shortpresentation 14 864353 show 282 864367 showactionchoice 11 864649 showall 18 864660 showallitems 9 864678 showaspart 9 864687 showasvalue 9 864696 showattribute 18 864705 showauto 9 864723 showbarcodescanning 9 864732 showbottom 9 864741 showbyvalues 9 864750 showcdatasection 18 864759 showcellnames 9 864777 showcertificatelist 9 864786 showchartgridlines 4 864795 showchartpopupreferenceline 20 864799 showchartscaletitle 21 864819 showcheckbox 22 864840 showcheckboxesindroplistwheninputmultiplevalues 9 864862 showcheckitems 11 864871 showchoosefromlist 10 864882 showchoosefrommenu 10 864892 showchooseitem 11 864902 showclosebutton 9 864913 showcolumngrouplevel 12 864922 showcomment 18 864934 showcondition 11 864952 showcoordinates 11 864963 showcurrentdate 29 864974 showdata 57 865003 showdatasourcecolumns 9 865060 showdatatable 32 865069 showdeleted 9 865101 showdeterminationfactor 9 865110 showdifferences 9 865119 showdifferencesmodally 9 865128 showdimensions 11 865137 showdocument 18 865148 showdocumentfragment 18 865166 showdocumentscanning 9 865184 showdocumenttype 18 865193 showedarea 11 865211 showelement 18 865222 showemptyvalues 9 865240 showentity 18 865249 showentityreference 18 865267 showequation 9 865285 showerror 9 865294 showerrorinfo 19 865303 showfields 31 865322 showfornearestvalue 9 865353 showfullscreenad 9 865362 showgraphicaldatarepresentationinchart 14 865371 showgraphicaldatarepresentationinchartlegend 14 865385 showgraphicalrepresentationofdatainchartlegend 5 865399 showgraphicalrepresentationofdataonchart 5 865404 showgrid 20 865409 showgroups 20 865429 showheaders 20 865449 showhelphyperlink 45 865469 showhierarchy 11 865514 showinchart 29 865525 showinchartlegend 21 865554 showindroplist 9 865575 showindroplistandininputfield 9 865584 showinfooter 20 865593 showinganttchart 21 865613 showinheader 29 865634 showininputfield 9 865663 showinlegend 9 865672 showinlist 69 865681 showinputapprate 10 865750 showinputcolumns 9 865760 showinputdate 10 865769 showinputnumber 10 865779 showinputstring 10 865789 showinputvalue 10 865799 showitemsareaonlyforsubordinates 9 865809 showleft 9 865818 showleftmargin 9 865827 showlegend 9 865836 showlines 11 865845 showmessagebox 10 865856 showmode 27 865866 showmonthspanel 9 865893 shownavigationandactionspanels 9 865902 shownotation 18 865911 showonchart 4 865929 showoncomposition 9 865933 showonhover 9 865942 showonmap 10 865951 showonusingfulltextsearch 9 865961 showorder 11 865970 showoutputpercent 22 865981 showpassword 12 866003 showpercent 20 866015 showperiodicallabels 11 866035 showpicture 22 866046 showpointlevel 9 866068 showpointspopupreferenceline 32 866077 showpointstext 9 866109 showpredictablecolumns 9 866118 showprocessinginstruction 18 866127 showquerybox 10 866145 showrewardedvideo 9 866155 showright 9 866164 showroot 9 866173 showrowandcolumnnames 9 866182 showrowgrouplevel 12 866191 showscale 9 866203 showscales 9 866212 showsectionspanel 9 866221 showselection 11 866230 showserieslevel 9 866241 showstate 4 866250 showstatus 18 866254 showstyle 11 866272 showtabs 81 866283 showtext 29 866364 showtitle 54 866393 showtop 9 866447 showtotallabels 11 866456 showtotalsinfooter 44 866467 showuserinfo 9 866511 showusernotification 10 866520 showvalue 10 866530 showvaluespopupreferenceline 32 866540 showwrappedheaders 9 866572 showwrappedtimescaleheaders 9 866581 shp 5 866590 si 12 866595 sienna 12 866607 sig 5 866619 sign 20 866624 signalgorithm 18 866644 signalgorithms 9 866662 signasync 20 866671 signature 30 866691 signaturealgorithm 9 866721 signaturecertificate 9 866730 signatures 22 866739 signaturetimestamp 9 866761 signaturetype 18 866770 signaturevalue 9 866788 signatureverificationcertificates 9 866797 signatureverificationdatatimestamp 9 866806 signatureverificationerror 9 866815 silver 21 866824 sim 4 866845 simple 21 866849 simpletypedefinition 141 866870 simplificationtype 4 867011 simplify 9 867015 simplytable 5 867024 sin 33 867029 single 54 867062 singlecallsafememoryusage 11 867116 singleline 9 867127 singlenodevalue 9 867136 singleprocessconnectionscount 11 867145 singleprocessinfobasescount 11 867156 singlerow 9 867167 singlethreaded 5 867176 singlevalue 9 867181 singlewindows 9 867190 sister 9 867199 size 166 867208 sizeasync 36 867374 sizechange 22 867410 sizechangemode 16 867432 sizedpie 9 867448 sizelimit 11 867457 sk 16 867468 skip 63 867484 skipasync 9 867547 skiponinput 58 867556 skipto 9 867614 skiptoasync 9 867623 skyblue 11 867632 skype 12 867643 sl 14 867655 slateblue 11 867669 slategray 11 867680 slaveitemswidth 27 867691 slicefirst 17 867718 slicelast 17 867735 sliceuse 20 867752 slow 9 867772 small 20 867781 smalltextfont 11 867801 smooth 9 867812 smoothcurve 9 867821 sms 129 867830 smslog 21 867959 smslogrecord 48 867980 smslogsupported 11 868028 smsmessage 47 868039 smsreceivingsupported 11 868086 smssendingsupported 11 868097 smsA>>1I5=85 62 868108 smtp 150 868170 smtpauthentication 9 868320 smtpauthenticationmode 5 868329 smtppassword 63 868334 smtppasswordchanged 36 868397 smtpport 63 868433 smtpsecureauthenticationonly 27 868496 smtpserveraddress 63 868523 smtpuser 63 868586 smtpusessl 9 868649 smtp0CB5=B8D8:0F8O 4 868658 smtpA5@25@ 4 868662 sn 21 868666 snapshotitem 9 868687 snapshotlength 9 868696 snow 11 868705 so 22 868716 socountrycode 4 868738 soft 9 868742 softadaptive 9 868751 softfail 9 868760 softwarelicense 11 868769 solid 60 868780 solution1 4 868840 solutionk 4 868844 solvesystemsoflinearequations 9 868848 some 10 868857 sort 107 868867 sortbypresentation 11 868974 sortbyvalue 11 868985 sortdirection 42 868996 sortlist 12 869038 sortlistasc 12 869050 sortlistdesc 12 869062 soundalert 24 869074 source 1400 869098 sourceconfigurations 9 870498 sourcedataset 20 870507 sourceexpression 20 870527 sourceline 10 870547 sourcelinenumber 9 870557 sourcemessage 9 870566 sourcerecordkey 9 870575 sources 9 870584 sourcestream 9 870593 sourcetags 9 870602 sourceB538 9 870611 southborderlatitude 20 870620 southeast 9 870640 southwest 9 870649 space 65 870658 spacemode 19 870723 span 9 870742 special 9 870751 specialarea 9 870760 specialcolumn 9 870769 specialposition 9 870778 specialtextcolor 11 870787 specialtextinputmode 50 870798 specificdate 9 870848 specified 28 870857 specifiedarea 9 870885 specify 28 870894 speechprocessing 10 870922 speechprocessingerror 9 870932 speechprocessingexternalconnectionparameters 19 870941 speechprocessinginfobasedata 5 870960 speechprocessinglocationusevariant 21 870965 speechprocessingmanager 150 870986 speechtotext 9 871136 speechtotextdelayedid 14 871145 speechtotextgrammars 6 871159 speechtotextgrammarschecksum 6 871165 speechtotextinformationdelayed 4 871171 speechtotextmodeldescription 51 871175 speechtotextmodeldir 11 871226 speechtotextmodelid 14 871237 speechtotextmodelmanagementservice 10 871251 speechtotextmodelparameters 30 871261 speechtotextmodels 6 871291 speechtotextmodelsdescriptions 9 871297 speechtotextphrasedata 31 871306 speechtotextphraseword 25 871337 speechtotextresult 15 871362 speechtotextservice 10 871377 speechtotextsettings 6 871387 speechtotextstreamingparameters 34 871393 speed 9 871427 spellcheckingontextinput 29 871436 spid 5 871465 spin 9 871470 spinbutton 31 871479 splash 9 871510 splinemode 33 871519 splinestrain 32 871552 split 27 871584 splitasync 9 871611 splitbinarydata 10 871620 splitfile 10 871630 splitinpartsof 9 871640 splitinpartsofasync 9 871649 splitperiod 42 871658 splittedbalancecr 22 871700 splittedbalancedr 22 871722 splitter 42 871744 splittext 36 871786 spn 10 871822 spouse 9 871832 spreadsheet 432 871841 spreadsheetdeletecomment 12 872273 spreadsheetdeletepagebreak 12 872285 spreadsheetdocument 679 872297 spreadsheetdocumentareacollection 36 872976 spreadsheetdocumentareafilltype 21 873012 spreadsheetdocumentcellareatype 25 873033 spreadsheetdocumentcelllinetype 41 873058 spreadsheetdocumentdetailuse 21 873099 spreadsheetdocumentdrawing 318 873120 spreadsheetdocumentdrawingcollection 48 873438 spreadsheetdocumentdrawinglinetype 36 873486 spreadsheetdocumentdrawingtype 71 873522 spreadsheetdocumentfield 117 873593 spreadsheetdocumentfiletype 95 873710 spreadsheetdocumentformatofrows 12 873805 spreadsheetdocumentgroupheaderplacement 20 873817 spreadsheetdocumentheaderfooter 48 873837 spreadsheetdocumentpatterntype 101 873885 spreadsheetdocumentpointertype 16 873986 spreadsheetdocumentprintsettings 13 874002 spreadsheetdocumentrange 432 874015 spreadsheetdocumentsavedpicturesdensity 26 874447 spreadsheetdocumentselectedareas 54 874473 spreadsheetdocumentselectionshowmodetype 15 874527 spreadsheetdocumentshifttype 20 874542 spreadsheetdocumentstepdirectiontype 21 874562 spreadsheetdocumenttemplateparameters 36 874583 spreadsheetdocumenttextplacementtype 26 874619 spreadsheetdocumentvaluesreadingmode 15 874645 spreadsheetinsertcomment 12 874660 spreadsheetinsertpagebreak 12 874672 spreadsheetreadonly 12 874684 spreadsheetshowcomments 12 874696 spreadsheetshowgrid 12 874708 spreadsheetshowgroups 12 874720 spreadsheetshowheaders 12 874732 spring 9 874744 springgreen 11 874753 spwd 6 874764 sq 14 874770 sql 80 874784 sqlite 6 874864 sqlyoffs 6 874870 sqrt 33 874876 squaredeuclidean 9 874909 sr 58 874918 src 61 874976 srvc 12 875037 srvr 7 875049 srvrconsole 14 875056 ss 28 875070 ssl 67 875098 ssl1 8 875165 ssl2 8 875173 ssl3 8 875181 ssl4 8 875189 st 8 875197 sta 6 875205 stack 9 875211 stacked 9 875220 stackedarea 9 875229 stackedbar 9 875238 stackedbar3d 9 875247 stackedcolumn 9 875256 stackedcolumn3d 9 875265 stackedline 9 875274 stackednormalized 9 875283 stackgroup 9 875292 stackgroupinchart 5 875301 stacktype 9 875306 stacktypeinchart 10 875315 standalone 48 875325 standaloneconfigurationcontent 10 875373 standaloneconfigurationrestrictionroles 10 875383 standard 128 875393 standardappearance 115 875521 standardattributedescription 145 875636 standardattributedescriptions 10 875781 standardattributes 171 875791 standardauthentication 88 875962 standardauthenticationchange 6 876050 standardbeginningdate 28 876056 standardbeginningdatevariant 115 876084 standardcommandsgroup 60 876199 standardglobalsearchtype 65 876259 standardization 4 876324 standardize 9 876328 standardodatainterfaceoptions 6 876337 standardperiod 116 876343 standardperiodeditdialog 29 876459 standardperiodvariant 250 876488 standardsettings 11 876738 standardsettingsstoragedefaultsettingsselection 30 876749 standardsettingsstoragemanager 72 876779 standardsettingsstorageselection 48 876851 standardtabularsectiondescription 40 876899 standardtabularsectiondescriptions 5 876939 standardtabularsections 18 876944 standardtimeoffset 10 876962 standardusers 9 876972 standby 9 876981 start 127 876990 startactivescanning 9 877117 startaudiorecording 9 877126 startchoice 32 877135 startchoosing 18 877167 startchoosingfromchoicelist 9 877185 startcolumnautogrouping 12 877194 startcolumngroup 12 877206 startdate 67 877218 started 44 877285 startedat 28 877329 startelement 9 877357 startexpirationdate 9 877366 startexpression 20 877375 startincoming 9 877395 startincomingringing 9 877404 startindex 18 877413 startlistchoice 32 877431 startoutgoing 9 877463 startpage 11 877472 startpagesettings 6 877483 startposition 9 877489 startrowautogrouping 12 877498 startrowgroup 12 877510 startsenddate 9 877522 startstreamingspeechtotext 9 877531 startswith 8 877540 starttexttospeech 9 877548 starttime 11 877557 starttls 12 877568 startuilogrecording 9 877580 startuniversaldateofprivatekey 9 877589 startvideoconference 21 877598 state 85 877619 statement 9 877704 stateorprovincename 8 877713 statepresentation 34 877721 statewindow 10 877755 status 121 877765 statuscode 18 877886 staywithnext 11 877904 std 11 877915 stddeviation 9 877926 steelblue 12 877935 step 57 877947 stepdirection 11 878004 stepping 8 878015 stereo 9 878023 stm 4 878032 stngs 4 878036 stock 9 878040 stockchartusedpointvalue 40 878049 stod 4 878089 stone 9 878093 stop 12 878102 stopactivescanning 9 878114 stopaudioplayback 9 878123 stopaudiorecording 9 878132 stopconnection 9 878141 stopprocessing 9 878150 stopstreamingspeechtotext 9 878159 stoptextplayback 9 878168 stoptexttospeech 9 878177 storage 99 878186 storagefieldname 7 878285 storageindexname 6 878292 storagetablename 6 878298 storeddata 9 878304 storeddatacontent 9 878313 storeddataerror 9 878322 storeddatasize 14 878331 storeddatasizeondisk 9 878345 storedfiledescription 20 878354 storeditemscount 9 878374 storedpasswordvalue 9 878383 storefullpath 18 878392 storerelativepath 18 878410 str 9 878428 strcompare 10 878437 strconcat 10 878447 stream 166 878457 streamingspeechtotextsupported 9 878623 street 40 878632 streetaddress 8 878672 strendswith 10 878680 stretch 9 878690 stretchrows 9 878699 stretchrowsanddata 9 878708 strfind 15 878717 strfindallbyregularexpression 10 878732 strfindandhighlightbyappearance 10 878742 strfindbyregularexpression 10 878752 strgetline 10 878762 strict 18 878772 strikeout 9 878790 string 218 878799 stringdataformat 9 879017 stringencodingmethod 15 879026 stringlength 5 879041 stringqualifiers 29 879046 strings 9 879075 stringsearchmode 126 879084 stringvalue 9 879210 stringwithnumber 10 879219 strlen 10 879229 strlikebyregularexpression 10 879239 strlinecount 10 879249 stroccurrencecount 10 879259 stronglyconnectedcomponents 9 879269 stronglyconnectedcomponentswithnoinnerconnectionrequired 9 879278 strongseparation 9 879287 strreplace 15 879296 strreplacebyregularexpression 10 879311 strsplit 10 879321 strstartswith 10 879331 strtemplate 10 879341 structure 137 879351 structureitemchart 5 879488 structureitemgroup 5 879493 structureitemnestedobject 5 879498 structureitemsfilteravailablefields 11 879503 structureitemtable 5 879514 stt 16 879519 style 154 879535 styleborders 18 879689 stylecolors 180 879707 styleelementtype 29 879887 stylefonts 42 879916 styleitem 92 879958 styleitems 10 880050 stylelib 39 880060 styles 10 880099 stylesheet 12 880109 styletags 9 880121 styleB538 9 880130 sub 19 880139 subbusinessprocess 9 880158 subject 56 880167 submit 4 880223 subordinateobjectshaveindependentrights 36 880227 subordinationuse 38 880263 subparameters 9 880301 subprocess 11 880310 subscriberadministrator 18 880321 subscriberemail 9 880339 subscriberiderror 9 880348 subscribertype 9 880357 subscribetomailbox 9 880366 subscription 9 880375 subset 17 880384 substitution 29 880401 substitutiongroup 10 880430 substitutiongroupaffiliation 11 880440 substitutiongroupexclusions 11 880451 substitutions 15 880462 substr 10 880477 substring 6 880487 substringdata 45 880493 subsystem 113 880538 subsystems 19 880651 success 18 880670 suffix 14 880688 suggestpasswordchange 9 880702 sum 18 880711 summary 9 880729 summaryseries 19 880738 summer 9 880757 super 13 880766 supplement 9 880779 support 45 880788 supported 9 880833 supportedonlybymainmanager 11 880842 supportsaltitude 9 880853 supportsheading 9 880862 supportsspeed 9 880871 surface 9 880880 surfacecolor 9 880889 surname 6 880898 suspend 9 880904 suspended 9 880913 susr 6 880922 sv 20 880928 svg 67 880948 sw 16 881015 swaplfnl 450 881031 swipe 9 881481 switch 18 881490 switchable 20 881508 switchactivity 12 881528 switchinterface 11 881540 switchprocessing 11 881551 switchrowdeletemark 9 881562 switchtodatahistoryversion 6 881571 sy 12 881577 symbology 4 881589 symbolsnotinbmp 9 881593 synccontents 12 881602 synchronousextensionandaddincallusemode 30 881614 synchronousplatformextensionandaddincallusemode 39 881644 syncport 29 881683 synonym 757 881712 synthesize 9 882469 sysauthallowed 14 882478 system 782 882492 systembackgroundjob 24 883274 systemdescriptions 30 883298 systemfields 5 883328 systemfont 11 883333 systemid 65 883344 systeminfo 58 883409 systemoflinearequationscalculation 78 883467 systemoflinearequationsdescription 15 883545 systemsdescription 9 883560 systemsettings 6 883569 systemsettingsstorage 10 883575 sysusername 19 883585 t 157 883604 ta 14 883761 tab 110 883775 tabindex 36 883885 table 3228 883921 tablebehavioronhorizontalcompression 20 887149 tablebodytemplate 5 887169 tablebox 486 887174 tableboxcolumn 276 887660 tableboxcolumns 66 887936 tableboxrowinputmode 25 888002 tableboxrowselectionmode 15 888027 tableboxselectedrows 42 888042 tableboxselectionmode 15 888084 tablecell 4 888099 tablecellappearance 5 888103 tablecurrentrowuse 25 888108 tabledatatype 9 888133 tablefilltype 4 888142 tablefooterbackcolor 11 888146 tablefootertemplate 9 888157 tablefootertextcolor 11 888166 tablegroup 10 888177 tablegroupoutputparametervalues 6 888187 tablegrouptemplate 5 888193 tableheader 6 888198 tableheaderbackcolor 11 888204 tableheadertemplate 9 888215 tableheadertextcolor 11 888224 tableheight 11 888235 tableheightcontrolvariant 25 888246 tablehierarchicalgroup 5 888271 tableid 9 888276 tablelocation 9 888285 tablename 42 888294 tableoutputparametervalues 6 888336 tablerecords 5 888342 tablerepresentation 38 888347 tablerow 4 888385 tablerowinputmode 25 888389 tablerowselectionmode 15 888414 tables 27 888429 tablesearchhistory 11 888456 tablesearchparameters 6 888467 tableselectionmode 15 888473 tablesforupdate 9 888488 tablespacepath 11 888497 tabletoadd 9 888508 tabletype 9 888517 tablewidth 12 888526 tabloid 11 888538 taborder 22 888549 tabs 9 888571 tabsonbottom 9 888580 tabsonlefthorizontal 9 888589 tabsonrighthorizontal 9 888598 tabsontop 9 888607 tabular 491 888616 tabularsection 91 889107 tabularsections 98 889198 tabularsectionsuse 18 889296 tagmanagerndef 30 889314 tagname 286 889344 tagndef 35 889630 tagwritelocksupportedasync 9 889665 tan 65 889674 tapegraph 9 889739 tar 13 889748 target 100 889761 targetconfiguration 9 889861 targetid 10 889870 targetnamespace 11 889880 targetstream 9 889891 task 1377 889900 taskcreatingprivilegedmode 9 891277 taskdescription 11 891286 tasklist 30 891297 tasklistmode 15 891327 taskmainpresentation 24 891342 taskmanager 120 891366 tasknumberautoprefix 33 891486 tasknumbertype 25 891519 taskobject 343 891544 taskref 127 891887 tasks 143 892014 tasksbyperformer 6 892157 taskselection 96 892163 tasksmanager 18 892259 taskviewmode 11 892277 taxcom 10 892288 taxi 52 892298 taxienableversion8 9 892350 tcp 56 892359 td 5 892415 te 14 892420 teal 12 892434 technicalspecialistmode 6 892446 tel 10 892452 telegram 12 892462 telephonytools 106 892474 telephonytoolscalleventvariant 30 892580 telephonytoolscalltype 5 892610 telephonytoolssmstype 35 892615 temp 115 892650 tempfilesdir 10 892765 tempfilesdirasync 10 892775 template 664 892785 templatedefinition 9 893449 templatelanguagecode 31 893458 templates 213 893489 templatetext 72 893702 templatetype 84 893774 templatetype1 9 893858 templatetype2 9 893867 temporarilyturnedoff 9 893876 temporaryallowedprocessestotalmemory 25 893885 temporaryallowedprocessestotalmemoryexcesstimelimit 11 893910 temporaryallowedprocessestotalmemorytimelimit 14 893921 tempstorage 5 893935 temptablesmanager 22 893940 tendays 67 893962 tendaysperiod 77 894029 term 11 894106 terminate 46 894117 terminateproblemprocess 11 894163 terminatesession 41 894174 test 491 894215 test1 4 894706 testcfg 4 894710 testclient 15 894714 testcomp 7 894729 tested 415 894736 testedapplication 114 895151 testedclientapplicationwindow 95 895265 testedcommandinterfacebutton 55 895360 testedcommandinterfacegroup 55 895415 testedform 105 895470 testedformbutton 45 895575 testedformdecoration 95 895620 testedformfield 90 895715 testedformgroup 100 895805 testedformitemaddition 80 895905 testedformtable 205 895985 testedwindowcommandinterface 40 896190 testmanager 5 896230 testsrv 6 896235 text 1518 896241 textbox 348 897759 textcolor 646 898107 textcoloruse 4 898753 textcontent 378 898757 textcontrast 9 899135 textdirection 26 899144 textdocument 181 899170 textdocumentfield 63 899351 textdocumenttemplateparameters 36 899414 textedit 21 899450 texteditend 21 899471 textencoding 48 899492 textextraction 24 899540 textfont 31 899564 textile 9 899595 textiswithinareabounds 9 899604 textlocation 18 899613 textorientation 50 899631 textplacement 31 899681 textplaybacksupported 9 899712 textpositionrelativetopicture 52 899721 textreader 37 899773 textrecordndef 24 899810 texts 9 899834 texttospeech 9 899843 texttospeechvoicedescription 30 899852 texttospeechvoiceparameterdescription 25 899882 texttospeechvoiceparametervaluedescription 20 899907 texttype 9 899927 textuse 4 899936 textwithpictures 9 899940 textwriter 37 899949 tfindescription 4 899986 tfoutdescription 4 899990 th 16 899994 thai 136 900010 the 185 900146 then 60 900331 there 16 900391 thickclient 63 900407 thickclientmanagedapplication 6 900470 thickclientordinaryapplication 6 900476 thickdashed 9 900482 thinclient 68 900491 thinclientwindowsettings 15 900559 thinclienwindowsettings 7 900574 thindashed 9 900581 this 4 900590 thisform 11 900594 thishalfyear 9 900605 thismonth 9 900614 thisnode 44 900623 thisobject 280 900667 thisquarter 9 900947 thistendays 9 900956 thistle 11 900965 thisweek 9 900976 thisyear 9 900985 threedimensional 9 900994 threestate 20 901003 throughalign 29 901023 thumbprint 9 901052 ti 16 901061 tif 7 901077 tiff 29 901084 tile 9 901113 tillendofthishalfyear 9 901122 tillendofthismonth 9 901131 tillendofthisquarter 9 901140 tillendofthistendays 9 901149 tillendofthisweek 9 901158 tillendofthisyear 9 901167 time 58 901176 timeout 63 901234 timepresentation 9 901297 timepresentationformat 54 901306 times 4 901360 timescale 54 901364 timescaledayformat 26 901418 timescaleitem 104 901444 timescaleitemclick 9 901548 timescaleitemhyperlink 9 901557 timescaleitemlabel 25 901566 timescaleitemlabels 25 901591 timescaleitems 48 901616 timescaleposition 26 901664 timescaleunittype 46 901690 timescalewrapbeginindent 9 901736 timescalewrapendindent 9 901745 timeslicewindow 4 901754 timeslicewindowrepetition 4 901758 timeslicewindowunit 4 901762 timestamp 4 901766 timestampserversaddresses 9 901770 timestampservice 24 901779 timezone 23 901803 timezonepresentation 10 901826 title 582 901836 titlearea 54 902418 titlebackcolor 18 902472 titledatapath 18 902490 titlefont 37 902508 titleheight 36 902545 titlehyperlink 9 902581 titleisshown 9 902590 titleleft 9 902599 titlelocation 55 902608 titleoutput 26 902663 titlepicture 11 902689 titleplacement 9 902700 titleright 9 902709 titles 9 902718 titlesandcurrentpage 9 902727 titletext 99 902736 titletextcolor 37 902835 titletextmode 9 902872 tk 20 902881 tl 9 902901 tls 32 902910 tmp 9 902942 tn 12 902951 to 144 902963 toc 6 903107 today 27 903113 tofolders 9 903140 tofoldersanditems 9 903149 together 45 903158 toitems 9 903203 token 22 903212 tokenauthentication 27 903234 tolocaltime 10 903261 tomato 12 903271 tomorrow 9 903283 tool 80 903292 tools 80 903372 toolspanel 5 903452 tooltip 603 903457 tooltipbackcolor 11 904060 tooltiprepresentation 105 904071 tooltiptext 11 904176 tooltiptextcolor 11 904187 toomanyresults 9 904198 top 488 904207 topandleftspecified 9 904695 topborder 22 904704 topleft 18 904726 toplevelparent 42 904744 toplevelsvertical 9 904786 topmargin 70 904795 topmultiline 9 904865 topmultilinetransposition 9 904874 topright 9 904883 topscrolling 9 904892 toptobottom 9 904901 tot 548 904910 total 184 905458 totalbyhierarchy 9 905642 totalcalculationfields 9 905651 totalcalculationfieldtype 9 905660 totalcount 9 905669 totaldigits 9 905678 totaldigitsfacet 9 905687 totalexpressions 9 905696 totalfield 5 905705 totalfields 11 905710 totalfieldstemplates 11 905721 totalplacementtype 25 905732 totals 12 905757 totalsbelow 11 905769 totalsbetweenaccounts 6 905780 totalsbyaccounts 6 905786 totalsbyaccountswithextdim 6 905792 totalscontrol 6 905798 totalsmaxperiodupdate 36 905804 totalsminperiodupdate 36 905840 totalsplacement 20 905876 totalsplacementoncolumns 9 905896 totalsplacementonrows 9 905905 totalsright 11 905914 totalsslicefirst 6 905925 totalsslicelast 6 905931 touniversaltime 10 905937 tport 9 905947 tr 333 905956 tr29 6 906289 trace 13 906295 track 90 906308 trackbar 102 906398 trackbarfield 9 906500 trackbarmarkingappearance 25 906509 trade 44 906534 transaction 68 906578 transactionactive 21 906646 transactional 9 906667 transactioned 18 906676 transactionid 22 906694 transactionlockservice 24 906716 transactionsisolationlevel 39 906740 transactionstatus 22 906779 transferablefiledescription 19 906801 transferdirection 38 906820 transferredfiledescription 25 906858 transform 29 906883 transformfromfile 9 906912 transformfromnode 9 906921 transformfromstring 9 906930 transforms 16 906939 transformvalues 9 906955 transparent 421 906964 transparentlabel 10 907385 transpose 10 907395 transverse 23 907405 trasform 12 907428 traversal 25 907440 tree 98 907465 treewalker 10 907563 trendlines 9 907573 trim 10 907582 trimall 15 907592 triml 15 907607 trimr 15 907622 true 74 907637 truetype 18 907711 truncate 9 907729 truncateeventlog 10 907738 try 9 907748 tsp 23 907757 tt 44 907780 tumbler 18 907824 tune 32 907842 tuning 32 907874 turkish 136 907906 turnedoff 9 908042 turnedoffreason 9 908051 turnedoffreasonerror 9 908060 turnedon 39 908069 turnflashlighton 11 908108 turnoff 11 908119 turnoffworkingprocess 16 908130 turnover 120 908146 turnovercr 55 908266 turnoverdr 55 908321 turnovers 55 908376 turnoversonly 11 908431 turquoise 20 908442 tw 14 908462 txt 205 908476 txtedt 6 908681 type 3144 908687 typedefinition 22 911831 typedefinitions 11 911853 typedescription 50 911864 typedomainenabled 19 911914 typefield 18 911933 typelink 57 911951 typelinkitem 11 912008 typename 40 912019 typeof 10 912059 typereductionmode 47 912069 typerestriction 20 912116 types 2163 912136 typesastree 9 914299 typesfilterfield 9 914308 typesfiltervalue 9 914317 tz 12 914326 u 618 914338 ua 43 914956 ubound 28 914999 ubuntu 24 915027 uc 52 915051 ui 107 915103 ui1 5 915210 ui2 5 915215 ui4 5 915220 ui8 5 915225 uid 9 915230 uidl 4 915239 uidplus 4 915243 uint 5 915247 uk 52 915252 unc 6 915304 uncheckall 12 915310 uncompressedsize 20 915322 undefined 13 915342 undeletemessages 9 915355 underline 18 915364 undomerge 12 915382 undoposting 37 915394 unfilledparentvalue 18 915431 unfinished 9 915449 ungroup 12 915458 unicode 47 915470 unicode4 6 915517 union 81 915523 unionall 9 915604 uniontype 9 915613 unique 33 915622 uniquekey 20 915655 uniqueness 9 915675 uniquevaluecount 9 915684 unit 11 915693 unite 9 915704 united 9 915713 unity 26 915722 universal 8 915748 universaldate 9 915756 universaldateofprivatekeyexpiration 9 915765 unix 46 915774 unixtime 5 915820 unknown 15 915825 unknownerror 9 915840 unknownformat 9 915849 unknownrecordndef 15 915858 unlimitedlengthstringsuse 18 915873 unload 206 915891 unloadasync 18 916097 unloadcolumn 154 916115 unloadcolumns 99 916269 unloadeventlog 10 916368 unloadrules 9 916378 unloadvalues 11 916387 unlock 121 916398 unlockdataforedit 10 916519 unlockformdataforedit 10 916529 unorderednodeiterator 9 916539 unorderednodesnapshot 9 916548 unparsed 15 916557 unpost 36 916572 unqualified 9 916608 unregagentadmin 16 916617 unregassignmentrule 16 916633 unregcluster 16 916649 unregclusteradmin 21 916665 unregisterinfobase 9 916686 unregisterinfobaseasync 9 916695 unregsecurityprofile 16 916704 unregsecurityprofileaddin 16 916720 unregsecurityprofileapplication 16 916736 unregsecurityprofilecomclass 16 916752 unregsecurityprofileinternetresource 16 916768 unregsecurityprofileunsafeexternalmodule 16 916784 unregsecurityprofilevirtualdirectory 16 916800 unregworkingserver 21 916816 unsafeactionprotection 135 916837 unsafeexternalmodulefullaccess 14 916972 unsafeoperationprotection 57 916986 unsafeoperationprotectiondescription 14 917043 unsafeoperationwarnings 9 917057 unsecure 9 917066 unset 9 917075 unsetnamespacemapping 9 917084 unspecified 9 917093 unstacked 9 917102 unsubscribefrommailbox 9 917111 unsupportedformat 9 917120 unverifiedsignaturetime 9 917129 up 13 917138 uparrow 9 917151 upca 24 917160 upce 20 917184 update 169 917204 updateaggregates 11 917373 updatecalendar 9 917384 updatecatalogaddress 9 917393 updatecertificaterevocationlist 9 917402 updatecertificaterevocationlistasync 9 917411 updatecontact 9 917420 updated 72 917429 updatedatabaseconfiguration 6 917501 updatedatahistory 6 917507 updatedatahistoryimmediatelyafterwrite 90 917513 updatedatahistoryofmissingdata 6 917603 updatedatahistorysettings 6 917609 updatedatahistoryversioncomment 6 917615 updatedate 9 917621 updateddata 9 917630 updatedomelement 352 917639 updateedittext 10 917991 updateerror 45 918001 updateevent 9 918046 updatehistory 9 918055 updatehistoryimmediatelyafterwrite 9 918064 updateinbackground 9 918073 updateindex 9 918082 updateinfobase 42 918091 updatelocation 9 918133 updateondatachange 24 918142 updateonfilterchange 33 918166 updatepredefineddata 36 918199 updatepurchaseinformation 9 918235 updatestate 9 918244 updateworkingserver 21 918253 updownarrow 9 918274 upgrade 8 918283 upper 20 918291 upperbound 20 918311 ur 14 918331 uri 976 918345 urirecordndef 19 919321 uri4>:C<5=B0 18 919340 uri70?8ALndef 29 919358 uri?@>AB@0=AB208<5= 859 919387 uri?@>AB@0=AB208<5=0B@81CB0 30 920246 uri?@>AB@0=AB208<5=A5@28A0 10 920276 uri?@>AB@0=AB208<5=AE5<K4;OAE5<Kxml 11 920286 uri?@>AB@0=AB28<5= 20 920297 url 611 920317 urlchoicelistitemdescription 20 920928 urlchoiselist 45 920948 urlclick 18 920993 urlencoding 9 921011 urlexternaldatastorage 26 921020 urlgetprocessing 19 921046 urlinurlencoding 9 921065 urllistgetprocessing 19 921074 urlnavigationdata 30 921093 urlparameters 18 921123 urlpresentation 25 921141 urlprocessing 37 921166 urls 14 921203 urltemplates 9 921217 urltype 9 921226 url2:>48@>2:5url 21 921235 url4>25@ONI59AB>@>=K 42 921256 url8AB>G=8:0 9 921298 url?@>20945@0openid 36 921307 urlA5@25@0 32 921343 urlAE5<K 8 921375 us 486 921383 usage 10 921869 usd 39 921879 use 831 921918 useadditionalgrammarsonly 9 922749 usealternationrowcolor 21 922758 usealways 9 922779 useascommonbubblesizeseries 4 922788 useattributes 17 922792 usecontentheight 18 922809 usecontextmenu 11 922827 usecoordinates 27 922838 usecopiesonly 9 922865 usecurrentdate 9 922874 usecurrentsessionsettings 45 922883 used 24 922928 usedbyanothercopy 9 922952 usedbyinfobase 9 922961 usedbythiscopy 9 922970 usedchartvaluesaxis 21 922979 useddatabasecopies 63 923000 useddatabasecopy 10 923063 useddatacontent 11 923073 usedefaultrolesforallusers 117 923084 usedescription 9 923201 usedfields 9 923210 usedfilename 80 923219 usedformserver 9 923299 usedindexescontent 11 923308 usedindistributedinfobase 117 923319 usedmobileapplicationfunctionalities 9 923436 usedoublequotes 9 923445 usedserver 15 923454 usedsettings 11 923469 usedvalueaxis 9 923480 usedvalueaxisinchart 10 923489 useextra 9 923499 useforfoldersanditems 40 923508 usefromdatasource 11 923548 usefulltextsearch 15 923559 useheightinformrows 18 923574 useheightintablerows 9 923592 useifnecessary 9 923601 useifpossible 9 923610 useignorablewhitespace 9 923619 useinfieldsheader 11 923628 useinfilter 11 923639 useingroup 11 923650 useinheader 11 923661 useinhierarchicalgroup 11 923672 useinoverall 11 923683 useinoverallheader 11 923694 useinoverallresourcefieldsheader 11 923705 useinparameters 11 923716 useinresourcefieldsheader 11 923727 useinternaldataaccelerator 9 923738 useinternetmailtokenauthentication 20 923747 useintotals 9 923767 useisunknown 9 923776 uselist 9 923785 usemanagedforminordinaryapplication 9 923794 usemap 27 923803 usemenumode 20 923830 usenextiffailed 9 923850 useonecommand 9 923859 useordinaryforminmanagedapplication 9 923868 useosauthentication 45 923877 useosproxy 18 923922 useoutput 21 923940 usepasswordcompromisecheckservice 45 923961 usepostingmode 20 924006 useprintersettings 9 924026 usepurposes 18 924035 usequerygroupifpossible 10 924053 usequickchoice 29 924063 user 435 924092 user1 4 924527 useragentinformation 19 924531 userdataworkdir 10 924550 userdataworkdirasync 10 924560 userestriction 41 924570 userestrictions 35 924611 userfieldcase 5 924646 userfieldexpression 5 924651 userfields 27 924656 userfullname 26 924683 userguide 6 924709 userinterruptprocessing 10 924715 usermatching 9 924725 usermatchingkey 11 924734 usermatchingkeys 57 924745 usermessage 57 924802 usermessageendtime 7 924859 username 131 924866 usernameadditioncode 42 924997 usernameadditioncodes 9 925039 usernotificationstatus 15 925048 userpasswordhashalgorithmtype 73 925063 userpasswordpolicies 9 925136 userpasswordpolicy 60 925145 userpasswordpolicydelete 42 925205 userpasswordpolicydeleteerror 42 925247 userpasswordpolicymanager 25 925289 userpasswordpolicynew 42 925314 userpasswordpolicynewerror 42 925356 userpasswordpolicyupdate 42 925398 userpasswordpolicyupdateerror 42 925440 userpresentation 8 925482 userroles 25 925490 users 92 925515 usersettingid 198 925607 usersettingpresentation 187 925805 usersettings 47 925992 usersettingskey 18 926039 usersettingsmodified 18 926057 usersettingspresentation 9 926075 usershistorystorage 6 926084 usersseparation 9 926090 useruuid 9 926099 userwithauthentication 12 926108 userwithoutnecessaryproperties 12 926120 userworkfavorites 61 926132 userworkfavoritesitem 30 926193 userworkhistory 18 926223 userworkhistoryitem 15 926241 userworkhistorymanager 25 926256 usescellnetwork 9 926281 usesdatanetwork 9 926290 usesetpasswordcompromisechecklist 36 926299 usespecifiedpasswordcompromisechecklist 9 926335 usespreadsheetdocumentwidthreduction 25 926344 usessatellites 9 926369 usessl 54 926378 usestandardcommands 189 926432 usestandardpasswordcompromisechecklist 45 926621 usetext 9 926666 usetoencrypt 9 926675 usetosign 9 926684 usevalue 9 926693 usevaluewithlimitations 9 926702 usevariant 9 926711 usewithoutstretch 9 926720 usewithwarnings 27 926729 usr 34 926756 usrdocs 10 926790 usrnm 5 926800 usual 180 926805 usualbutton 18 926985 usualgroup 9 927003 usualgroupbehavior 25 927012 usualgroupcontrolrepresentation 15 927037 usualgrouprepresentation 25 927052 utc 127 927077 utf 758 927204 utf16 169 927962 utf32 166 928131 utf8 261 928297 uuencode 13 928558 uuid 281 928571 uuidversion 25 928852 uy 12 928877 uz 28 928889 v 26 928917 v1 15 928943 v2 10 928958 v2048 6 928968 v3 10 928974 v8 1988 928984 v83 60 930972 v83c 6 931032 val 4 931038 validate 49 931042 validateinapppurchasereceipt 9 931091 validateinapppurchasereceiptatmobiledevice 9 931100 validatestructure 9 931109 validationtype 9 931118 validfrom 9 931127 validto 9 931136 valign 27 931145 value 1398 931172 valueafterchange 5 932570 valueappearance 41 932575 valuebeforechange 5 932616 valuechange 19 932621 valuechoice 85 932640 valuecontains 7 932725 valuedescription 5 932732 valueequals 7 932737 valuefield 18 932744 valuefrom 24 932762 valuefromfile 10 932786 valuefromstringinternal 10 932796 valueisfilled 10 932806 valuelabelformat 42 932816 valuelist 172 932858 valuelistallowed 19 933030 valuelistitem 36 933049 valuelisttype 6 933085 valuemanagermodule 9 933091 valuematchesregex 7 933100 valuepercent 9 933107 values 76 933116 valuesavailablefields 22 933192 valuesaxis 32 933214 valuesbyseriesconnection 33 933246 valuesbyseriesconnectioncolor 33 933279 valuesbyseriesconnectionlines 32 933312 valuescaleformat 18 933344 valuescount 9 933362 valuescountafterupdate 36 933371 valueseditmode 19 933407 valuesize 9 933426 valuespicture 9 933435 valuesreferencebands 32 933444 valuesreferencelines 32 933476 valuesscale 32 933508 valuesselection 9 933540 valuesselectionmode 9 933549 valuesshowmode 9 933558 valuestartswith 7 933567 valuestooltipfilltype 32 933574 valuestooltipshowmode 33 933606 valuestorage 18 933639 valuestoragesuse 18 933657 valuetable 139 933675 valuetablecolumn 30 933814 valuetablecolumncollection 66 933844 valuetablerow 30 933910 valuetextrepresentation 9 933940 valueto 24 933949 valuetofile 10 933973 valuetoformattribute 10 933983 valuetoformdata 10 933993 valuetostringinternal 10 934003 valuetree 36 934013 valuetreecolumn 30 934049 valuetreecolumncollection 66 934079 valuetreerow 48 934145 valuetreerowcollection 96 934193 valuetype 334 934289 valuetypefield 9 934623 var 13 934632 variable 9 934645 variables 5 934654 variablesinrelationscolumn 9 934659 variant 83 934668 variantform 18 934751 variantkey 9 934769 variantmodified 9 934778 variantpresentation 9 934787 variants 20 934796 variantset 9 934816 variantsstorage 9 934825 variety 22 934834 varietyannotation 11 934856 vbscript 5 934867 ve 12 934872 vendor 157 934884 vendorinformationaddress 9 935041 verdana 5 935050 verificationcode 10 935055 verificationcodealphabet 9 935065 verificationcodeeffectiveperiod 54 935074 verificationcodelength 54 935128 verificationcoderefreshrequestlockduration 54 935182 verificationsupported 9 935236 verifyaccessrights 10 935245 verifyandrepairimportant 36 935255 verifyandrepairinfo 36 935291 verifyandrepairmessage 36 935327 verifyasync 9 935363 verifyreceipt 5 935372 verifysignature 27 935377 verifysignatureasync 27 935404 verifysignatures 18 935431 verifysignaturesasync 18 935449 verifytimestamp 9 935467 verifytimestampasync 9 935476 version 460 935485 version1 27 935945 version2 18 935972 version3 9 935990 version4 9 935999 version5 9 936008 version8 201 936017 versioncomment 9 936218 versioncommentupdate 36 936227 versiondata 9 936263 versiondifferences 9 936272 versionnumber 25 936281 versionnumberafterchange 9 936306 versionnumberbeforechange 9 936315 versionnumberswitchtodatahistoryversion 72 936324 versions 6 936396 vertical 63 936402 verticalaccuracy 9 936465 verticalalign 262 936474 verticalaligningroup 54 936736 verticalbrackets 9 936790 verticaldensity 9 936799 verticalformscroll 25 936808 verticallabels 9 936833 verticallevel 5 936842 verticallines 29 936847 verticallinesdatatable 9 936876 vertically 27 936885 verticalmerge 5 936912 verticaloverall 6 936917 verticaloverallplacement 15 936923 verticalscroll 18 936938 verticalscrollbar 40 936956 verticalscrollonreducesize 9 936996 verticalspacing 27 937005 verticalstretch 209 937032 veryfast 9 937241 veryhigh 9 937250 veryimportant 9 937259 verylow 9 937268 veryslow 9 937277 vi 42 937286 video 33 937328 videoconference 9 937361 videoconferenceallowed 9 937370 videoconferenceasync 9 937379 videoconferenceparticipant 9 937388 videoconferences 9 937397 videoconferencesavailable 9 937406 videoconferencesupported 9 937415 videoquality 20 937424 videorecordingsupported 9 937444 view 109 937453 viewbyowner 12 937562 viewdatahistory 6 937574 viewfoldersanditems 22 937580 viewmode 260 937602 viewmodeapplicationonsetreportresult 20 937862 viewmodeapplicationonsetresult 9 937882 viewscalingmode 29 937891 viewstatuslocation 43 937920 viewstatusrepresentation 18 937963 violet 12 937981 violetred 11 937993 virtual 8 938004 visible 236 938012 vista 9 938248 visual 19 938257 visualtypeinchart 5 938276 vl 17 938281 vlink 9 938298 vn 24 938307 voice 9 938331 vrd 11 938340 vs 6 938351 vspace 29 938357 vt 59 938386 vtab 11 938445 w 103 938456 w3 384 938559 w3c 64 938943 w3includeattributes 9 939007 w3include0B@81CBK 9 939016 waitforclosing 9 939025 waitforcompletion 22 939034 waitforcondition 9 939056 waitfordroplistgeneration 9 939065 waitforexecutioncompletion 22 939074 waitforobjectdisplayed 9 939096 want 18 939105 warm 9 939123 warn 97 939132 warnbelowhigh 9 939229 warnbelowmedium 9 939238 warning 97 939247 warningonedit 9 939344 warningoneditrepresentation 29 939353 was 5 939382 waterfall 9 939387 wav 10 939396 wavpcm16bit 12 939406 wd 5 939418 weaklyconnectedcomponents 9 939423 weakseparation 9 939432 web 169 939441 webchat 8 939610 webclient 78 939618 webclientwindowsettings 7 939696 webcolor 9 939703 webcolors 882 939712 webdav 28 940594 webhook 13 940622 webkit 5 940635 webserverextension 20 940640 webservice 138 940660 webserviceoperation 85 940798 webserviceparameter 70 940883 webservices 9 940953 websocket 273 940962 websocketclient 180 941235 websocketclientconnection 45 941415 websocketclientconnectionhandlers 38 941460 websocketclientconnectionparameters 45 941498 websocketclientconnections 9 941543 websocketclientconnectionsmanager 20 941552 websocketclients 24 941572 websocketclientsmanager 25 941596 websocketconnectionstate 25 941621 websocket:;85=B 406 941646 websocket:;85=BA>548=5=85 108 942052 websocket:;85=BA>548=5=8O 9 942160 websocket:;85=BK 24 942169 websocketD09;>2>3>20@80=B0 48 942193 webA5@28A 322 942241 webA5@28AK 10 942563 webF25B 9 942573 webF25B0 901 942582 week 95 943483 weekday 48 943578 weekdayinmonth 18 943626 weekdaymonthday 9 943644 weekdayname 6 943653 weekdays 18 943659 weekly 9 943677 weekofyear 16 943686 weekperiod 77 943702 weeksincebeginofperiod 9 943779 weeksperiod 18 943788 weight 63 943806 westborderlongitude 20 943869 whatsapp 46 943889 wheat 12 943935 when 50 943947 whenactive 27 943997 whenmultiplecellsselected 9 944024 whenmultiplecellsselectedwhenactive 9 944033 where 14 944042 while 9 944056 white 11 944065 whitebackgrounddocument 9 944076 whitepaperquality 9 944085 whitesmoke 11 944094 whitespace 18 944105 whitespacefacet 9 944123 wholecatalog 9 944132 wholecharacteristickind 9 944141 wholechartofaccounts 9 944150 wholetext 36 944159 wi 40 944195 wide 5 944235 width 585 944240 widthinmonths 9 944825 widthweightfactor 20 944834 wifi 12 944854 wifiprinters 9 944866 wifi?@8=B5@K 9 944875 wiki 10 944884 wikipedia 10 944894 wildcard 20 944904 win 16 944924 window 2240 944940 windowappearancemode 11 947180 windowappearancemodechange 20 947191 windowappearancemodevariant 20 947211 windowbackground 11 947231 windowdocklocation 11 947242 windowdockvariant 25 947253 windowframe 11 947278 windowlocation 11 947289 windowlocationvariant 20 947300 windowoptionskey 41 947320 windowoptionsname 22 947361 windows 2222 947383 windowscertificateselectmode 24 949605 windowscertificationauthoritycertificates 9 949629 windowsclientcertificate 18 949638 windowscolor 9 949656 windowscolors 156 949665 windowsettings 11 949821 windowsfont 9 949832 windowsfonts 36 949841 windowsinapppurchase 12 949877 windowsizechange 15 949889 windowstate 11 949904 windowstatevariant 25 949915 windowsusers 10 949940 windowsF25B 9 949950 windowsF25B0 156 949959 windowsH@8DB 18 950115 windowsH@8DBK 40 950133 windowtext 11 950173 winrt 33 950184 winter 9 950217 wireframesurface 9 950226 with 6 950235 withaxis 9 950241 withdimensions 9 950250 withinownersubordination 9 950259 withinsubordination 27 950268 withoutborder 9 950295 withoutmove 9 950304 withoutpattern 9 950313 withoutprocessing 9 950322 withoutrestriction 9 950331 withoutshift 9 950340 withoutstatus 9 950349 withownerfield 9 950358 wjalrxutnfemi 5 950367 wmf 24 950372 wns 16 950396 wood 9 950412 word 48 950421 words 9 950469 work 57 950478 workfax 9 950535 working 6 950544 workingaddress 7 950550 workingcomputer 4 950557 workingdate 19 950561 workingdatemode 15 950580 workingdateuse 9 950595 workingprocessmemorylimit 14 950604 workmobile 9 950618 workplace 9 950627 workprocessid 11 950636 workprocessmemoryusagelimit 11 950647 workprocesssafememoryusage 11 950658 workprocessstatus 11 950669 works 6 950680 workserverid 11 950686 world 5 950697 wrap 47 950702 wrappedtimescaleheaderarea 14 950749 wrappedtimescaleheaderclick 9 950763 wrappedtimescaleheaderformat 9 950772 wrappedtimescaleheaderhyperlink 9 950781 writablepasswordsettingdate 9 950790 write 950 950799 writeandclose 11 951749 writeasync 106 951760 writeattachments 9 951866 writeattachmentsasync 9 951875 writeattachmentsdeletion 9 951884 writeattachmentsdeletionasync 9 951893 writeattribute 27 951902 writebinarydatabuffer 9 951929 writebinarydatabufferasync 9 951938 writebitwiseand 9 951947 writebitwiseandnot 9 951956 writebitwiseor 9 951965 writebitwisexor 9 951974 writebyte 9 951983 writebyteasync 9 951992 writecdatasection 27 952001 writechanges 22 952028 writechars 9 952050 writecharsasync 9 952059 writecomment 36 952068 writecontenttofile 36 952104 writecurrent 27 952140 writedatahistory 121 952167 writedatahistoryparameters 45 952288 writedatahistoryversioninformation 65 952333 writedatahistoryversioninformationcollection 20 952398 writediskdatasize 22 952418 writediskdatasizecurrent 11 952440 writediskdatasizelast5min 11 952451 writediskdatasizetotal 11 952462 writedocumenttype 27 952473 writedumpwhileterminatingbymemory 11 952500 writeendarray 9 952511 writeendattribute 27 952520 writeendelement 27 952547 writeendobject 9 952574 writeentityreference 27 952583 writefileforprinting 9 952610 writefileforprintingasync 9 952619 writeinform 154 952628 writeint16 18 952782 writeint16async 9 952800 writeint32 18 952809 writeint32async 9 952827 writeint64 18 952836 writeint64async 9 952854 writejson 28 952863 writejsondate 10 952891 writejsonvalue 10 952901 writeline 18 952911 writelineasync 9 952929 writelogevent 10 952938 writemessageasync 9 952948 writemode 9 952957 writemodified 9 952966 writenamespacemapping 27 952975 writeontagsupported 9 953002 writeontagsupportedasync 9 953011 writeprocessinginstruction 27 953020 writepropertyname 9 953047 writeraw 36 953056 writerepresentationobject 9 953092 writerepresentationobjectasync 9 953101 writeschema 9 953110 writeselected 9 953119 writesignature 9 953128 writesignatureasync 9 953137 writestartarray 9 953146 writestartattribute 27 953155 writestartelement 27 953182 writestartobject 9 953209 writetext 27 953218 writevalue 9 953245 writeversion 9 953254 writexdto 9 953263 writexml 28 953272 writexmldeclaration 27 953300 writingallowed 11 953327 ws 95 953338 wsconnection 15 953433 wsdefinition 9 953448 wsdefinitions 24 953457 wsdl 35 953481 wsendpoint 25 953516 wsendpointcollection 15 953541 wsinterface 25 953556 wsoperation 25 953581 wsoperationcollection 15 953606 wsparameter 30 953621 wsparametercollection 15 953651 wsparameterdirection 21 953666 wsproxy 59 953687 wsreference 65 953746 wsreferencemanager 15 953811 wsreferences 18 953826 wsreferencesmanager 10 953844 wsreturnvalue 20 953854 wsservice 25 953874 wsservicecollection 15 953899 ws2>72@0I05<>57=0G5=85 24 953914 ws8=B5@D59A 33 953938 ws:>;;5:F8O>?5@0F89 23 953971 ws:>;;5:F8O?0@0<5B@>2 23 953994 ws:>;;5:F8OA5@28A>2 23 954017 ws:>;;5:F8OB>G5:?>4:;NG5=8O 23 954040 ws=0?@02;5=85?0@0<5B@0 24 954063 ws>?5@0F8O 41 954087 ws>?@545;5=85 9 954128 ws>?@545;5=8O 54 954137 ws?0@0<5B@ 42 954191 ws?@>:A8 84 954233 wsA5@28A 37 954317 wsAAK;:0 251 954354 wsAAK;:0<5=5465@ 27 954605 wsAAK;:8 32 954632 wsAAK;:8<5=5465@ 19 954664 wsB>G:0?>4:;NG5=8O 41 954683 www 405 954724 x 563 955129 x1 8 955692 x110 112 955700 x2 8 955812 x86 112 955820 xb 178 955932 xbase 389 956110 xbaseencoding 15 956499 xbasefield 25 956514 xbasefieldscollection 35 956539 xbaseindex 30 956574 xbaseindexescollection 35 956604 xbasekey 10 956639 xdto 3354 956649 xdtodataobject 80 960003 xdtodatavalue 30 960083 xdtodatavaluecollection 15 960113 xdtofacet 15 960128 xdtofacetcollection 25 960143 xdtofacettype 65 960168 xdtofactory 95 960233 xdtolist 55 960328 xdtoobjecttype 60 960383 xdtopackage 105 960443 xdtopackagecollection 15 960548 xdtopackages 19 960563 xdtoproperty 70 960582 xdtopropertycollection 15 960652 xdtoreturningvaluetype 9 960667 xdtosequence 60 960676 xdtoserializer 93 960736 xdtovaluetype 54 960829 xdtovaluetypecollection 15 960883 xdtovariety 20 960898 xi 20 960918 xlb 4 960938 xlc 4 960942 xls 57 960946 xls95 30 961003 xls97 20 961033 xlsx 52 961053 xlt 4 961105 xml 4653 961109 xmla 21 965762 xmlattributetype 55 965783 xmlbase 12 965838 xmlcanonicalization 9 965850 xmlcanonicalization1 15 965859 xmlcanonicalizationtype 35 965874 xmlcanonicalizationwithcomments 9 965909 xmlcanonicalizingwriter 9 965918 xmldatatype 19 965927 xmldeclaration 9 965946 xmlencoding 45 965955 xmlexclusivecanonicalization 9 966000 xmlexclusivecanonicalizationwithcomments 9 966009 xmlexpandedname 19 966018 xmlexpandednamelist 40 966037 xmlform 20 966077 xmlnamespacecontext 40 966097 xmlnodetype 80 966137 xmlreader 240 966217 xmlreadersettings 68 966457 xmlschema 524 966525 xmlschemabuilder 23 967049 xmlschemaset 41 967072 xmlspace 15 967113 xmlstring 19 967128 xmlstringprocessing 9 967147 xmlstringprocessingmanager 10 967156 xmltype 19 967166 xmltypeassignment 15 967185 xmltypeof 19 967200 xmlvalidationtype 20 967219 xmlvalue 19 967239 xmlversion 45 967258 xmlwriter 135 967303 xmlwritersettings 38 967438 xml7=0G5=85 34 967476 xmlAB@>:0 40 967510 xmlB8? 26 967550 xmlB8?7=G 22 967576 xn 8 967598 xor 9 967606 xp 22 967615 xpath 118 967637 xpathdefinition 9 967755 xpathexpression 10 967764 xpathnamespace 185 967774 xpathresult 50 967959 xpcom 10 968009 xsannotation 89 968019 xsappinfo 77 968108 xsattributedeclaration 155 968185 xsattributegroupdefinition 125 968340 xsattributeuse 107 968465 xsattributeusecategory 20 968572 xscomplexfinal 20 968592 xscomplexfinalunion 30 968612 xscomplextypedefinition 197 968642 xscomponentfixedlist 24 968839 xscomponentlist 54 968863 xscomponenttype 165 968917 xscompositor 20 969082 xsconstraint 15 969102 xscontentmodel 15 969117 xsderivationmethod 15 969132 xsdisallowedsubstitutions 25 969147 xsdisallowedsubstitutionsunion 30 969172 xsdocumentation 83 969202 xselementdeclaration 209 969285 xsenumerationfacet 95 969494 xsform 15 969589 xsfractiondigitsfacet 95 969604 xsidentityconstraintcategory 20 969699 xsidentityconstraintdefinition 113 969719 xsimport 95 969832 xsinclude 83 969927 xsl 56 970010 xslengthfacet 95 970066 xslt 4 970161 xsltransform 64 970165 xsmaxexclusivefacet 107 970229 xsmaxinclusivefacet 107 970336 xsmaxlengthfacet 95 970443 xsminexclusivefacet 107 970538 xsmininclusivefacet 107 970645 xsminlengthfacet 95 970752 xsmodelgroup 83 970847 xsmodelgroupdefinition 113 970930 xsnamedcomponentmap 18 971043 xsnamespaceconstraintcategory 20 971061 xsnotationdeclaration 95 971081 xsparticle 101 971176 xspatternfacet 95 971277 xsprocesscontents 20 971372 xsprohibitedsubstitutions 20 971392 xsprohibitedsubstitutionsunion 30 971412 xsredefine 89 971442 xsschemafinal 30 971531 xsschemafinalunion 42 971561 xssimplefinal 25 971603 xssimplefinalunion 36 971628 xssimpletypedefinition 167 971664 xssimpletypevariety 20 971831 xssubstitutiongroupexclusions 20 971851 xssubstitutiongroupexclusionsunion 30 971871 xstotaldigitsfacet 95 971901 xswhitespacefacet 95 971996 xswhitespacehandling 20 972091 xswildcard 107 972111 xsxpathdefinition 95 972218 xsxpathvariety 15 972313 xu 7 972328 xx 11 972335 xxxx 6 972346 xxxxx 5 972352 xxxxxxxx 4 972357 xxxxxxxxxxxx 4 972361 xz 13 972365 y 70 972378 ye 12 972448 year 173 972460 yearly 9 972633 yearperiod 77 972642 yearsincebeginofperiod 9 972719 yearsincebeginofperiod445 9 972728 yearsperiod 9 972737 yellow 20 972746 yellowgreen 11 972766 yes 17 972777 yesno 9 972794 yesnocancel 9 972803 yesterday 9 972812 yi 20 972821 ymd6rpamwqsye 8 972841 you 31 972849 yy 20 972880 yyyy 28 972900 yyyymmddhhmmss 17 972928 yyyyy 5 972945 z 46 972950 za 16 972996 zap 9 973012 zh 55 973021 zi 7 973076 zile 9 973083 zip 262 973092 zip20 66 973354 zipcode 32 973420 zipcompressionlevel 20 973452 zipcompressionmethod 20 973472 zipencryptionmethod 25 973492 zipfileentries 20 973517 zipfileentry 85 973537 zipfilereader 47 973622 zipfilewriter 37 973669 ziprestorefilepathsmode 15 973706 zipstorepathmode 20 973721 zipsubdirprocessingmode 15 973741 zn 8 973756 zone 11 973764 zoom 12 973775 zoomable 29 973787 zoomin 12 973816 zoomout 12 973828 zorder 11 973840 zw 12 973851 zBote 9 973863 zBoty 9 973872 zBotych 9 973881 D 7 973890 | 7 973897 0 4053 973904 04 6 977957 011@5280BC@0 4 977963 012 7 977967 0123 6 977974 0170F 4 977980 0170F52 4 977984 01>=5=B 60 977988 01>=5=B0 56 978048 01>=5=B5 4 978104 01>@B 9 978108 01A>;NB=0O 22 978117 01A>;NB=89 4 978139 01A>;NB=> 8 978143 01A>;NB=>3> 4 978151 01A>;NB=>5 4 978155 01A>;NB=>9 42 978159 01A>;NB=K5 9 978201 01A>;NB=K9 184 978210 01A>;NB=K< 56 978394 01A>;NB=K<8 8 978450 01AB@0:B=89 14 978458 01AB@0:B=>3> 14 978472 01AB@0:B=>5 5 978486 01AB@0:B=K5 5 978491 01AB@0:B=K9 39 978496 01AB@0:F8N 40 978535 01AB@0:F8O 40 978575 020@89=> 60 978615 020@89=>3> 22 978675 020@89=>5 4 978697 020@89=>< 28 978701 020@89=><C 10 978729 020@89=K9 117 978739 020B0@ 4 978856 023CAB 7 978860 023CAB0 7 978867 02AB@0;8O 12 978874 02AB@8O 12 978886 02B> 2616 978898 02B>22>4=570?>;=5==>3> 9 981514 02B>22>4=>2>9AB@>:8 20 981523 02B>2@5<O 25 981543 02B>2K1>@ 12 981568 02B>2K1>@=570?>;=5==>3> 20 981580 02B>2K1@0==>5?>;5:><?>=>2:840==KE 85 981600 02B>2KA>B0AB@>:8 18 981685 02B>2KA>B0OG59:8 31 981703 02B>3@C??8@>2:8 12 981734 02B>45B0;L=K570?8A8 9 981746 02B>4>102;5=85?@54AB02;5=89 12 981755 02B>703>;>2>: 29 981767 02B>70?>;=5=85 41 981796 02B>70?>;=5=854>ABC?=KE?>;59 19 981837 02B>70?>;=5=8O 12 981856 02B>87<5=5=85 4 981868 02B>87<5=5=85@538AB@0?@822>45B5:AB0 40 981872 02B>87<5=5=8O 4 981912 02B>8A?>;L7>20=85 14 981916 02B>8A?>;L7>20=85>1I53>@5:2878B0 29 981930 02B>8A?@02;5=85 8 981959 02B>8A?@02;5=85?@822>45B5:AB0 30 981967 02B>8A?@02;5=8O 4 981997 02B>:>=B5:AB=>5<5=N 21 982001 02B><0:A8<0;L=0O2KA>B0 278 982022 02B><0:A8<0;L=0O2KA>B02AB@>:0EB01;8FK 18 982300 02B><0:A8<0;L=0OH8@8=0 299 982318 02B><0:A8<0;L=>57=0G5=85 17 982617 02B><0AHB01 21 982634 02B><0B878@>20==>3> 9 982655 02B><0B878@>20==>5 10 982664 02B><0B878@>20==>< 4 982674 02B><0B878@>20BL 17 982678 02B><0B8G5A:0O 25 982695 02B><0B8G5A:0O>B?@02:0smsA>>1I5=89 9 982720 02B><0B8G5A:8 2013 982729 02B><0B8G5A:89 1417 984742 02B><0B8G5A:898C?@02;O5<K9 85 986159 02B><0B8G5A:89@0AG5B 13 986244 02B><0B8G5A:8< 30 986257 02B><0B8G5A:8A>E@0=OBL0CB5=B8D8:0F8N?>C<>;G0=8N 36 986287 02B><0B8G5A:8E 15 986323 02B><0B8G5A:>3> 661 986338 02B><0B8G5A:>5 553 986999 02B><0B8G5A:>5A>E@0=5=8540==KE2=0AB@>9:0E 13 987552 02B><0B8G5A:>5A>E@0=5=8540==KED>@<K2=0AB@>9:0E 19 987565 02B><0B8G5A:>5A>E@0=5=85?>;L7>20B5;LA:8E=0AB@>5: 9 987584 02B><0B8G5A:>9 69 987593 02B><0B8G5A:>< 42 987662 02B><0B8G5A:CN 84 987704 02B><8=8<0;L=0O2KA>B0AB@>:8 9 987788 02B><8=8<0;L=0OH8@8=0:>;>=:8 9 987797 02B><8=8<0;L=>57=0G5=85 9 987806 02B><>18;L 23 987815 02B><>18;O 18 987838 02B><>18;O< 6 987856 02B>=02830F8>==0OAAK;:0 44 987862 02B>=><5@70?8A8 21 987906 02B>=><=89 60 987927 02B>=><=>3> 60 987987 02B>=><=>9 37 988047 02B>=><=>< 4 988084 02B>=><=K9 36718 988088 02B>=><=K< 61 1024806 02B>=C<5@0F859 4 1024867 02B>=C<5@0F88 60 1024871 02B>=C<5@0F8O 235 1024931 02B>=C<5@0F8O2D>@<5 55 1025166 02B>>1=>2;5=85 208 1025221 02B>>1=>2;5=8O 64 1025429 02B>>?@545;5=85 9 1025493 02B>>?@545;5=85?>;=>3>8=B5@20;0 14 1025502 02B>>B<5B:0 9 1025516 02B>>B<5B:0=570?>;=5==>3> 84 1025525 02B>>B>1@065=85:=>?:8>B:@KB8O 9 1025609 02B>>B>1@065=85:=>?:8>G8AB:8 9 1025618 02B>>B>1@065=85A>AB>O=8O 9 1025627 02B>>BABC? 25 1025636 02B>?5@5=>A 9 1025661 02B>?5@5=>AAB@>: 20 1025670 02B>?>2>@>B 6 1025690 02B>?>41>@ 181 1025696 02B>?>41>@5 155 1025877 02B>?>41>@?>;L7>20B5;59A8AB5<K2708<>459AB28O 28 1026032 02B>?>41>@B5:AB0 19 1026060 02B>?>41>@C 4 1026079 02B>?>4AB0=>2:0 6 1026083 02B>?>4AB0=>2:8 5 1026089 02B>?>4B25@645=85 15 1026094 02B>?>78F8O 10 1026109 02B>?>78F8O@5AC@A>2 21 1026119 02B>?>78F8O@5AC@A>2:><?>=>2:840==KE 36 1026140 02B>?>;5 7 1026176 02B>?>;53@C??8@>2:8:><?>=>2:840==KE 79 1026183 02B>?>;O 5 1026262 02B>?>@O4>: 14 1026267 02B>?>@O4>:>1E>40 11 1026281 02B>?>@O4>:?>:>4C 9 1026292 02B>?@5D8:A=><5@07040G8 37 1026301 02B>@ 53 1026338 02B>@0 16 1026391 02B>@0742865=85A5@89 66 1026407 02B>@07<5@ 30 1026473 02B>@07<5@157CG5B0<0AHB010 19 1026503 02B>@0< 5 1026522 02B>@5 4 1026527 02B>@538AB@0F88 8 1026531 02B>@538AB@0F8O 22 1026539 02B>@538AB@0F8O87<5=5=89 19 1026561 02B>@870F88 13 1026580 02B>@870F8O 26 1026593 02B>@878@>20= 4 1026619 02B>@878@>20==K9 4 1026623 02B>@>2 21 1026627 02B>@A:85?@020 13 1026648 02B>A>E@0=5=85 24 1026661 02B>A>E@0=5=8O 9 1026685 02B>B5:AB 9 1026694 02B>B@0=A?>=8@>20=85 17 1026703 02B>C40;5=85 17 1026720 02B>C40;5=8587>1@01>B:8?>A;570?8A825@A89 9 1026737 02B>C?>@O4>G820=85 37 1026746 02B>CAB0=>2:08<5=A5@89 9 1026783 02B>CAB0=>2:08<5=B>G5: 9 1026792 02B>CAB0=>2:0B5:AB0A5@89 22 1026801 02B>CAB0=>2:0B5:AB0B>G5: 22 1026823 02B>CAB0=>2:0B5:AB0M;5<5=B>2 9 1026845 02B>D8:A0F88 5 1026854 02B>D8:A0F8O 12 1026859 02B>F25B 115 1026871 02B>F25B0 4 1026986 02B>H@8DB 27 1026990 02B>M;5<5=B?>@O4:0:><?>=>2:840==KE 79 1027017 030 29 1027096 035=B 740 1027125 035=B0 91 1027865 035=B5 13 1027956 035=B:;85=BA:>3>?@8;>65=8O 13 1027969 035=B>< 597 1027982 035=BC 17 1028579 03@530B 201 1028596 03@530B0 42 1028797 03@530B0<8 4 1028839 03@530B0E 11 1028843 03@530B5 5 1028854 03@530B=0O 40 1028859 03@530B=CN 4 1028899 03@530B=K5 60 1028903 03@530B=K9 112 1028963 03@530B=K<8 5 1029075 03@530B=KE 52 1029080 03@530B>2 92 1029132 03@530B>< 9 1029224 03@530B@538AB@0=0:>?;5=8O 42 1029233 03@530BC 4 1029275 03@530BK 57 1029279 03@530BK70?>;=5=K 12 1029336 03@530BK@538AB@0=0:>?;5=8O 23 1029348 03@530F8O 56 1029371 040?B0F88 67 1029427 040?B0F8N 8 1029494 040?B0F8O 82 1029502 040?B5@ 29 1029584 040?B5@0 4 1029613 040?B5@0E 5 1029617 040?B5@5 8 1029622 040?B5@>< 4 1029630 040?B82=0O 4 1029634 040?B82=K9 4 1029638 040?B8@>20= 12 1029642 040?B8@>20==K9 8 1029654 040?B8@>20BL 8 1029662 040?B8@>20BLC75; 25 1029670 040?B8@C5<>3> 10 1029695 040?B8@C5<K9 10 1029705 045:20B=> 4 1029715 045:20B=K9 4 1029719 04<8=8AB@0B82=>5 5 1029723 04<8=8AB@0B82=>9 21 1029728 04<8=8AB@0B82=K5 64 1029749 04<8=8AB@0B82=K9 341 1029813 04<8=8AB@0B82=K< 22 1030154 04<8=8AB@0B82=K<8 99 1030176 04<8=8AB@0B82=KE 142 1030275 04<8=8AB@0B>@ 712 1030417 04<8=8AB@0B>@0 453 1031129 04<8=8AB@0B>@01>=5=B0 18 1031582 04<8=8AB@0B>@0E 5 1031600 04<8=8AB@0B>@5 5 1031605 04<8=8AB@0B>@:;0AB5@0 36 1031610 04<8=8AB@0B>@>2 113 1031646 04<8=8AB@0B>@>< 45 1031759 04<8=8AB@0B>@C 39 1031804 04<8=8AB@0B>@K 12 1031843 04<8=8AB@8@>20=85 545 1031855 04<8=8AB@8@>20=8504<8=8AB@0B>@ 69 1032400 04<8=8AB@8@>20=851;>:8@>2:0 41 1032469 04<8=8AB@8@>20=8540==KE 55 1032510 04<8=8AB@8@>20=85459AB285?@8?@52KH5=88>3@0=8G5=8O?>B@51;5=8O@5AC@A>2 30 1032565 04<8=8AB@8@>20=85480?07>=?>@B>2 35 1032595 04<8=8AB@8@>20=857=0G5=85AG5BG8:0?>B@51;5=8O@5AC@A>2 95 1032630 04<8=8AB@8@>20=858=D>@<0F8>==0O1070 226 1032725 04<8=8AB@8@>20=85:;0AB5@ 317 1032951 04<8=8AB@8@>20=85;8F5=78O 78 1033268 04<8=8AB@8@>20=85<5=5465@:;0AB5@0 47 1033346 04<8=8AB@8@>20=85>3@0=8G5=85?>B@51;5=8O@5AC@A>2 124 1033393 04<8=8AB@8@>20=85?@8>@8B5B2K1>@0?@>F5AA0 20 1033517 04<8=8AB@8@>20=85?@>D8;L157>?0A=>AB8 238 1033537 04<8=8AB@8@>20=85@01>G89?@>F5AA 131 1033775 04<8=8AB@8@>20=85@01>G89A5@25@ 196 1033906 04<8=8AB@8@>20=85@0AH8@5=89:>=D83C@0F88 6 1034102 04<8=8AB@8@>20=85@568<C40;5=8O8=D>@<0F8>==>9107K 26 1034108 04<8=8AB@8@>20=85A50=A 328 1034134 04<8=8AB@8@>20=85A5@25@0 67 1034462 04<8=8AB@8@>20=85A5@28A 62 1034529 04<8=8AB@8@>20=85A>548=5=85 76 1034591 04<8=8AB@8@>20=85A>AB>O=85@01>G53>?@>F5AA0 25 1034667 04<8=8AB@8@>20=85AG5BG8:?>B@51;5=8O@5AC@A>2 148 1034692 04<8=8AB@8@>20=85B8?3@C??8@>2:8AG5BG8:0?>B@51;5=8O@5AC@A>2 20 1034840 04<8=8AB@8@>20=85B8?>B1>@0AG5BG8:0?>B@51;5=8O@5AC@A>2 25 1034860 04<8=8AB@8@>20=85B8?B@51>20=8O=07=0G5=8O 25 1034885 04<8=8AB@8@>20=85B@51>20=85=07=0G5=8O 64 1034910 04<8=8AB@8@>20=85C@>25=L157>?0A=>AB8A>548=5=89 66 1034974 04<8=8AB@8@>20=85E@0=8;8I542>8G=KE40==KE 58 1035040 04<8=8AB@8@>20=8O 219 1035098 04@5A 1387 1035317 04@5A1 6 1036704 04@5A2 6 1036710 04@5A3 6 1036716 04@5A0 1245 1036722 04@5A035=B0 11 1037967 04@5A0<3=>25==KEA>>1I5=89 14 1037978 04@5A0<8 4 1037992 04@5A0=B 4 1037996 04@5A0A5@25@>2<5B>:2@5<5=8 39 1038000 04@5A0B 17 1038039 04@5A0B0 8 1038056 04@5A0B>< 4 1038064 04@5A0BK 5 1038068 04@5A0C254><;5=8O>4>AB02:5 17 1038073 04@5A0C254><;5=8O>?@>GB5=88 17 1038090 04@5A0E 84 1038107 04@5A0F88 208 1038191 04@5A0F8N 9 1038399 04@5A0F8O 236 1038408 04@5A0M;5:B@>==>9?>GBK 14 1038644 04@5A2=5H=53>A5@28A08=B53@0F88 18 1038658 04@5A4>:C<5=B0 10 1038676 04@5A5 29 1038686 04@5A8=D>@<0F88>:>=D83C@0F88 9 1038715 04@5A8=D>@<0F88>?>AB02I8:5 9 1038724 04@5A:0B0;>30>1=>2;5=89 9 1038733 04@5A=89 56 1038742 04@5A=>3> 56 1038798 04@5A=K9 56 1038854 04@5A>2 116 1038910 04@5A>20==K9 10 1039026 04@5A>20=> 10 1039036 04@5A>< 54 1039046 04@5A>B?@028B5;O 10 1039100 04@5A@5AC@A0 33 1039110 04@5AA5@25@0 75 1039143 04@5AA5@25@0imap 9 1039218 04@5AA5@25@0pop3 20 1039227 04@5AA5@25@0smtp 74 1039247 04@5AA5@25@0smtp0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 1039321 04@5AA5@25@0>=;09=?@>25@:8 12 1039357 04@5AA5@28A0>1@01>B:8>H81>: 9 1039369 04@5AA5@28A0>1@01>B:8>H81>:?@870?CA:5 9 1039378 04@5AA5@28A0?@>25@:8@0A:@KB8O?0@>;O 45 1039387 04@5AC 106 1039432 04@5AC20B8 10 1039538 04@5AD09;02;>65=8O 10 1039548 04@5AF5=B@0;8F5=78@>20=8O 10 1039558 04@5AM;5:B@>==>9?>GBK 70 1039568 04@5AM;5:B@>==>9?>GBK01>=5=B0 10 1039638 04@5AM;5:B@>==>9?>GBK4;O0CB5=B8D8:0F88 32 1039648 04@5AM;5:B@>==>9?>GBKF5=B@0;8F5=78@>20=8O 10 1039680 075@109460= 16 1039690 075@109460=A:89 45 1039706 075@109460=A:>3> 14 1039751 078<CB0;L=0O?@>5:F8O08B>D0 9 1039765 078<CB0;L=0O?@>5:F8O203=5@07 9 1039774 078<CB0;L=0O?@>5:F8O28=:5;OB@8?5;O 9 1039783 078<CB0;L=0O?@>5:F8O@02=KE?;>I0459;0<15@B0 13 1039792 078<CB0;L=0O?@>5:F8OE0<5@0 9 1039805 078<CB0;L=0O@02=>C40;5==0O?@>5:F8O 13 1039814 07C@ 11 1039827 0:1 74 1039838 0:20<0@8= 17 1039912 0:20<0@8=>2K9 5 1039929 0:20@5;L=> 5 1039934 0:20@5;L=>A8=89 11 1039939 0:20@5;L=K9 5 1039950 0:20@8C< 58 1039955 0::@548B>20==>3> 7 1040013 0::@548B>20==K9 7 1040020 0:A5;5@0B>@ 197 1040027 0:A5;5@0B>@0 32 1040224 0:A5;5@0B>@5 21 1040256 0:A5;5@0B>@C 4 1040277 0:B820F859 4 1040281 0:B820F88 29 1040285 0:B820F8N 15 1040314 0:B820F8O 56 1040329 0:B825= 49 1040385 0:B82870F88 121 1040434 0:B82870F8N 5 1040555 0:B82870F8O 142 1040560 0:B82878@>20= 10 1040702 0:B82878@>20=0 31 1040712 0:B82878@>20=85 12 1040743 0:B82878@>20=8O 12 1040755 0:B82878@>20==K9 50 1040767 0:B82878@>20BL 206 1040817 0:B82878@>20BL?>C<>;G0=8N 38 1041023 0:B82878@>20BL@5:2878B2D>@<5 13 1041061 0:B82878@>20BLAO 24 1041074 0:B82878@C5<0O 4 1041098 0:B82878@C5<K9 4 1041102 0:B82878@C5B 65 1041106 0:B82878@C5BAO 24 1041171 0:B828@>20= 4 1041195 0:B828@>20==K9 4 1041199 0:B828@>20BL 22 1041203 0:B828@>20BL7040GC 11 1041225 0:B828@>20BL8=B5@0:B82=> 43 1041236 0:B828@C5B 5 1041279 0:B82=0 57 1041284 0:B82=0O 14 1041341 0:B82=0O?>4?8A:0 9 1041355 0:B82=0OA5@8O 14 1041364 0:B82=0OAAK;:0 9 1041378 0:B82=0OB>G:0 14 1041387 0:B82=89 150 1041401 0:B82=> 174 1041551 0:B82=>3> 73 1041725 0:B82=>5 31 1041798 0:B82=>5>:=> 15 1041829 0:B82=>9 67 1041844 0:B82=>< 21 1041911 0:B82=><C 11 1041932 0:B82=>?0AA82=K9 9 1041943 0:B82=>AB8 221 1041952 0:B82=>ABL 496 1042173 0:B82=CN 13 1042669 0:B82=K 10 1042682 0:B82=K5 70 1042692 0:B82=K5?>;L7>20B5;8 27 1042762 0:B82=K9 704 1042789 0:B82=K9>1J5:B 33 1043493 0:B82=K< 40 1043526 0:B82=KE 60 1043566 0:BC0;5= 12 1043626 0:BC0;870F88 9 1043638 0:BC0;870F8N 4 1043647 0:BC0;870F8O 17 1043651 0:BC0;878@>20BL 5 1043668 0:BC0;L=0 14 1043673 0:BC0;L=0O 4 1043687 0:BC0;L=89 22 1043691 0:BC0;L=> 6 1043713 0:BC0;L=>3> 4 1043719 0:BC0;L=>< 30 1043723 0:BC0;L=>AB8 105 1043753 0:BC0;L=>ABL 121 1043858 0:BC0;L=CN 5 1043979 0:BC0;L=K 16 1043984 0:BC0;L=K5 55 1044000 0:BC0;L=K5<5B040==K5 5 1044055 0:BC0;L=K9 165 1044060 0:BC0;L=KE 34 1044225 0:CAB8: 15 1044259 0:CAB8:0 15 1044274 0:CAB8G5A:0O 4 1044289 0:CAB8G5A:89 4 1044293 0:F5=B8@>20=85 5 1044297 0:F5=B8@>20=8O 5 1044302 0;0448= 10 1044307 0;10=8O 12 1044317 0;10=A:89 14 1044329 0;351@0 5 1044343 0;351@C 5 1044348 0;3>@8B< 641 1044353 0;3>@8B<0 107 1044994 0;3>@8B<0<8 22 1045101 0;3>@8B<0E 4 1045123 0;3>@8B<5 14 1045127 0;3>@8B<>2 26 1045141 0;3>@8B<>< 81 1045167 0;3>@8B<>B:@KB>3>:;NG0 9 1045248 0;3>@8B<?>4?8A8 66 1045257 0;3>@8B<?>4?8A8B>:5=04>ABC?0 80 1045323 0;3>@8B<A60B8O40==KE 6 1045403 0;3>@8B<C 64 1045409 0;3>@8B<E5H8@>20=8O 41 1045473 0;3>@8B<EMH8@>20=8O 5 1045514 0;3>@8B<H8D@>20=8O 27 1045519 0;3>@8B<K 34 1045546 0;3>@8B<K?>4?8A8 9 1045580 0;3>@8B<KE5H8@>20=8O 9 1045589 0;3>@8B<KH8D@>20=8O 9 1045598 0;68@ 12 1045607 0;80A 89 1045619 0;80A>A< 4 1045708 0;;0 183 1045712 0;D028B 123 1045895 0;D028B0 72 1046018 0;D028B:>40?>4B25@645=8O 9 1046090 0;D028B:>40?>4B25@645=8O0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 1046099 0;D028B=> 13 1046135 0;D028B=>< 10 1046148 0;D028B=K9 10 1046158 0;D028B>2 9 1046168 0;D028BC 45 1046177 0;K9 10 1046222 0;LB5@=0B82 4 1046232 0;LB5@=0B820 23 1046236 0;LB5@=0B82=>9 4 1046259 0;LB5@=0B82=K5 12 1046263 0;LB5@=0B82=K9 57 1046275 0;LB5@=0B82=K9B5:AB 27 1046332 0;LB5@=0B82=K9F25BD>=0?>;O 11 1046359 0;LB5@=0B82=KE 25 1046370 0;LB5@=0B82>9 4 1046395 0;LB5@=0B82K 6 1046399 0;LD0 7 1046405 0<07>=0 15 1046412 0<5@8:0 14 1046427 0<5@8:0=A:85 12 1046441 0<5@8:0=A:89 12 1046453 0<5@8:8 14 1046465 0<>@B870F8O>A=>2=KEA@54AB2 5 1046479 0<?5@A0=4 9 1046484 0<?5@A0=40 9 1046493 0<E0@A:89 14 1046502 0=0;87 640 1046516 0=0;870 376 1047156 0=0;870B>@ 16 1047532 0=0;870B>@0 4 1047548 0=0;870B>@>< 4 1047552 0=0;8740==KE 52 1047556 0=0;8740==KE45@52>@5H5=89 13 1047608 0=0;8740==KE:;0AB5@870F8O 13 1047621 0=0;8740==KE>1I0OAB0B8AB8:0 13 1047634 0=0;8740==KE?>8A:0AA>F80F89 13 1047647 0=0;8740==KE?>8A:?>A;54>20B5;L=>AB59 13 1047660 0=0;875 12 1047673 0=0;878@>20BL 16 1047685 0=0;878@>20BLAO 65 1047701 0=0;878@C5<>3> 10 1047766 0=0;878@C5<K5 4 1047776 0=0;878@C5<K9 18 1047780 0=0;878@C5BAO 20 1047798 0=0;878@CNBAO 45 1047818 0=0;8B8: 109 1047863 0=0;8B8:0 109 1047972 0=0;8B8:8 109 1048081 0=0;8B8G5A:89 5 1048190 0=0;8B8G5A:>3> 5 1048195 0=0;>3 42 1048200 0=0;>30<8 5 1048242 0=0;>388 4 1048247 0=0;>38G5= 104 1048251 0=0;>38G=0 9 1048355 0=0;>38G=0O 5 1048364 0=0;>38G=> 1356 1048369 0=0;>38G=>3> 22 1049725 0=0;>38G=>5 45 1049747 0=0;>38G=>9 4 1049792 0=0;>38G=>< 37 1049796 0=0;>38G=CN 10 1049833 0=0;>38G=K 11 1049843 0=0;>38G=K5 20 1049854 0=0;>38G=K9 1740 1049874 0=0;>38G=K< 20 1051614 0=0;>38G=K<8 22 1051634 0=0;>38G=KE 69 1051656 0=0;>38O 4 1051725 0=0;>3>2 3 1051729 0=0;>3>< 17 1051732 0=3; 4 1051749 0=3;89A:85 7 1051753 0=3;89A:89 174 1051760 0=3;89A:>3> 49 1051934 0=3;89A:>5 12 1051983 0=3;89A:>< 9 1051995 0=3;>O7KG=>9 6 1052004 0=3;>O7KG=K5 6 1052010 0=3;>O7KG=K9 12 1052016 0=48 43 1052028 0=4@>84 423 1052071 0=4K 43 1052494 0=8<0F859 4 1052537 0=8<0F88 16 1052541 0=8<0F8N 8 1052557 0=8<0F8O 41 1052565 0=8<0F8O4803@0<< 6 1052606 0=8<0F8O4803@0<<K 28 1052612 0=8<8@>20==K9 5 1052640 0=8<8@>20BL 5 1052645 0==>B0F859 18 1052650 0==>B0F88 34 1052668 0==>B0F89 15 1052702 0==>B0F8N 10 1052717 0==>B0F8O 484 1052727 0==>B0F8Oxs 1005 1053211 0==>B0F8O20@80=B0 16 1054216 0==>B0F8O<>45;8A>45@68<>3> 16 1054232 0==>B0F8O=0A;54>20=8O 16 1054248 0==C;8@>20=0 8 1054264 0==C;8@>20==K9 8 1054272 0=>=8<=>5 20 1054280 0=>=8<=>5>?@545;5=85B8?0 22 1054300 0=>=8<=K9 20 1054322 0=B5F545=B 9 1054342 0=B8: 5 1054351 0=B8:15;K9 11 1054356 0=B8G=K9 23 1054367 0> 13 1054390 0?0G 10 1054403 0?0G0 10 1054413 0?5;LA8= 10 1054423 0?;5B 59 1054433 0?;5B0 40 1054492 0?;5B>2 4 1054532 0?;5B>< 8 1054536 0?;5BK 13 1054544 0??0@0B=0O 48 1054557 0??0@0B=>3> 10 1054605 0??0@0B=>9 28 1054615 0??0@0B=CN 10 1054643 0??0@0B=K9 54 1054653 0??;5B 4 1054707 0??@>:A8<0F88 16 1054711 0??@>:A8<0F8O 36 1054727 0?@5;5 4 1054763 0?@5;L 4 1054767 0@ 29 1054771 0@01A:85 12 1054800 0@01A:89 52 1054812 0@028O 12 1054864 0@35=B8=0 12 1054876 0@3C<5=B 1385 1054888 0@3C<5=B0 1351 1056273 0@3C<5=B>2 5 1057624 0@3C<5=B>< 8 1057629 0@3C<5=BK 5 1057637 0@8D<5B8G5A:85 12 1057642 0@8D<5B8G5A:89 47 1057654 0@8D<5B8G5A:8<8 5 1057701 0@8D<5B8G5A:8E 15 1057706 0@8D<5B8G5A:>3> 5 1057721 0@8D<5B8G5A:>5 9 1057726 0@8D<5B8G5A:CN 5 1057735 0@::>A8=CA 11 1057740 0@::>A8=CA0 5 1057751 0@:A8=CA 11 1057756 0@:A8=CA0 5 1057767 0@:B0=35=A 11 1057772 0@:B0=35=A0 5 1057783 0@:B8:0 23 1057788 0@< 53 1057811 0@<5=8O 14 1057864 0@<O=A:89 20 1057878 0@B8:C; 14 1057898 0@E82 570 1057912 0@E820 339 1058482 0@E820B>@ 13 1058821 0@E820B>@K 9 1058834 0@E820F88 16 1058843 0@E820F8O 16 1058859 0@E825 81 1058875 0@E82=0O<5B:0 6 1058956 0@E82=>9 17 1058962 0@E82=CN 10 1058979 0@E82=K5 9 1058989 0@E82=K5<5B:82@5<5=8 16 1058998 0@E82=K9 28 1059014 0@E82>2 23 1059042 0@E82>< 27 1059065 0@E82C 55 1059092 0@E82K 5 1059147 0@E8B5:BC@0 64 1059152 0@E8B5:BC@>9 60 1059216 0@E8B5:BC@K 4 1059276 0A8=E 73 1059280 0A8=E@>==0O 951 1059353 0A8=E@>==89 951 1060304 0A8=E@>==> 52 1061255 0A8=E@>==>9 18 1061307 0A8=E@>==>< 12 1061325 0A8=E@>==>ABL 6 1061337 0A8=E@>==>ABLN 4 1061343 0A8=E@>==K5 10 1061347 0A8=E@>==K9 1063 1061357 0A8=E@>==K< 30 1062420 0A8=E@>==KE 32 1062450 0AA0<A:89 14 1062482 0AA>F80B82=>9 10 1062496 0AA>F80B82=K9 14 1062506 0AA>F80B82=KE 4 1062520 0AA>F80F88 20 1062524 0AA>F80F89 45 1062544 0AA>F80F8O 65 1062589 0AA>F88@>20==0O3@C??0 24 1062654 0AA>F88@>20==>3> 56 1062678 0AA>F88@>20==>5 5 1062734 0AA>F88@>20==>9 6 1062739 0AA>F88@>20==K9 67 1062745 0AD0;LB 10 1062812 0AO 24 1062822 0B><0@=0O 10 1062846 0B><0@=K9 20 1062856 0B@81CB 5718 1062876 0B@81CBdom 883 1068594 0B@81CBhtml 1959 1069477 0B@81CB0 2070 1071436 0B@81CB0< 12 1073506 0B@81CB5 8 1073518 0B@81CB>2 985 1073526 0B@81CB>< 475 1074511 0B@81CBC 232 1074986 0B@81CBK 836 1075218 0C48> 58 1076054 0C48>70?8A59 4 1076112 0C48>70?8A8 40 1076116 0C48>70?8AL 60 1076156 0C48>:0=0; 4 1076216 0C48>:0=0;>2 4 1076220 0C48>?;55@0 5 1076224 0C48>CAB@>9AB2> 5 1076229 0C48>D09; 36 1076234 0C48>D09;0 8 1076270 0C48>D09;>2 8 1076278 0C48>D09;C 10 1076286 0C48>D09;K 4 1076296 0C48B 93 1076300 0C48B0 93 1076393 0CB 8 1076486 0CB5=8D8:0F88 4 1076494 0CB5=B8D8:0F8 4 1076498 0CB5=B8D8:0F859 5 1076502 0CB5=B8D8:0F88 889 1076507 0CB5=B8D8:0F8N 118 1077396 0CB5=B8D8:0F8O 1145 1077514 0CB5=B8D8:0F8Oopenid 66 1078659 0CB5=B8D8:0F8Oopenidconnect 66 1078725 0CB5=B8D8:0F8Opop3 14 1078791 0CB5=B8D8:0F8Oqr:>4>< 78 1078805 0CB5=B8D8:0F8Osmtp 18 1078883 0CB5=B8D8:0F8O>A 114 1078901 0CB5=B8D8:0F8O?>B>:5=C 33 1079015 0CB5=B8D8:0F8O?>B>:5=C?@8>B?@02:5:>40?>4B25@645=8O0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 1079048 0CB5=B8D8:0F8O?>B>:5=C?@8>B?@02:5:>40?>4B25@645=8O2>AAB0=>2;5=8O?0@>;O 36 1079084 0CB5=B8D8:0F8OAB0=40@B=0O 120 1079120 0CB5=B8D8:0F8OB>:5=><4>ABC?0 66 1079240 0CB5=B8D8:0F8OG5@57M;5:B@>==CN?>GBC 18 1079306 0CB5=B8D8F8@>20;AO 8 1079324 0CB5=B8D8F8@>20= 25 1079332 0CB5=B8D8F8@>20==>3> 27 1079357 0CB5=B8D8F8@>20==><C 6 1079384 0CB5=B8D8F8@>20==K9 68 1079390 0CB5=B8D8F8@>20==K< 10 1079458 0CB5=B8D8F8@>20BLAO 8 1079468 0CB5=B8D:0F8O 36 1079476 0CB5=BD8:0F8N 4 1079512 0D0= 16 1079516 0D30=8AB0= 16 1079532 0D@8:0 16 1079548 0D@8:00=A 16 1079564 1 14 1079580 1020@8O 48 1079594 107 7055 1079642 1070 7333 1086697 107040==KE 32 1094030 1070:>40 18 1094062 1070:>=B@035=B>2 5 1094080 1070< 44 1094085 1070<8 42 1094129 1070E 112 1094171 1075 1716 1094283 1078@>20BLAO 50 1095999 1078@C5BAO 50 1096049 107>20O 13 1096099 107>20O=02830F8>==0OAAK;:0 15 1096112 107>289 240 1096127 107>2>3> 190 1096367 107>2>5 21 1096557 107>2>57=0G5=85 53 1096578 107>2>587<5@5=85 9 1096631 107>2>9 5 1096640 107>2>< 6 1096645 107>2><C 50 1096651 107>2K5 17 1096701 107>2K5284K@0AG5B0 198 1096718 107>2K5284K@0AG5B0AB@>:0 84 1096916 107>2K540==K5A2>4 7 1097000 107>2K9 567 1097007 107>2K9uri 354 1097574 107>2K9url 9 1097928 107>2K9:0B0;>3 18 1097937 107>2K9?5@8>4 40 1097955 107>2K9?5@8>4:>=5F 73 1097995 107>2K9?5@8>4=0G0;> 71 1098068 107>2K9?CBL 10 1098139 107>2K9B8? 42 1098149 107>2K9F25BD83C@K 9 1098191 107>2K9O7K: 18 1098200 107>2K< 120 1098218 107>2KE 103 1098338 107>9 432 1098441 107C 991 1098873 107K 4050 1099864 107O 1716 1103914 109B 1246 1105630 109B0 33 1106876 109B0< 8 1106909 109B0<8 16 1106917 109B0E 425 1106933 109B>2 540 1107358 109B>2K9 4 1107898 109BK 107 1107902 10:5B0 8 1108009 10:5B>< 8 1108017 10;0=A 32 1108025 10;0=A5 28 1108057 10;0=A>289 30 1108085 10;0=A>2>3> 30 1108115 10;0=A>2>5 5 1108145 10;0=A>2K9 111 1108150 10;0=A>2KE 58 1108261 10;; 4 1108319 10;;0E 4 1108323 10=: 409 1108327 10=:0 395 1108736 10=:0<8 6 1109131 10=:8 394 1109137 10=:>2A:852K?8A:8 5 1109531 10=:>2A:85AG5B0 5 1109536 10=:>2A:89 9 1109541 10=:>2A:89AG5B 18 1109550 10=:>2A:8E 5 1109568 10=:>2A:>9 4 1109573 10=:>< 6 1109577 10==5@ 64 1109583 10==5@0 38 1109647 10=O 8 1109685 10@ 189 1109693 10@8= 189 1109882 10A 115 1110071 10A:A:89 14 1110186 10E@59= 12 1110200 14 14 1110212 153CI0OAB@>:0 16 1110226 153CI59 20 1110242 153CI89 20 1110262 15652K9 12 1110282 157 1612 1110294 1570CB5=B8D8:0F88 8 1111906 157459AB285 25 1111914 157459AB28O 25 1111939 1574>?>;=5=8O 18 1111964 1577=0:>2>5 9 1111982 1577=0:>2K9 9 1111991 157:>48@>20=8O 9 1112000 157=0:>?;5=8O 9 1112009 157>1@01>B:8 9 1112018 157>3@0=8G5=8O 35 1112027 157>?0A=>3> 264 1112062 157>?0A=>5 6 1112326 157>?0A=>5E@0=8;8I5 13 1112332 157>?0A=>9 4 1112345 157>?0A=>< 152 1112349 157>?0A=><C 10 1112501 157>?0A=>AB8 638 1112511 157>?0A=>ABL 638 1113149 157>?0A=K9 1313 1113787 157>?0A=K9@0AE>4?0<OB870>48=2K7>2 11 1115100 157>?0A=K9@0AE>4?0<OB8@01>G8E?@>F5AA>2 11 1115111 157>?0A=K9@568< 178 1115122 157>?0A=K9@568<@0745;5=8O40==KE 17 1115300 157>?0A=K< 70 1115317 157>D>@<;5=8O 20 1115387 157?5@5E>40 9 1115407 157@0<:8 13 1115416 157A<5I5=8O 20 1115429 157AB0BCA0 9 1115449 157C7>@0 9 1115458 157CA;>2=0O 5 1115467 157CA;>2=> 12 1115472 157CA;>2=>5 6 1115484 157CA;>2=K9 26 1115490 15; 18 1115516 15;0@CAL 12 1115534 15;0O 5 1115546 15;87 12 1115551 15;>9 9 1115563 15;>< 18 1115572 15;>@CAA:89 32 1115590 15;>@CAA:>3> 13 1115622 15;>A=56=K9 12 1115635 15;K5 7 1115647 15;K9 81 1115654 15;K9D>=4>:C<5=B0 13 1115735 15;K< 7 1115748 15;L38O 22 1115755 15=30;LA:89 14 1115777 15@5BAO 51 1115791 15@CBAO 18 1115842 15A 52 1115860 15A:>=5G=><C 11 1115912 15A:>=5G=K9 11 1115923 15A?5@51>9=>9 6 1115934 15A?5@51>9=K9 6 1115940 15A?>:>8BL 5 1115946 18 8 1115951 181;8>B5: 21 1115959 181;8>B5:0 149 1115980 181;8>B5:0:0@B8=>: 1863 1116129 181;8>B5:0< 15 1117992 181;8>B5:0<0:5B>2>D>@<;5=8O:><?>=>2:840==KE 120 1118007 181;8>B5:0<C7K:8 9 1118127 181;8>B5:0AB8;59 51 1118136 181;8>B5:0E 12 1118187 181;8>B5:5 52 1118199 181;8>B5:8 51 1118251 181;8>B5:8:0@B8=>:82845> 9 1118302 181;8>B5:C 14 1118311 183 11 1118325 187=5A 2248 1118336 187=5A?@>F5AcAAK;:0 4 1120584 187=5A?@>F5AA 754 1120588 187=5A?@>F5AA1 6 1121342 187=5A?@>F5AA2K1>@:0 107 1121348 187=5A?@>F5AA<5=5465@ 187 1121455 187=5A?@>F5AA>1J5:B 428 1121642 187=5A?@>F5AAA?8A>: 40 1122070 187=5A?@>F5AAAAK;:0 321 1122110 187=5A?@>F5AAB01;8G=0OG0ABL 17 1122431 187=5A?@>F5AAK 103 1122448 187=5A?@>F5AAK<5=5465@ 37 1122551 18=0@=0O 10 1122588 18=0@=>3> 4 1122598 18=0@=>< 8 1122602 18=0@=K5 12 1122610 18=0@=K9 26 1122622 18=0@=K<8 5 1122648 18><5B@88 4 1122653 18><5B@8G5A:0O 4 1122657 18><5B@8G5A:0O8;822>4?0@>;O 21 1122661 18><5B@8G5A:89 21 1122682 18><5B@8G5A:8< 8 1122703 18><5B@8G5A:>9 9 1122711 18><5B@8O 24 1122720 18@6520O 23 1122744 18@6520OA25G0 13 1122767 18@652>9 41 1122780 18@652K5 4 1122821 18@652KE 4 1122825 18@N70 10 1122829 18@N7>2K9 27 1122839 18B 106 1122866 18B0 94 1122972 18B0E 8 1123066 18B89 34 1123074 18B=0?8:A5;1 9 1123108 18B=0?8:A5;24 9 1123117 18B=0?8:A5;32 9 1123126 18B=0?8:A5;4 9 1123135 18B=0?8:A5;8 9 1123144 18B=0O 44 1123153 18B=>3> 24 1123197 18B=>5 60 1123221 18B=>9 24 1123281 18B=K9 180 1123305 18B=K< 8 1123485 18B>2 12 1123493 18B>20O 11 1123505 18B>2K9 11 1123516 18BK 5 1123527 18BK9 86 1123532 1; 8 1123618 1;0=: 14 1123626 1;54=> 35 1123640 1;54=>18@N7>2K9 11 1123675 1;54=>75;5=K9 11 1123686 1;54=>7>;>B8ABK9 11 1123697 1;54=>:@0A=>D8>;5B>2K9 11 1123708 1;54=>;8;>2K9 11 1123719 1;54=><8=40;L=K9 11 1123730 1;54=>A8@5=52K9 11 1123741 1;54=K9 35 1123752 1;8609H0O 4 1123787 1;8609H53> 21 1123791 1;8609H55 4 1123812 1;8609H5<C 8 1123816 1;8609H89 37 1123824 1;865 74 1123861 1;86=59 4 1123935 1;86=89 4 1123939 1;86=OOA2O7L 9 1123943 1;87:85 4 1123952 1;87:89 86 1123956 1;87:8E 4 1124042 1;87:>5 8 1124046 1;>3 9 1124054 1;>30 4 1124063 1;>: 98 1124067 1;>:0 65 1124165 1;>:0E 3 1124230 1;>:8 3 1124233 1;>:8@>20==K9 5 1124236 1;>:8@>20=> 5 1124241 1;>:8@>20BL 50 1124246 1;>:8@>20BL25AL8=B5@D59A 9 1124296 1;>:8@>20BL4;O87<5=5=8O 22 1124305 1;>:8@>20BL>:=>2;045;LF0 15 1124327 1;>:8@>20BLAO 82 1124342 1;>:8@>2:0 1144 1124424 1;>:8@>2:00CB5=B8D8:0F88 9 1125568 1;>:8@>2:00CB5=B8D8:0F88?>;L7>20B5;O8=D>@<0F8>==>9107K 34 1125577 1;>:8@>2:040==KE 56 1125611 1;>:8@>2:04>:C<5=B0 9 1125667 1;>:8@>2:0<8 25 1125676 1;>:8@>2:0?>C<>;G0=8N 16 1125701 1;>:8@>2:0@53;0<5=B=KE7040=89 47 1125717 1;>:8@>2:0A50=A>2 51 1125764 1;>:8@>2:0E 49 1125815 1;>:8@>2:5 86 1125864 1;>:8@>2:8 594 1125950 1;>:8@>2:>9 130 1126544 1;>:8@>2:C 121 1126674 1;>:8@>2>: 137 1126795 1;>:8@C5<>3> 5 1126932 1;>:8@C5<>5 9 1126937 1;>:8@C5<>57=0G5=85 7 1126946 1;>:8@C5<K9 19 1126953 1;>:8@C5<KE 5 1126972 1;>:8@C5B 39 1126977 1;>:8@C5BAO 67 1127016 1;>:8@CNBAO 15 1127083 1;>:8@CNI0O 5 1127098 1;>:8@CNI53> 21 1127103 1;>:8@CNI59 4 1127124 1;>:8@CNI85 6 1127128 1;>:8@CNI89 38 1127134 1;>:8@CNI8E 12 1127172 1;>:8@CO 7 1127184 1;>:>2 8 1127191 1;>G=89 12 1127199 1;>G=>3> 12 1127211 1;>G=>5 4 1127223 1;>G=K9 16 1127227 1>4 97 1127243 1>;30@8O 12 1127340 1>;30@A:89 37 1127352 1>;30@A:>3> 14 1127389 1>;55 614 1127403 1>;57=8 4 1128017 1>;57=L 4 1128021 1>;828O 12 1128025 1>;LH5 540 1128037 1>;LH53> 5 1128577 1>;LH55 60 1128582 1>;LH58;8@02=> 34 1128642 1>;LH59 34 1128676 1>;LH5<C 6 1128710 1>;LH85 61 1128716 1>;LH89 744 1128777 1>;LH8< 16 1129521 1>;LH8<8 13 1129537 1>;LH8=AB20 17 1129550 1>;LH8=AB25 27 1129567 1>;LH8=AB2> 49 1129594 1>;LH8E 4 1129643 1>;LH>3> 42 1129647 1>;LH>5 27 1129689 1>;LH>9 13 1129716 1>;LH>9:204@0B 9 1129729 1>;LH>9:@C3 9 1129738 1>;LH>9?C=:B8@ 9 1129747 1>;LH>9B@5C3>;L=8: 9 1129756 1>;LH>9H03 20 1129765 1>;LH>< 12 1129785 1>;LHCN 39 1129797 1>@4>2K9 5 1129836 1>@8A 6 1129841 1>A=8O 16 1129847 1>B 439 1129863 1>B0 76 1130302 1>B0E 5 1130378 1>B>2 17 1130383 1>B>< 28 1130400 1>BA20=0 12 1130428 1>BA8AB5<K2708<>459AB28O 56 1130440 1>BK 20 1130496 1>BKA8AB5<K2708<>459AB28O 6 1130516 1?<5B040==K5 7 1130522 1@078;8O 12 1130529 1@0B 10 1130541 1@0BL 10 1130551 1@0BLAO 25 1130561 1@0C75@ 373 1130586 1@0C75@0 155 1130959 1@0C75@0E 49 1131114 1@0C75@5 126 1131163 1@0C75@>2 23 1131289 1@0C= 12 1131312 1@8: 6 1131324 1@8:0 6 1131330 1@>=70 13 1131336 1@>A05BAO 6 1131349 1@>A0BLAO 6 1131355 1@C=59 12 1131361 1@N:8 43 1131373 1C40 5 1131416 1C45< 20 1131421 1C45=>2A:89 63 1131441 1C45B 16700 1131504 1C4B> 25 1148204 1C4C 5 1148229 1C4CB 4119 1148234 1C4CI59 4 1152353 1C4CI89 13 1152357 1C4CI8E 9 1152370 1C:2 63 1152379 1C:20 809 1152442 1C:20<8 5 1153251 1C:25==K5 4 1153256 1C:25==K9 4 1153260 1C:2>9 5 1153264 1C:2K 729 1153269 1C:<>; 14 1153998 1C;02:0 5 1154012 1C;02:5 5 1154017 1C;52 15697 1154022 1C;520 8 1169719 1C;52> 15669 1169727 1C;52>3> 20 1185396 1C;52>7=0G5=85 9 1185416 1C;52C 5 1185425 1C;52K 8 1185430 1C;52K< 4 1185438 1C;52KE 6 1185442 1C;L20@ 4 1185448 1C<030 27 1185452 1C<035 5 1185479 1C<038 20 1185484 1C<06=K9 5 1185504 1C<06=KE 5 1185509 1CD5@ 875 1185514 1CD5@0 316 1186389 1CD5@0<8 5 1186705 1CD5@0E 4 1186710 1CD5@42>8G=KE40==KE 413 1186714 1CD5@5 163 1187127 1CD5@870F88 5 1187290 1CD5@870F8N 5 1187295 1CD5@870F8O 6 1187300 1CD5@878@>20==K<8 4 1187306 1CD5@>1>@>B>2 6 1187310 1CD5@>2 5 1187316 1CD5@>< 74 1187321 1CD5@C 24 1187395 1CD5@K 53 1187419 1CE30;B5@ 32 1187472 1CE30;B5@88 1372 1187504 1CE30;B5@8O 1372 1188876 1CE30;B5@A:89 67 1190248 1CE30;B5@A:8< 4 1190315 1CE30;B5@A:>3> 51 1190319 1K 242 1190370 1K205B 10 1190612 1K20BL 16 1190622 1K20NB 6 1190638 1K; 2403 1190644 1K;0 939 1193047 1K;8 460 1193986 1K;> 1753 1194446 1K;L 460 1196199 1KAB@0O 5 1196659 1KAB@55 26 1196664 1KAB@> 82 1196690 1KAB@>3> 163 1196772 1KAB@>5 14 1196935 1KAB@>587<5=5=85 14 1196949 1KAB@>9 4 1196963 1KAB@>< 137 1196967 1KAB@>@540:B8@>20BLM;5<5=B 27 1197104 1KAB@K9 480 1197131 1KAB@K92K1>@ 318 1197611 1KAB@K94>ABC? 27 1197929 1KAB@KE 16 1197956 1KB 8 1197972 1KB>20O 19 1197980 1KB>2>9 19 1197999 1KBL 9645 1198018 1N465B=0O7040G0 9 1207663 1N465B=0O>?5@0F8O 5 1207672 1V: 117 1207677 2 142114 1207794 2030 189 1349908 2038 189 1350097 2065= 5 1350286 206=> 448 1350291 206=>5 68 1350739 206=>AB8 53 1350807 206=>ABL 173 1350860 206=>ABL8=B5@=5B?>GB>2>3>A>>1I5=8O 34 1351033 206=>ABL?@8>B>1@065=88 115 1351067 206=>ABL?@>1;5<K?@8<5=5=8O@0AH8@5=8O:>=D83C@0F88 24 1351182 206=>ABLN 12 1351206 206=K9 524 1351218 206=K< 4 1351742 206=KE 5 1351746 20; 4 1351751 20;840F8N 4 1351755 20;84=>9 5 1351759 20;84=>ABL 8 1351764 20;84=K9 4 1351772 20;84=K< 4 1351776 20;;89A:89 14 1351780 20;C9 1322 1351794 20;NB 10 1353116 20;NB0 573 1353126 20;NB04B 6 1353699 20;NB0:B 6 1353705 20;NB5 10 1353711 20;NB=0OAC<<04B 6 1353721 20;NB=0OAC<<0:B 7 1353727 20;NBK 481 1353734 20< 11 1354215 20=BCA 33 1354226 20@ 13 1354259 20@80=B 5803 1354272 20@80=Bxdto 20 1360075 20@80=Bxpathxs 20 1360095 20@80=B0 5516 1360115 20@80=B0< 5 1365631 20@80=B0<8 46 1365636 20@80=B0E 26 1365682 20@80=B157A>3;0A>20=8O 5 1365708 20@80=B2AB@>5==>3>O7K:0 37 1365713 20@80=B2K@02=820=8OM;5<5=B>28703>;>2:>2 47 1365750 20@80=B3@0=8FK8=B5@20;0 55 1365797 20@80=B3@0=8FK?5@8>40 12 1365852 20@80=B48@5:B>@0 5 1365864 20@80=B5 312 1365869 20@80=B70?8A840BK 15 1366181 20@80=B70?8A840BKjson 29 1366196 20@80=B87<5=5=8O3@0=8F 5 1366225 20@80=B87<5=5=8O3@0=8F?5@5B0A:820=8O2=CB@8?;0=8@>2I8:0 24 1366230 20@80=B8=B5@D59A0:;85=BA:>3>?@8;>65=8O 34 1366254 20@80=B8A?>;L7>20=88107K40==KE:>?88 29 1366288 20@80=B8A?>;L7>20=8O 9 1366317 20@80=B8A?>;L7>20=8O3@C??8@>2:8 16 1366326 20@80=B8A?>;L7>20=8O3@C??8@>2:8:><?>=>2:840==KE 31 1366342 20@80=B8A?>;L7>20=8O@0A?>;>65=8O@01>BKA@5GLN 35 1366373 20@80=B<0AHB010D>@<:;85=BA:>3>?@8;>65=8O 30 1366408 20@80=B<>48D8F8@>20= 9 1366438 20@80=B=0AB@>5::><?>=>2:840==KE 59 1366447 20@80=B=0AB@>9:8 36 1366506 20@80=B=0AB@>9:8?5@8>40 35 1366542 20@80=B=0G0;0 36 1366577 20@80=B=K9 6 1366613 20@80=B>1@01>B:8 9 1366619 20@80=B>1@01>B:840==KE70?@>A0?>45;8BLAO 19 1366628 20@80=B>2 357 1366647 20@80=B>:>=G0=8O 36 1367004 20@80=B>< 37 1367040 20@80=B>A=>2=>3>H@8DB0:;85=BA:>3>?@8;>65=8O 19 1367077 20@80=B>B>1@065=8OA>>1I5=8O 14 1367096 20@80=B>B>1@065=8OA>>1I5=8O>1>H81:5 34 1367110 20@80=B>BG5B0 9 1367144 20@80=B?5@8>40 90 1367153 20@80=B?>;>65=8O>:=0 25 1367243 20@80=B?>;L7>20B5;LA:>3>?>;O2K1>@:><?>=>2:840==KE 80 1367268 20@80=B?@8:@5?;5=8O>:=0 30 1367348 20@80=B?@8;>65=8O 10 1367378 20@80=B?@>25@:8>B>1@065=8O=>2>9AB@>:8 110 1367388 20@80=B?@>AB>3>B8?0xs 25 1367498 20@80=BA>1KB8O 5 1367523 20@80=BA>1KB8O72>=:0A@54AB2B5;5D>=88 36 1367528 20@80=BA>AB>O=8O>:=0 30 1367564 20@80=BA?>A>10>B>1@065=8O>:=0 25 1367594 20@80=BAB0=40@B=>3>?5@8>40 260 1367619 20@80=BAB0=40@B=>940BK=0G0;0 123 1367879 20@80=BAB0=40@B=>9=02830F8>==>9AAK;:8D>@<K 55 1368002 20@80=BB>G:8<0@H@CB0187=5A?@>F5AA0 36 1368057 20@80=BC 89 1368093 20@80=BC?@02;5=8O2KA>B>9 30 1368182 20@80=BC?@02;5=8O2KA>B>9B01;8FK 29 1368212 20@80=BC?@02;5=8O2KA>B>9M;5<5=B0 24 1368241 20@80=BE@0=5=8O40==KE40B00:A5;5@0B>@0 31 1368265 20@80=BK 2216 1368296 20@80=BK=0AB@>5: 16 1370512 20@80=BK=0AB@>5::><?>=>2:840==KE 69 1370528 20@80=BK?>;L7>20B5;LA:>3>?>;O2K1>@:><?>=>2:840==KE 52 1370597 20@80=BKB>G:8<0@H@CB0187=5A?@>F5AA0 35 1370649 20@80=BKM;5<5=B03@0D8G5A:>9AE5<K2K1>@20@80=B0 29 1370684 20@80=BM;5<5=B03@0D8G5A:>9AE5<K2K1>@20@80=B0 53 1370713 20@8O 6 1370766 20A8;L:>2K9 12 1370772 20H 10 1370784 20H5 6 1370794 20H5< 4 1370800 20H8< 5 1370804 22 12 1370809 22545=0 35 1370821 22545=85 4 1370856 22545=8O 4 1370860 22545==0O 43 1370864 22545==>3> 44 1370907 22545==>5 57 1370951 22545==>9 12 1371008 22545==><C 50 1371020 22545==K5 6 1371070 22545==K9 275 1371076 22545==K< 5 1371351 22545==KE 13 1371356 22545=> 24 1371369 22548B5 59 1371393 225@E 149 1371452 225@EC 18 1371601 225AB8 134 1371619 225AB8html4>:C<5=B0 20 1371753 225AB840BC 23 1371773 225AB840BC0A8=E 17 1371796 225AB87=0G5=85 19 1371813 225AB87=0G5=850A8=E 17 1371832 225AB8AB@>:C 19 1371849 225AB8AB@>:C0A8=E 17 1371868 225AB8B5:AB 30 1371885 225AB8G8A;> 25 1371915 225AB8G8A;>0A8=E 17 1371940 225AL 5152 1371957 22845:>40 105 1377109 22845=08<5=>20=8O 124 1377214 22845=><5@0 19 1377338 2284C 5 1377357 22>4 3239 1377362 22>40 2513 1380601 22>44>ABC?5= 23 1383114 22>45 764 1383137 22>48<0O 15 1383901 22>48<>3> 36 1383916 22>48<>9 21 1383952 22>48<K5 9 1383973 22>48<K9 130 1383982 22>48<KE 37 1384112 22>48B8 35 1384149 22>48B8AO 32 1384184 22>48BAO 24 1384216 22>48BAO=0>A=>20=88 81 1384240 22>48BL 47 1384321 22>48BLAO 61 1384368 22>4=0>A=>20=88 11 1384429 22>4>< 14 1384440 22>4?>AB@>:5 169 1384454 22>4OBAO 5 1384623 22K45;5==>9>1;0AB8 9 1384628 22V4 14 1384637 23@0=8F0 39 1384651 2402;5==0O 240 1384690 2402;5==K9 240 1384930 2480;>35 54 1385170 24>;L 15 1385224 24>?>;=8B5;L=><?>4<5=N 9 1385239 251 27497 1385248 25104@5A0 14 1412745 251:;85=B 76 1412759 2545=85 15 1412835 2545=8O 15 1412850 2545B 3 1412865 2545BAO 46 1412868 254CI0O 10 1412914 254CI0O7040G0 44 1412924 254CI53> 16 1412968 254CI55 23 1412984 254CI85 24 1413007 254CI85284K@0AG5B0 193 1413031 254CI85284K@0AG5B0AB@>:0 84 1413224 254CI89 125 1413308 254CI8< 6 1413433 254CI8E 48 1413439 254CICN 21 1413487 254QBAO 8 1413508 255@ 10 1413516 25745 4 1413526 25: 21 1413530 25:0 14 1413551 25:> 21 1413565 25:>< 12 1413586 25:B>@=89 9 1413598 25:B>@=>3> 9 1413607 25:B>@=K5 4 1413616 25:B>@=K9 30 1413620 25:B>@=KE 21 1413650 25;0AL 6 1413671 25;8:0 5 1413677 25;8:89 10 1413682 25;8:> 5 1413692 25;8:>1@8B0=8O 14 1413697 25;8G8=0 61 1413711 25;8G8=0<8 4 1413772 25;8G8=5 8 1413776 25;8G8=C 23 1413784 25;8G8=K 17 1413807 25=35@A:89 37 1413824 25=35@A:>3> 14 1413861 25=35@A:>5 14 1413875 25=3@8O 12 1413889 25=4>@ 157 1413901 25=5ACM;;0 12 1414058 25@=5B 418 1414070 25@=5BAO 27 1414488 25@=> 4 1414515 25@=>3> 4 1414519 25@=C2 4 1414523 25@=C; 9 1414527 25@=C;0 5 1414536 25@=CB8 72 1414541 25@=CB8AO 10 1414613 25@=CBL 497 1414623 25@=CBLAO 37 1415120 25@=K9 18 1415157 25@=K< 10 1415175 25@>OB=55 5 1415185 25@>OB=>5 7 1415190 25@>OB=>ABL 33 1415197 25@>OB=>ABLN 8 1415230 25@>OB=K5 24 1415238 25@>OB=K9 36 1415262 25@A859 587 1415298 25@A88 158204 1415885 25@A888AB>@8840==KE 6 1574089 25@A89 370 1574095 25@A8>=8@>20=85 10 1574465 25@A8>=8@>20=8O 10 1574475 25@A8N 280 1574485 25@A8O 158987 1574765 25@A8O1 35 1733752 25@A8O2 44 1733787 25@A8O3 9 1733831 25@A8O4 9 1733840 25@A8O5 9 1733849 25@A8O8 799 1733858 25@A8Oxml 50 1734657 25@A8O0:BC0;L=0 10 1734707 25@A8O40==KE 358 1734717 25@A8O<8 45 1735075 25@A8O>A 11 1735120 25@A8O?>;=>B5:AB>2>3>?>8A:0 26 1735131 25@A8O?@8;>65=8O 10 1735157 25@A8OA5@25@0 10 1735167 25@A8OAB0=40@B=>9@5?;8:0F88 5 1735177 25@A8OAB0=40@B=>9@5?;8:0F88:>?89107K40==KE 23 1735182 25@A8OC=8:0;L=>3>845=B8D8:0B>@0 34 1735205 25@A8OE 38 1735239 25@B 6 1735277 25@B8:0;5= 4 1735283 25@B8:0;8 196 1735287 25@B8:0;L 196 1735483 25@B8:0;L=0O 94 1735679 25@B8:0;L=0O?>;>A0?@>:@CB:8 49 1735773 25@B8:0;L=0O?@>:@CB:0 22 1735822 25@B8:0;L=0O?@>:@CB:0?@8A60B88 9 1735844 25@B8:0;L=0O?@>:@CB:0D>@<K 29 1735853 25@B8:0;L=0OB>G=>ABL 9 1735882 25@B8:0;L=89 106 1735891 25@B8:0;L=> 120 1735997 25@B8:0;L=>3> 96 1736117 25@B8:0;L=>5 87 1736213 25@B8:0;L=>5?>;>65=85 362 1736300 25@B8:0;L=>5?>;>65=8523@C??5 54 1736662 25@B8:0;L=>5?>;>65=85:0@B8=:8 20 1736716 25@B8:0;L=>5?>;>65=85?>4G8=5==KE 27 1736736 25@B8:0;L=>5?>;>65=85M;5<5=B0 77 1736763 25@B8:0;L=>5@0A?>;>65=85>1I8E8B>3>2 15 1736840 25@B8:0;L=>9 113 1736855 25@B8:0;L=>< 4 1736968 25@B8:0;L=><C 10 1736972 25@B8:0;L=CN 37 1736982 25@B8:0;L=K5 19 1737019 25@B8:0;L=K5;8=88 29 1737038 25@B8:0;L=K5;8=882B01;8F540==KE 9 1737067 25@B8:0;L=K5<5B:8 9 1737076 25@B8:0;L=K9 611 1737085 25@B8:0;L=K98=B5@20; 27 1737696 25@B8:0;L=K9>BABC? 27 1737723 25@B8:0;L=K9C@>25=L 5 1737750 25@B8:0;L=K9H03A5B:8 9 1737755 25@B8:0;L=K< 8 1737764 25@B8:0;L=KE 17 1737772 25@E 496 1737789 25@E=53> 243 1738285 25@E=55 5 1738528 25@E=59 263 1738533 25@E=5< 68 1738796 25@E=5<C 22 1738864 25@E=85C@>2=825@B8:0;L=> 9 1738886 25@E=89 784 1738895 25@E=89:>;>=B8BC; 16 1739679 25@E=8E 20 1739695 25@E=NN 19 1739715 25@E=OO 64 1739734 25@E=OO3@0=8F0 31 1739798 25@E=V9 64 1739829 25@EC 4 1739893 25@H8=0 20 1739897 25@H8=C 12 1739917 25@H8=K 17 1739929 25A 10 1739946 25A5==5 10 1739956 25A5==575;5=K9 11 1739966 25A8BL 101 1739977 25A=0 14 1740078 25A>2>9 30 1740092 25A>2>9:>MDD8F85=BH8@8=K 25 1740122 25AB8 3 1740147 25AB8AL 75 1740150 25AC 10 1740225 25AL 8686 1740235 25AL45=L 13 1748921 25B:0 25 1748934 25B:0E 5 1748959 25B:5 10 1748964 25B:8 4 1748974 25B>: 8 1748978 25G5@ 6 1748986 2708<=>3> 12 1748992 2708<=>9 15 1749004 2708<=><C 4 1749019 2708<=K9 31 1749023 2708<>459AB285 898 1749054 2708<>459AB288 8 1749952 2708<>459AB28O 881 1749960 2708<>459AB2>20BL 4 1750841 2708<>>B=>H5=85 12 1750845 2708<>>B=>H5=8O 4 1750857 2708<>A2O70==K9 5 1750861 2708<>A2O70==KE 5 1750866 2708<>A2O7L 5 1750871 270<8>459AB28O 5 1750876 27=0G5=88 26 1750881 27OB 21 1750907 27OB89 108 1750928 27OB>3> 108 1751036 27OBK 5 1751144 27OBK5 8 1751149 27OBK9 154 1751157 27OBK< 4 1751311 27OBKE 8 1751315 27OBL 34 1751323 28 11 1751357 281@0F88 5 1751368 281@0F89 5 1751373 281@0F8N 6 1751378 281@0F8O 20 1751384 281@>A83=0; 5 1751404 284 8516 1751409 2840 1845 1759925 2840< 66 1761770 2840<8 9 1761836 2840B8 66 1761845 2840E 5 1761911 2843@0=8FK 37 1761916 2843@C??K 15 1761953 2843@C??K<>45;8xs 25 1761968 2843@C??KD>@<K 53 1761993 28440==KE 13 1762046 28440==KE0=0;870 19 1762059 28442865=8O 106 1762078 28442865=8O1CE30;B5@88 73 1762184 28442865=8O=0:>?;5=8O 66 1762257 28442865=8O@538AB@0=0:>?;5=8O 6 1762323 28445:>@0F88D>@<K 23 1762329 2844>?>;=5=8OM;5<5=B0D>@<K 28 1762352 2845 1763 1762380 2845= 9 1764143 2845==K9 9 1764152 2845> 37 1764161 2845>70?8A59 8 1764198 2845>70?8A8 12 1764206 2845>70?8AL 35 1764218 2845>72>=:0 13 1764253 2845>72>=:0<8 4 1764266 2845>72>=:8 18 1764270 2845>72>=:>2 4 1764288 2845>72>=:C 4 1764292 2845>:>=D5@5=F88 37 1764296 2845>:>=D5@5=F884>ABC?=K 10 1764333 2845>:>=D5@5=F89 4 1764343 2845>:>=D5@5=F8N 27 1764347 2845>:>=D5@5=F8O 62 1764374 2845>:>=D5@5=F8O0A8=E 10 1764436 2845>>1JO2;5=85 26 1764446 2845>>1JO2;5=8O 26 1764472 2845>AJ5<:0 4 1764498 2845>D09; 4 1764502 2845>D09;>2 4 1764506 2845BL 52 1764510 28470?>;=5=8O@0AH8D@>2:8?>AB@>8B5;O>BG5B0 29 1764562 28485@0@E88 37 1764591 28487<5=5=8O 5 1764628 28487<5=5=8O40==KE 54 1764633 28487<5=5=8OAB@>:840==KE 38 1764687 2848< 8 1764725 2848<0 18 1764733 2848<0O 16 1764751 2848<89 38 1764767 2848<>3> 4 1764805 2848<>9 51 1764809 2848<>AB8 107 1764860 2848<>ABL 383 1764967 2848<>ABLN 20 1765350 2848<K 9 1765370 2848<K5 8 1765379 2848<K9 233 1765387 2848<K< 12 1765620 2848<K<8 10 1765632 2848<KE 56 1765642 284:0@B8=:8 24 1765698 284:;NG0 9 1765722 284:;NG048=0<8G5A:>3>A?8A:0 30 1765731 284:=>?:8?0=5;8:=>?>:A>>1I5=8OA8AB5<K2708<>459AB28O 19 1765761 284:=>?:8D>@<K 33 1765780 284:=>?>: 17 1765813 284:>=B@035=B0 16 1765830 284=> 14 1765846 284=K 34 1765860 284=K9 57 1765894 284>1@01>B:8A>45@68<>3> 15 1765951 284>2 3868 1765966 284>< 172 1769834 284>B>1@065=8O 5 1770006 284>B>1@065=8O?>;=>B5:AB>2>3>?>8A:0 19 1770011 284?5@5:;NG0B5;O 34 1770030 284?5@8>40 12 1770064 284?5@8>40@538AB@0@0AG5B0 36 1770076 284?>4?8A59 45 1770112 284?>4?8A59:4803@0<<5 149 1770157 284?>8A:0 53 1770306 284?>;OD>@<K 113 1770359 284@0<:8 20 1770472 284@0AG5B0 206 1770492 284@538AB@0 23 1770698 284@538AB@0=0:>?;5=8O 36 1770721 284A@02=5=8O 180 1770757 284A@02=5=8O:><?>=>2:840==KE 119 1770937 284AC1:>=B> 79 1771056 284AC1:>=B>1 5 1771135 284AC1:>=B>4B 31 1771140 284AC1:>=B>4B1 5 1771171 284AC1:>=B>:>=B@035=B 10 1771176 284AC1:>=B>:B 31 1771186 284AC1:>=B>>A 6 1771217 284AG5B0 73 1771223 284B01;8FK 17 1771296 284B01;8FK2=5H=53>8AB>G=8:040==KE 29 1771313 284B>G:8<0@H@CB0187=5A?@>F5AA0 55 1771342 284C 172 1771397 284CG5B02@5<5=8 6 1771569 284D0A5B0 5 1771575 284D0A5B0xdto 73 1771580 284D;06:0 39 1771653 284D>@<K 126 1771692 284F25B0 34 1771818 284G8A;>2>3>7=0G5=8O 24 1771852 284H@8DB0 38 1771876 284K 351 1771914 284K70@0:B5@8AB8:70?@>A 10 1772265 284K:>=B@035=B>2 26 1772275 284K:>@ 7 1772301 284KAC1:>=B> 111 1772308 284KAC1:>=B>4B 6 1772419 284KAC1:>=B>:B 7 1772425 284KAC1:>=B>?5@54=0G0;><4>102;5=8O 5 1772432 284KB>20@>2 20 1772437 284KCG5B02@5<5=8 6 1772457 284KE0@0:B5@8AB8: 31 1772463 284KE0@0:B5@8AB8:70?@>A 19 1772494 284KE0@0:B5@8AB8:B01;8F0 25 1772513 284KE0@0:B5@8AB8:B>20@>2 5 1772538 284M;5<5=B0AB8;O 35 1772543 285@0@E88 22 1772578 287C0;870F88 4 1772600 287C0;870F8O 4 1772604 287C0;878@CNBAO 4 1772608 287C0;L=0O 5 1772612 287C0;L=> 16 1772617 287C0;L=>3> 48 1772633 287C0;L=>5 24 1772681 287C0;L=>9 28 1772705 287C0;L=>< 50 1772733 287C0;L=K9 216 1772783 287C0;L=K< 24 1772999 287C0;L=KE 24 1773023 28;L> 6 1773047 28=8B5;L=K9 21 1773053 28@38=A:85 12 1773074 28@38=A:89 12 1773086 28@BC0;L=0O 6 1773098 28@BC0;L=>3> 124 1773104 28@BC0;L=>9 122 1773228 28@BC0;L=K5 66 1773350 28@BC0;L=K9 402 1773416 28@BC0;L=K9:0B0;>3 6 1773818 28@BC0;L=K9E>ABs3 37 1773824 28@BC0;L=KE 66 1773861 28AB 9 1773927 2: 187 1773936 2:;04:0 4 1774123 2:;04:5 4 1774127 2:;NG05B 454 1774131 2:;NG05B?>;=>ABLN 9 1774585 2:;NG05BAO 195 1774594 2:;NG0;0 4 1774789 2:;NG0B8 4 1774793 2:;NG0BL 1100 1774797 2:;NG0BL24>ABC?=K5?>;O 10 1775897 2:;NG0BL2:><0=4=K98=B5@D59A 9 1775907 2:;NG0BL8<O?>;L7>20B5;O2>BG5B 9 1775916 2:;NG0BL8<O?>;L7>20B5;O2>BG5B=0:;85=B5 13 1775925 2:;NG0BL8<O?>;L7>20B5;O2>BG5B=0A5@25@5 17 1775938 2:;NG0BL8=D>@<0F8N>A8AB5<52>BG5B 9 1775955 2:;NG0BL8=D>@<0F8N>A8AB5<52>BG5B=0:;85=B5 13 1775964 2:;NG0BL?>4@>1=K9B5:AB>H81:82>BG5B 9 1775977 2:;NG0BL?>4@>1=K9B5:AB>H81:82>BG5B=0:;85=B5 13 1775986 2:;NG0BL?>4@>1=K9B5:AB>H81:82>BG5B=0A5@25@5 9 1775999 2:;NG0BL?>4G8=5==K5 29 1776008 2:;NG0BL?>;=CNF5?>G:C 9 1776037 2:;NG0BL?CABK5 6 1776046 2:;NG0BL@0AH8@5=8O:>=D83C@0F88 17 1776052 2:;NG0BLA2545=8O>18=D>@<0F8>==>910752>BG5B 9 1776069 2:;NG0BLA2545=8O>18=D>@<0F8>==>910752>BG5B=0:;85=B5 13 1776078 2:;NG0BLA2545=8O>18=D>@<0F8>==>910752>BG5B=0A5@25@5 9 1776091 2:;NG0BLA5@B8D8:0BAC1J5:B0 9 1776100 2:;NG0BLA=8<>:>:>=2>BG5B 9 1776109 2:;NG0BLA=8<>:>:>=2>BG5B=0:;85=B5 13 1776118 2:;NG0BLA?@02:C2A>45@60=85 198 1776131 2:;NG0BLAO 316 1776329 2:;NG0BLF5?>G:C157:>@=52>3> 13 1776645 2:;NG0NB 13 1776658 2:;NG0NB?>;=>ABLN 9 1776671 2:;NG0NBAO 37 1776680 2:;NG0NI0O 30 1776717 2:;NG0NI53> 26 1776747 2:;NG0NI55 68 1776773 2:;NG0NI89 184 1776841 2:;NG0O 579 1777025 2:;NG0O?>4G8=5==K5 18 1777604 2:;NG5= 186 1777622 2:;NG5=0 234 1777808 2:;NG5=01;>:8@>2:0=0G0;0A50=A>2 47 1778042 2:;NG5=85 378 1778089 2:;NG5=85xs 834 1778467 2:;NG5=8540==KE2?>4?8AL 9 1779301 2:;NG5=85< 18 1779310 2:;NG5=85A5@B8D8:0B>22?>4?8AL 28 1779328 2:;NG5=88 19 1779356 2:;NG5=8N 8 1779375 2:;NG5=8O 203 1779383 2:;NG5==>5 6 1779586 2:;NG5==>9 5 1779592 2:;NG5==>< 8 1779597 2:;NG5==><C 5 1779605 2:;NG5==>AB8 10 1779610 2:;NG5==>ABL 10 1779620 2:;NG5==K5 12 1779630 2:;NG5==K9 645 1779642 2:;NG5==K<8 4 1780287 2:;NG5==KE 31 1780291 2:;NG5=> 75 1780322 2:;NG5=>>?>25I5=85>A8=E@>=870F88 6 1780397 2:;NG5=K 106 1780403 2:;NG8; 17 1780509 2:;NG8B5 4 1780526 2:;NG8B5;L=> 55 1780530 2:;NG8B8 321 1780585 2:;NG8B8AO 84 1780906 2:;NG8BL 153 1780990 2:;NG8BL0:B82=>5A:0=8@>20=85 10 1781143 2:;NG8BL0C48>70?8AL 10 1781153 2:;NG8BL<5B040==K5 16 1781163 2:;NG8BL>1J5:BK 49 1781179 2:;NG8BL>BA;56820=8535>7>= 18 1781228 2:;NG8BL@5:2878BK 9 1781246 2:;NG8BLD>=0@8: 12 1781255 2:><0=4=>9?0=5;8 9 1781267 2:><0=4=>9?0=5;8824>?>;=8B5;L=><?>4<5=N 9 1781276 2:>=5F>:=0 18 1781285 2:>=5FA?8A:0 18 1781303 2:>=B0:B5 8 1781321 2:>=F5 23 1781329 2:>=F5M;5<5=B0 9 1781352 2:CA=> 12 1781361 2:CA=K9 12 1781373 2;0455B 344 1781385 2;045;5F 1664 1781729 2;045;5FD>@<K 31 1783393 2;045;LF0 585 1783424 2;045;LF0< 13 1784009 2;045;LF0<8 8 1784022 2;045;LF5 33 1784030 2;045;LF52 13 1784063 2;045;LF5< 640 1784076 2;045;LFC 53 1784716 2;045;LFK 9 1784769 2;045=85 4 1784778 2;045BL 504 1784782 2;045NI0O 10 1785286 2;045NI53> 10 1785296 2;045NI55 4 1785306 2;045NI55A2>9AB2> 24 1785310 2;045NI89 184 1785334 2;52> 55 1785518 2;5G5B 47 1785573 2;5GL 47 1785620 2;8O5B 585 1785667 2;8O=85 313 1786252 2;8O=85@07<5@0=0?C7K@5: 30 1786565 2;8O=85@07<5@0=0?C7K@5:4803@0<<K 50 1786595 2;8O=8O 34 1786645 2;8OBL 659 1786679 2;8ONB 34 1787338 2;8ONI55 210 1787372 2;8ONI85 9 1787582 2;8ONI89 271 1787591 2;8ONI8E 52 1787862 2;>65= 10 1787914 2;>65=85 534 1787924 2;>65=85pdf 45 1788458 2;>65=85A8AB5<K2708<>459AB28O 75 1788503 2;>65=88 4 1788578 2;>65=89 92 1788582 2;>65=8O 403 1788674 2;>65=8O<8 8 1789077 2;>65==0O 80 1789085 2;>65==0OAE5<0:><?>=>2:840==KE 73 1789165 2;>65==0OB01;8F0 11 1789238 2;>65==0OB01;8F0AE5<K70?@>A0 52 1789249 2;>65==>3> 144 1789301 2;>65==>5 17 1789445 2;>65==>5A>>1I5=85 5 1789462 2;>65==>9 143 1789467 2;>65==>< 21 1789610 2;>65==><C 6 1789631 2;>65==>AB8 41 1789637 2;>65==>ABL 46 1789678 2;>65==CN 43 1789724 2;>65==K5 243 1789767 2;>65==K5=01>@K40==KE 40 1790010 2;>65==K5=01>@K40==KE<0:5B0:><?>=>2:840==KE 80 1790050 2;>65==K5?0@0<5B@K 13 1790130 2;>65==K5AE5<K:><?>=>2:840==KE 82 1790143 2;>65==K9 925 1790225 2;>65==K9187=5A?@>F5AA 38 1791150 2;>65==K970?@>A 5 1791188 2;>65==K970?@>AAE5<K70?@>A0 28 1791193 2;>65==K9=01>@40==KE<0:5B0:><?>=>2:840==KE 75 1791221 2;>65==K9=01>@40==KEAE5<K:><?>=>2:840==KE 36 1791296 2;>65==K9>1J5:B<0:5B0:><?>=>2:840==KE 77 1791332 2;>65==K9?@>F5AA 17 1791409 2;>65==K< 34 1791426 2;>65==K<8 23 1791460 2;>65==KE 246 1791483 2;>65=K 4 1791729 2;>65=L5 92 1791733 2;>68BL 97 1791825 2<5AB5 244 1791922 2<5AB5A2;045;LF5< 9 1792166 2<5AB5A87<5@5=8O<8 9 1792175 2<5AB5A>A;54CNI8< 11 1792184 2<5AB8BL 4 1792195 2<5AB> 665 1792199 2<5I0;AO 5 1792864 2<5I0BLAO 13 1792869 2<5I0NBAO 4 1792882 2<5I0NI89AO 4 1792886 2=0G0;5 42 1792890 2=5 494 1792932 2=54@5=85 8 1793426 2=54@5=8O 8 1793434 2=54@OBL 18 1793442 2=5:>=B5:AB=0O 6 1793460 2=5:>=B5:AB=K<8 5 1793466 2=5:>=B5:AB=KE 10 1793471 2=5A5=85 24 1793481 2=5A5=8O 24 1793505 2=5A5==K5 51 1793529 2=5A5==K9 60 1793580 2=5A5==KE 5 1793640 2=5A5=K 4 1793645 2=5AB8 40 1793649 2=5AH89 30 1793689 2=5H=53> 2591 1793719 2=5H=55 63687 1796310 2=5H=55A>1KB85 40 1859997 2=5H=55A>548=5=85 37 1860037 2=5H=55B5;>A>>1I5=8OA5@28A08=B53@0F88 6 1860074 2=5H=55E@0=8;8I542>8G=KE40==KE 5 1860080 2=5H=59 471 1860085 2=5H=5< 149 1860556 2=5H=5<C 97 1860705 2=5H=85 179 1860802 2=5H=8540==K5=02830F8>==>9AAK;:8 114 1860981 2=5H=858AB>G=8:840==KE 18 1861095 2=5H=858AB>G=8:840==KE<5=5465@ 17 1861113 2=5H=85=01>@K40==KE 6 1861130 2=5H=85>1@01>B:8 21 1861136 2=5H=85>1@01>B:8<5=5465@ 34 1861157 2=5H=85>BG5BK 15 1861191 2=5H=85>BG5BK<5=5465@ 34 1861206 2=5H=85E@0=8;8I042>8G=KE40==KE 43 1861240 2=5H=89 66443 1861283 2=5H=89845=B8D8:0B>@ 19 1927726 2=5H=898AB>G=8: 14 1927745 2=5H=898AB>G=8:40==KE 310 1927759 2=5H=898AB>G=8:40==KE:C1 11 1928069 2=5H=898AB>G=8:40==KE:C170?8AL 28 1928080 2=5H=898AB>G=8:40==KE:C1:;NG70?8A8 42 1928108 2=5H=898AB>G=8:40==KE:C1<5=5465@ 53 1928150 2=5H=898AB>G=8:40==KE:C1<5=5465@70?8A8 35 1928203 2=5H=898AB>G=8:40==KE:C1=01>@70?8A59 90 1928238 2=5H=898AB>G=8:40==KE:C1B01;8F087<5@5=8O 11 1928328 2=5H=898AB>G=8:40==KE:C1B01;8F087<5@5=8O<5=5465@ 70 1928339 2=5H=898AB>G=8:40==KE:C1B01;8F087<5@5=8O>1J5:B 54 1928409 2=5H=898AB>G=8:40==KE:C1B01;8F087<5@5=8OAAK;:0 100 1928463 2=5H=898AB>G=8:40==KE:C1B01;8FK87<5@5=89<5=5465@ 17 1928563 2=5H=898AB>G=8:40==KE:C1K<5=5465@ 18 1928580 2=5H=898AB>G=8:40==KE<5=5465@ 115 1928598 2=5H=898AB>G=8:40==KEB01;8F0 11 1928713 2=5H=898AB>G=8:40==KEB01;8F070?8AL 52 1928724 2=5H=898AB>G=8:40==KEB01;8F0:;NG70?8A8 60 1928776 2=5H=898AB>G=8:40==KEB01;8F0<5=5465@ 100 1928836 2=5H=898AB>G=8:40==KEB01;8F0<5=5465@70?8A8 53 1928936 2=5H=898AB>G=8:40==KEB01;8F0=01>@70?8A59 180 1928989 2=5H=898AB>G=8:40==KEB01;8F0>1J5:B 192 1929169 2=5H=898AB>G=8:40==KEB01;8F0AAK;:0 105 1929361 2=5H=898AB>G=8:40==KEB01;8FK<5=5465@ 23 1929466 2=5H=898AB>G=8:40==KEDC=:F8O 11 1929489 2=5H=89:><?>=5=B 6 1929500 2=5H=89<>4C;L 6 1929506 2=5H=89>1J5:B 22 1929512 2=5H=89>BG5B 158 1929534 2=5H=89>BG5BB01;8G=0OG0ABL 6 1929692 2=5H=89?>;L7>20B5;LA8AB5<K2708<>459AB28O 11 1929698 2=5H=8< 132 1929709 2=5H=8<8 92 1929841 2=5H=8E 526 1929933 2=5H=NN 80 1930459 2=5H=OO 128 1930539 2=5H=OO:><?>=5=B0 44 1930667 2=5H=OO>1@01>B:0 118 1930711 2=5H=OO>1@01>B:0B01;8G=0OG0ABL 6 1930829 2=5H>1@01>B:0 11 1930835 2=87 167 1930846 2=87C 18 1931013 2=8<0=85 862 1931031 2=>2L 27 1931893 2=>A8B8 6 1931920 2=>A8BAO 25 1931926 2=>A8BL 6 1931951 2=>A8BLAO 25 1931957 2=CB@5==53> 57 1931982 2=CB@5==55 112 1932039 2=CB@5==55?>4<=>65AB2> 246 1932151 2=CB@5==59 12 1932397 2=CB@5==5< 8 1932409 2=CB@5==85 25 1932417 2=CB@5==89 278 1932442 2=CB@5==8970:07 5 1932720 2=CB@5==89@048CA:>;LF52>94803@0<<K 30 1932725 2=CB@5==8E 16 1932755 2=CB@5==NN 20 1932771 2=CB@5==OO 21 1932791 2=CB@8 638 1932812 2=CB@8?@>F5AA=K9 5 1933450 2=CB@8H:0;K 9 1933455 2> 1694 1933464 2>1;0AB8?>AB@>5=8O 9 1935158 2>2=5 8 1935167 2>2A5 5 1935175 2>2A5<?;0=5284>2E0@0:B5@8AB8: 9 1935180 2>2A5<?;0=5AG5B>2 9 1935189 2>2A5<A?@02>G=8:5 21 1935198 2>3=CB0O 4 1935219 2>3=CB0O?>25@E=>ABL 13 1935223 2>3=CBK9 4 1935236 2>4>?04 13 1935240 2>71C640BLAO 15 1935253 2>72545=85 17 1935268 2>72545=8O 17 1935285 2>72>48B 10 1935302 2>72>48BL 10 1935312 2>72@0B 316 1935322 2>72@0B0 30 1935638 2>72@0B5 46 1935668 2>72@0B8B 10 1935714 2>72@0B8BL 10 1935724 2>72@0B8BLAO 4 1935734 2>72@0B=0OB0@0 10 1935738 2>72@0B>< 4 1935748 2>72@0BOBAO 4 1935752 2>72@0I05<0O 195 1935756 2>72@0I05<>3> 109 1935951 2>72@0I05<>5 21036 1936060 2>72@0I05<>57=0G5=85 13 1957096 2>72@0I05<>9 39 1957109 2>72@0I05<>< 72 1957148 2>72@0I05<><C 8 1957220 2>72@0I05<CN 4 1957228 2>72@0I05<K5 22 1957232 2>72@0I05<K9 21527 1957254 2>72@0I05<K< 26 1978781 2>72@0I05<KE 86 1978807 2>72@0I05B 3944 1978893 2>72@0I05B7=0G5=85 13 1982837 2>72@0I05BAO 1542 1982850 2>72@0I0BL 4273 1984392 2>72@0I0BLAO 1690 1988665 2>72@0I0NB 123 1990355 2>72@0I0NBAO 158 1990478 2>72@0I0NI53> 4 1990636 2>72@0I0NI89 4 1990640 2>72@0I5= 63 1990644 2>72@0I5=0 577 1990707 2>72@0I5==>3> 10 1991284 2>72@0I5==>5 5 1991294 2>72@0I5==>9 6 1991299 2>72@0I5==K9 1178 1991305 2>72@0I5=> 487 1992483 2>72@0I5=K 76 1992970 2>72@0I5B 5 1993046 2>73;02;O5<>9 5 1993051 2>73;02;O5<K9 11 1993056 2>73;02;O5<KE 6 1993067 2>74CE 20 1993073 2>7;0305BAO 6 1993093 2>7;030BLAO 6 1993099 2>7<>65= 1310 1993105 2>7<>6=0 212 1994415 2>7<>6=> 1914 1994627 2>7<>6=>3> 4 1996541 2>7<>6=>5 29 1996545 2>7<>6=>9 28 1996574 2>7<>6=>< 4 1996602 2>7<>6=>?CAB>5 36 1996606 2>7<>6=>?CAB>9 20 1996642 2>7<>6=>@0725@=CBL 10 1996662 2>7<>6=>AB59 13 1996672 2>7<>6=>AB8 717 1996685 2>7<>6=>ABL 2288 1997402 2>7<>6=>ABL8A?>;L7>20=8O2=5H=8EDC=:F89 6 1999690 2>7<>6=>ABL?@5@K20=8O?>;L7>20B5;5< 12 1999696 2>7<>6=>ABLGB5=8Oxml 32 1999708 2>7<>6=>ABLN 117 1999740 2>7<>6=>ABO<8 5 1999857 2>7<>6=>ABOE 6 1999862 2>7<>6=>CAB0=>28BL?0@0<5B@ 30 1999868 2>7<>6=CN 15 1999898 2>7<>6=K 80 1999913 2>7<>6=K5 352 1999993 2>7<>6=K9 4042 2000345 2>7<>6=K< 37 2004387 2>7<>6=KE 214 2004424 2>7=03@0645=85 7 2004638 2>7=03@0645=85< 4 2004645 2>7=03@0645=8O 5 2004649 2>7=8:05B 2122 2004654 2>7=8:0BL 2133 2006776 2>7=8:0NB 11 2008909 2>7=8:0NI55 30 2008920 2>7=8:0NI85 52 2008950 2>7=8:0NI89 93 2009002 2>7=8:0NI8E 11 2009095 2>7=8:;0 29 2009106 2>7=8:=5B 22 2009135 2>7=8:=>25=85 641 2009157 2>7=8:=>25=85< 5 2009798 2>7=8:=>25=88 275 2009803 2>7=8:=>25=8N 216 2010078 2>7=8:=>25=8O 198 2010294 2>7=8:=C2H59 4 2010492 2>7=8:=CBL 79 2010496 2>7=8:H0O 6 2010575 2>7=8:H59 17 2010581 2>7=8:H89 24 2010598 2>7=8:H8E 5 2010622 2>7>1=>28BL 4 2010627 2>7>1=>2;O5<K9 4 2010631 2>7>1=>2;O5<KE 4 2010635 2>7>1=>2;O5BAO 9 2010639 2>7>1=>2;OBLAO 9 2010648 2>7@ 226 2010657 2>7@0AB05B 4 2010883 2>7@0AB0=85 268 2010887 2>7@0AB0=8N 240 2011155 2>7@0AB0=8O 32 2011395 2>7@0AB0BL 4 2011427 2>7@0AB0NI55 5 2011431 2>7@0AB0NI89 6 2011436 2>7@0AB0NI8< 5 2011442 2>7@0I05<>3> 4 2011447 2>7@0I05B 11 2011451 2>7@0I5=0 4 2011462 2>7@0I5==K9 19 2011466 2>7@0I5=> 15 2011485 2>9B8 22 2011500 2>:=51@0C75@0 13 2011522 2>:@C3 375 2011535 2>;=0 20 2011910 2>;=K 20 2011930 2>>1I5 135 2011950 2>?5@0B82=>9?0<OB8 9 2012085 2>?5@0B82=>9?0<OB88=048A:5 17 2012094 2>?@5:8 72 2012111 2>?@>A 206 2012183 2>?@>A0 98 2012389 2>?@>A0A8=E 19 2012487 2>?@>A>2 18 2012506 2>?@>AK 8 2012524 2>@>=:0 27 2012532 2>@>=:0=>@<8@>20==0O 25 2012559 2>@>=:0=>@<8@>20==0O>1J5<=0O 13 2012584 2>@>=:0>1J5<=0O 13 2012597 2>@>=:8 4 2012610 2>@>=:> 27 2012614 2>A5<L45AOB 4 2012641 2>A5<LN 5 2012645 2>A7=0G 7 2012650 2>A:;8F0=85 5 2012657 2>A:;8F0B5;L=>3> 4 2012662 2>A:;8F0B5;L=K9 36 2012666 2>A:;8F0B5;L=K97=0: 9 2012702 2>A:;8F0B5;L=KE 8 2012711 2>A:@5A5=L5 45 2012719 2>A?>;L7>20BLAO 20 2012764 2>A?>;L7C5<AO 5 2012784 2>A?@5I5= 4 2012789 2>A?@5I5==K9 4 2012793 2>A?@8=8<05BAO 26 2012797 2>A?@8=8<0BLAO 42 2012823 2>A?@8=8<0NBAO 6 2012865 2>A?@8OB85 11 2012871 2>A?@8OB8O 11 2012882 2>A?@>872545= 12 2012893 2>A?@>872545=0 5 2012905 2>A?@>872545=85 64 2012910 2>A?@>872545=850C48>8281@0F8O 9 2012974 2>A?@>872545=850C48>8281@0F8O2D>=>2><@568<5 9 2012983 2>A?@>872545=8O 17 2012992 2>A?@>872545==K9 13 2013009 2>A?@>8725AB8 17 2013022 2>A?@>8725AB80C48> 20 2013039 2>A?@>8725AB872C:>2>5>?>25I5=85 20 2013059 2>A?@>8725AB8B5:AB 14 2013079 2>A?@>872>48B 10 2013093 2>A?@>872>48BAO 19 2013103 2>A?@>872>48BL 15 2013122 2>A?@>872>48BLAO 19 2013137 2>A?@>872>4OI55 15 2013156 2>A?@>872>4OI89 15 2013171 2>AAB0=02;8205B 39 2013186 2>AAB0=02;8205BAO 85 2013225 2>AAB0=02;820BL 111 2013310 2>AAB0=02;820BL7=0G5=8O?@8>B:@KB88 22 2013421 2>AAB0=02;820BL:0B0;>38 22 2013443 2>AAB0=02;820BLAO 124 2013465 2>AAB0=02;820BLB5:CICNAB@>:C 151 2013589 2>AAB0=02;820NBAO 39 2013740 2>AAB0=>28< 5 2013779 2>AAB0=>28<K9 5 2013784 2>AAB0=>28BL 99 2013789 2>AAB0=>28BL7=0G5=85 22 2013888 2>AAB0=>28BL7=0G5=8O 11 2013910 2>AAB0=>2;5=0 19 2013921 2>AAB0=>2;5=85 382 2013940 2>AAB0=>2;5=88 36 2014322 2>AAB0=>2;5=8O 297 2014358 2>AAB0=>2;5==>5 5 2014655 2>AAB0=>2;5==K9 51 2014660 2>AAB0=>2;5=> 5 2014711 2>AAB0=>2;5=K 22 2014716 2>AB>: 4 2014738 2>AB>G=>9 9 2014742 2>AB>G=K9 9 2014751 2>B 4 2014760 2>B45;L=><>:=5 13 2014764 2>G5@548 13 2014777 2>H54H85 5 2014790 2>H54H89 5 2014795 2>H5; 12 2014800 2>H;8 10 2014812 2>HL 7 2014822 2?5@54 139 2014829 2?5@Q4 8 2014968 2?8A0=0 4 2014976 2?8A0==K9 4 2014980 2?;>BL 4 2014984 2?>A;54AB288 50 2014988 2?@020 66 2015038 2?@02> 66 2015104 2?@545;0E?>4G8=5=8O 39 2015170 2?@545;0E?>4G8=5=8O2;045;LFC 21 2015209 2@ 38 2015230 2@53 28 2015268 2@5<5=5< 15 2015296 2@5<5=8 1768 2015311 2@5<5=8BL 1768 2017079 2@5<5==0O 65 2018847 2@5<5==0O>A=>2=0O 3 2018912 2@5<5==0OB01;8F0 36 2018915 2@5<5==0OB01;8F070?@>A0 28 2018951 2@5<5==> 26 2018979 2@5<5==>3> 98 2019005 2@5<5==>4>?CAB8<K9>1J5<?0<OB8?@>F5AA>2 29 2019103 2@5<5==>5 178 2019132 2@5<5==>9 734 2019310 2@5<5==>< 113 2020044 2@5<5==>>B:;NG5=0 9 2020157 2@5<5==CN 43 2020166 2@5<5==K5 54 2020209 2@5<5==K540==K5>1@01>B:8 11 2020263 2@5<5==K5B01;8FK70?@>A0 23 2020274 2@5<5==K9 780 2020297 2@5<5==K< 8 2021077 2@5<5==K<8 10 2021085 2@5<5==KE 150 2021095 2@5<5=>9 6 2021245 2@5<O 5063 2021251 2@5<O0:BC0;L=>AB840==KE 7 2026314 2@5<O687=8 11 2026321 2@5<O687=802B><0B8G5A:8A>E@0=5==>90CB5=B8D8:0F88 36 2026332 2@5<O687=8A50=A0 18 2026368 2@5<O687=8A>E@0=5==>90CB5=B8D8:0F88 48 2026386 2@5<O7025@H5=8O 13 2026434 2@5<O7025@H5=8OA50=A0?@8157459AB288 36 2026447 2@5<O7025@H5=8OA?OI53>A50=A0 47 2026483 2@5<O70?@>A0 9 2026530 2@5<O70?CA:0 11 2026539 2@5<O70AK?0=8O?0AA82=>3>A50=A0 47 2026550 2@5<O87<5=5=8O 59 2026597 2@5<O:>=F0 22 2026656 2@5<O=0G0;0 60 2026678 2@5<O=0G0;01;>:8@>2:8 72 2026738 2@5<O=0G0;08:>=F0 9 2026810 2@5<O>1@01>B:8 6 2026819 2@5<O>6840=8O1;>:8@>2:840==KE 36 2026825 2@5<O>6840=8OA5@25@0 5 2026861 2@5<O>:>=G0=8O 18 2026866 2@5<O>:>=G0=8O1;>:8@>2:8 52 2026884 2@5<O>:>=G0=8O>6840=8O 6 2026936 2@5<O?>A;54=53>2K7>20AC14 11 2026942 2@5<O?>A;54=590:B82=>AB8 11 2026953 2@5<O?@52KH5=8O?>?0<OB8 11 2026964 2@5<O?@54C?@5645=8O>7025@H5=88A50=A0?@8157459AB288 36 2026975 2@5<O?@8=C48B5;L=>3>7025@H5=8O 21 2027011 2@5<OA>740=8O 11 2027032 2@5<OCAB0=>2:8A>548=5=8O 11 2027043 2@CG=CN 40 2027054 2A5 5046 2027094 2A520@80=BK 33 2032140 2A52K1@0==K5 9 2032173 2A5340 1854 2032182 2A53> 161 2034036 2A53>:>;>=>: 5 2034197 2A53>?>4>:C<5=BC 12 2034202 2A53>AB8;59 5 2034214 2A53>AB@>: 15 2034219 2A53>B>G5: 4 2034234 2A540==K5 18 2034238 2A57040G8 9 2034256 2A57=0G5=8O 20 2034265 2A57=0G5=8OB>G:8 9 2034285 2A59 113 2034294 2A5:@><52K1@0==KE 9 2034407 2A5< 348 2034416 2A5<8 281 2034764 2A5<8@=>3> 12 2035045 2A5<8@=K9 12 2035057 2A5<C 24 2035069 2A5>H81:8 22 2035093 2A5?>;L7>20B5;8?@8;>65=8O 14 2035115 2A5?>;O 9 2035129 2A5@5H5=8O 9 2035138 2A5A8<2>;K 9 2035147 2A5C@>2=825@B8:0;L=> 9 2035156 2A5C@>2=83>@87>=B0;L=> 9 2035165 2A5DC=:F88 9 2035174 2A5E 3124 2035183 2A5M;5<5=BK 9 2038307 2A5M;5<5=BKD>@<K 45 2038316 2A5OBL 113 2038361 2A;54 10 2038474 2A;54AB285 13 2038484 2A?5F80;L=>9?>78F88 9 2038497 2A?8A:5 211 2038506 2A?8A:5?>85@0@E88 34 2038717 2A?;K20NI0O 75 2038751 2A?;K20NI53> 4 2038826 2A?;K20NI55 8 2038830 2A?;K20NI59 328 2038838 2A?;K20NI5< 4 2039166 2A?;K20NI89 414 2039170 2A?;K20NI8< 4 2039584 2A?;KB85 8 2039588 2A?;KB8N 8 2039596 2A?><>30B5;L=0O 11 2039604 2A?><>30B5;L=>3> 40 2039615 2A?><>30B5;L=>5 22 2039655 2A?><>30B5;L=>< 19 2039677 2A?><>30B5;L=CN 5 2039696 2A?><>30B5;L=K5 5 2039701 2A?><>30B5;L=K9 127 2039706 2A?><>30B5;L=K9ip?>@B 29 2039833 2A?><>30B5;L=K< 4 2039862 2A?><>30B5;L=KE 24 2039866 2A?KH:0 21 2039890 2A?KH:8 13 2039911 2AB028< 5 2039924 2AB028B8 2378 2039929 2AB028BL 2385 2042307 2AB028BL40==K5 50 2044692 2AB028BL>1;0ABL 30 2044742 2AB028BL?5@54 429 2044772 2AB028BL?>A;5 9 2045201 2AB028BLAB@>:C 149 2045210 2AB028BLOG59:C 131 2045359 2AB02:0 301 2045490 2AB02:5 18 2045791 2AB02:8 30 2045809 2AB02:C 5 2045839 2AB02;5= 15 2045844 2AB02;5=0 15 2045859 2AB02;5==0O 55 2045874 2AB02;5==>3> 10 2045929 2AB02;5==>9 9 2045939 2AB02;5==CN 8 2045948 2AB02;5==K9 366 2045956 2AB02;5==KE 10 2046322 2AB02;5=> 24 2046332 2AB02;5=K 202 2046356 2AB02;O5<0O 29 2046558 2AB02;O5<>3> 61 2046587 2AB02;O5<>5 35 2046648 2AB02;O5<>9 33 2046683 2AB02;O5<>< 16 2046716 2AB02;O5<K9 393 2046732 2AB02;O5B 541 2047125 2AB02;O5BAO 516 2047666 2AB02;OBL 612 2048182 2AB02;OBLAO 522 2048794 2AB02;ONBAO 10 2049316 2AB02>: 4 2049326 2AB0BL 5 2049330 2AB@08205<>3> 4 2049335 2AB@08205<K9 4 2049339 2AB@0820=85 4 2049343 2AB@0820=8O 4 2049347 2AB@5B82H53>AO 5 2049351 2AB@5B82H89AO 5 2049356 2AB@5B8;AO 6 2049361 2AB@5B8BAO 10 2049367 2AB@5B8BLAO 16 2049377 2AB@5G0 4 2049393 2AB@5G05<K5 4 2049397 2AB@5G05<K9 4 2049401 2AB@5G05BAO 31 2049405 2AB@5G0;8AL 5 2049436 2AB@5G0BLAO 74 2049441 2AB@5G0NBAO 28 2049515 2AB@5G5==>3> 10 2049543 2AB@5G5==K9 16 2049553 2AB@5G5==KE 6 2049569 2AB@5G8 4 2049575 2AB@>5= 6 2049579 2AB@>5=2OG59:C 11 2049585 2AB@>5==0O 10 2049596 2AB@>5==0O?>:C?:0 64 2049606 2AB@>5==0OB01;8F0 6 2049670 2AB@>5==>3> 837 2049676 2AB@>5==>5 34 2050513 2AB@>5==>5@01>G55<5AB> 9 2050547 2AB@>5==>9 103 2050556 2AB@>5==>< 523 2050659 2AB@>5==><C 4 2051182 2AB@>5==CN 10 2051186 2AB@>5==K5 33 2051196 2AB@>5==K5?>:C?:8 18 2051229 2AB@>5==K5B01;8FK 26 2051247 2AB@>5==K9 1659 2051273 2AB@>5==K< 21 2052932 2AB@>5==K<8 9 2052953 2AB@>5==KE 99 2052962 2AB@>8BL 28 2053061 2AB@>:0EB01;8FK 18 2053089 2AB@>:0ED>@<K 30 2053107 2AB@>:5 9 2053137 2ABC?8;8 11 2053146 2ABC?8;> 5 2053157 2ABC?8B8 16 2053162 2ABC?8BL 16 2053178 2AN 59 2053194 2AO 71 2053253 2AO:89 8 2053324 2AO:>3> 3 2053332 2AQ 16 2053335 2B01 31 2053351 2B>965:>;>=:5 9 2053382 2B>@0 894 2053391 2B>@0O 950 2054285 2B>@=8: 20 2055235 2B>@>3> 302 2055255 2B>@>5 409 2055557 2B>@>9 1312 2055966 2B>@>9D09; 9 2057278 2B>@>9M;5<5=B 25 2057287 2B>@>< 43 2057312 2B>@><C 36 2057355 2B>@C20B8 28 2057391 2B>@CN 28 2057419 2B>@K< 15 2057447 2B>@KE 5 2057462 2B@0=70:F88 18 2057467 2BC;:0 8 2057485 2BC;:8 8 2057493 2C4 5 2057501 2E>4 92 2057506 2E>40 54 2057598 2E>45 12 2057652 2E>48;> 5 2057664 2E>48B 237 2057669 2E>48B2>1J548=5==CN>1;0ABL 10 2057906 2E>48B8 41 2057916 2E>48BL 373 2057957 2E>4=0O 44 2058330 2E>4=0O8?@>3=>78@C5<0O 9 2058374 2E>4=>3> 29 2058383 2E>4=>9 183 2058412 2E>4=>92KE>4=>9 18 2058595 2E>4=>9?>B>: 5 2058613 2E>4=>< 8 2058618 2E>4=K< 12 2058626 2E>4=KE 60 2058638 2E>4?@822>45 9 2058698 2E>4OB 83 2058707 2E>4OI0O 479 2058790 2E>4OI53> 52 2059269 2E>4OI55 26 2059321 2E>4OI59 9 2059347 2E>4OI5< 5 2059356 2E>4OI5<C 5 2059361 2E>4OI85 113 2059366 2E>4OI8570?@>AK?>45;8BLAO 9 2059479 2E>4OI89 578 2059488 2E>4OI8< 5 2060066 2E>4OI8E 354 2060071 2E>4OICN 4 2060425 2E>645=85 162 2060429 2E>645=89 18 2060591 2E>645=8N 5 2060609 2E>645=8O 113 2060614 2E>645=L5 18 2060727 2G5@0 9 2060745 2G5@0H=53> 9 2060754 2G5@0H=89 9 2060763 2H0 7 2060772 2K 18 2060779 2K1 29 2060797 2K1187=5A?@>F5AA 64 2060826 2K120;NB0 23 2060890 2K13@C??0 5 2060913 2K140B0 49 2060918 2K14>: 5 2060967 2K14>:C<5=B 32 2060972 2K14>;6=>ABL 5 2061004 2K15@5B 31 2061009 2K15@8B5 59 2061040 2K17=0G 18 2061099 2K17=0G5=85 22 2061117 2K18<O 4 2061139 2K18@05< 11 2061143 2K18@05<>3> 36 2061154 2K18@05<>57=0G5=85 14 2061190 2K18@05<>9 8 2061204 2K18@05<K5 4 2061212 2K18@05<K5?>;O 9 2061216 2K18@05<K9 127 2061225 2K18@05<KE 68 2061352 2K18@05B 231 2061420 2K18@05BAO 437 2061651 2K18@0;8AL 5 2062088 2K18@0BL 302 2062093 2K18@0BL4;O87<5=5=8O 9 2062395 2K18@0BL@07;8G=K5 9 2062404 2K18@0BL@07@5H5==K5 9 2062413 2K18@0BLA@57 16 2062422 2K18@0BLAO 2170 2062438 2K18@0BLB8? 31 2064608 2K18@0NBAO 1635 2064639 2K18@0O 4 2066274 2K1:;85=B 6 2066278 2K1:>=B@035=B 15 2066284 2K1=><5=:;0BC@0 17 2066299 2K1>@ 4015 2066316 2K1>@0 2706 2070331 2K1>@0E 5 2073037 2K1>@20@80=B0 54 2073042 2K1>@30=870F8O 10 2073096 2K1>@3@C??8M;5<5=B>2 267 2073106 2K1>@4>102;5=85< 32 2073373 2K1>@4>ABC?5= 63 2073405 2K1>@5 694 2073468 2K1>@7=0G5=8O 95 2074162 2K1>@:0 1597 2074257 2K1>@:01 5 2075854 2K1>@:02 8 2075859 2K1>@:0187=5A?@>F5AA0 7 2075867 2K1>@:040==KE 31 2075874 2K1>@:070?8A59 6 2075905 2K1>@:0876C@=0;0 6 2075911 2K1>@:087@57C;LB0B070?@>A0 78 2075917 2K1>@:08B>38 5 2075995 2K1>@:0:C@A>220;NB 10 2076000 2K1>@:0< 5 2076010 2K1>@:0?;0=0>1<5=0 6 2076015 2K1>@:0?>@538AB@0B>@C 9 2076021 2K1>@:0?>AC1:>=B> 7 2076030 2K1>@:0?>AG5B0< 8 2076037 2K1>@:0?>AG5BC 17 2076045 2K1>@:0?>H0?:54>:C<5=B0 8 2076062 2K1>@:0A?@02>G=8:0 32 2076070 2K1>@:0B0;>30 23 2076102 2K1>@:0B8?>2F5= 17 2076125 2K1>@:0B>20@>2 8 2076142 2K1>@:0C7;>2 8 2076150 2K1>@:0E 20 2076158 2K1>@:0F5= 9 2076178 2K1>@:5 133 2076187 2K1>@:8 1023 2076320 2K1>@:82 4 2077343 2K1>@:>9 5 2077347 2K1>@:><?>=>2:840==KE 11 2077352 2K1>@:><?>=>2:840==KE=54>ABC?=K9 11 2077363 2K1>@:C 318 2077374 2K1>@=0AB@>5: 35 2077692 2K1>@=570?>;=5==>3> 18 2077727 2K1>@>2 10 2077745 2K1>@>: 15 2077755 2K1>@>< 28 2077770 2K1>@>G=> 11 2077798 2K1>@>G=K9 11 2077809 2K1>@?>2;045;LFC 11 2077820 2K1>@A>3;0A>20=8O>1@01>B:02K1>@020@80=B0 5 2077831 2K1>@AB@C4=8:0 6 2077836 2K1>@B8?04803@0<<K 4 2077842 2K1>@C 22 2077846 2K1>@K 11 2077868 2K1?>4@0745;5=85 5 2077879 2K1?@8:07 5 2077884 2K1@0; 4 2077889 2K1@0= 377 2077893 2K1@0=0 149 2078270 2K1@0==0O 37 2078419 2K1@0==0O40B0 38 2078456 2K1@0==0OA5@8O 4 2078494 2K1@0==0OAB@>:0 11 2078498 2K1@0==0OB>G:0 4 2078509 2K1@0==0OD>@<0 159 2078513 2K1@0==>3> 183 2078672 2K1@0==>5 123 2078855 2K1@0==>5459AB285 17 2078978 2K1@0==>57=0G5=85 39 2078995 2K1@0==>58<OD09;0 17 2079034 2K1@0==>5?>;5:><?>=>2:840==KE 88 2079051 2K1@0==>5D>B> 6 2079139 2K1@0==>9 47 2079145 2K1@0==>< 31 2079192 2K1@0==><C 5 2079223 2K1@0==K5 134 2079228 2K1@0==K5?>;O 56 2079362 2K1@0==K5?>;O:><?>=>2:840==KE 139 2079418 2K1@0==K5D09;K 15 2079557 2K1@0==K9 1460 2079572 2K1@0==K9M;5<5=B 18 2081032 2K1@0==K< 48 2081050 2K1@0==KE 208 2081098 2K1@0=> 135 2081306 2K1@0=K 55 2081441 2K1@0AK205B 5 2081496 2K1@0AK205BAO 4 2081501 2K1@0AK20BL 5 2081505 2K1@0AK20BLAO 8 2081510 2K1@0BL 1569 2081518 2K1@0BL0A8=E 53 2083087 2K1@0BL20@80=B 10 2083140 2K1@0BL25@A88 38 2083150 2K1@0BL25@E=89C@>25=L 11 2083188 2K1@0BL40==K5 50 2083199 2K1@0BL459AB285 34 2083249 2K1@0BL459AB2850A8=E 24 2083283 2K1@0BL7=0G5=85 11 2083307 2K1@0BL85@0@E8G5A:8 75 2083318 2K1@0BL87<5=5=8O 29 2083393 2K1@0BL87<5=N 42 2083422 2K1@0BL87<5=N0A8=E 20 2083464 2K1@0BL87A?8A:0 52 2083484 2K1@0BL87A?8A:00A8=E 20 2083536 2K1@0BL87A?8A:02K1>@0 10 2083556 2K1@0BL=0AB@>9:8?>C<>;G0=8N 17 2083566 2K1@0BL>1J5:BK 11 2083583 2K1@0BL?5@5=5A5==K9703>;>2>:H:0;K2@5<5=8 23 2083594 2K1@0BL?>@538AB@0B>@C 76 2083617 2K1@0BL?>AAK;:0< 117 2083693 2K1@0BLA>>1I5=85?>;L7>20B5;N 10 2083810 2K1@0BLA>>1I5=8O 10 2083820 2K1@0BLA@07C 6 2083830 2K1@0BLAB@>:C 36 2083836 2K1@0BLB8? 11 2083872 2K1@0BLM;5<5=B 24 2083883 2K1@0BLM;5<5=B0A8=E 18 2083907 2K1@0BLM;5<5=B87<5@5=8O 23 2083925 2K1@0BLM;5<5=BH:0;K2@5<5=8 22 2083948 2K1@538AB@0B>@ 5 2083970 2K1@>H5==K9 8 2083975 2K1@>H5=> 8 2083983 2K1A:;04 17 2083991 2K1AB@>:0 5 2084008 2K1B>20@ 33 2084013 2K1D09; 68 2084046 2K1D87;8F> 5 2084114 2K1M;5<5=B 9 2084119 2K2545< 8 2084128 2K2545= 26 2084136 2K2545=0 48 2084162 2K2545==0O 20 2084210 2K2545==>9 15 2084230 2K2545==K9 144 2084245 2K2545=> 45 2084389 2K2545=K 22 2084434 2K2545BAO 12 2084456 2K254O 5 2084468 2K25AB8 259 2084473 2K25AB825@B8:0;L=K9@0745;8B5;LAB@0=8F 14 2084732 2K25AB83>@87>=B0;L=K9@0745;8B5;LAB@0=8F 19 2084746 2K25AB8A?8A>: 11 2084765 2K25AB8AL 12 2084776 2K25AB8M;5<5=B 30 2084788 2K2>4 1493 2084818 2K2>40 816 2086311 2K2>45 396 2087127 2K2>4703>;>2:0 11 2087523 2K2>48;AO 9 2087534 2K2>48< 15 2087543 2K2>48<0O 14 2087558 2K2>48<0O>1;0ABL 3 2087572 2K2>48<>3> 54 2087575 2K2>48<>5 4 2087629 2K2>48<>9 14 2087633 2K2>48<><C 15 2087647 2K2>48<CN 22 2087662 2K2>48<K5 60 2087684 2K2>48<K9 304 2087744 2K2>48<K< 5 2088048 2K2>48<KE 56 2088053 2K2>48B 139 2088109 2K2>48BAO 354 2088248 2K2>48BL 429 2088602 2K2>48BL0:BC0;L=>ABL40==KE 6 2089031 2K2>48BL45B0;L=K570?8A8 9 2089037 2K2>48BL703>;>2>: 15 2089046 2K2>48BL703>;>2>:>BG5B0 9 2089061 2K2>48BL:0@B8=:C 4 2089070 2K2>48BL:>?8N107K40==KE 6 2089074 2K2>48BL=0>A8B>G5:4803@0<<K 4 2089080 2K2>48BL=0?5G0BL 22 2089084 2K2>48BL>1I858B>38 9 2089106 2K2>48BL>B1>@ 15 2089115 2K2>48BL?0@0<5B@K40==KE 6 2089130 2K2>48BL?>420;>BG5B0 9 2089136 2K2>48BL?>420;B01;8FK 9 2089145 2K2>48BL?>7=0G5=8N 14 2089154 2K2>48BL?>AAK;:5 14 2089168 2K2>48BLAO 699 2089182 2K2>48BLH0?:CB01;8FK 9 2089881 2K2>4>< 11 2089890 2K2>4>B1>@0 6 2089901 2K2>4?0@0<5B@>240==KE 6 2089907 2K2>4C 10 2089913 2K2>4OBAO 239 2089923 2K2>4OBAO157 8 2090162 2K3;O45BL 82 2090170 2K3;O48B 13 2090252 2K3@C605<>9 5 2090265 2K3@C605<K9 5 2090270 2K3@C605B 38 2090275 2K3@C605BAO 89 2090313 2K3@C60BL 40 2090402 2K3@C60BLAO 224 2090442 2K3@C60NBAO 177 2090666 2K3@C65= 32 2090843 2K3@C65=0 5 2090875 2K3@C65==>3> 8 2090880 2K3@C65==K5 16 2090888 2K3@C65==K540==K5 8 2090904 2K3@C65==K9 254 2090912 2K3@C65=K 216 2091166 2K3@C78BL 629 2091382 2K3@C78BL0A8=E 32 2092011 2K3@C78BL6C@=0;@538AB@0F88 18 2092043 2K3@C78BL7=0G5=8O 13 2092061 2K3@C78BL:>;>=:8 108 2092074 2K3@C78BL:>;>=:C 185 2092182 2K3@C78BL?@028;0 16 2092367 2K3@C7:0 540 2092383 2K3@C7:02A15@10=: 6 2092923 2K3@C7:040==KE 24 2092929 2K3@C7:040==KEA8AB5<K2708<>459AB28O 51 2092953 2K3@C7:5 204 2093004 2K3@C7:8 301 2093208 2K3@C7:>9 13 2093509 2K3@C7:C 49 2093522 2K3@C7>: 8 2093571 2K40205<>5 5 2093579 2K40205<CN 4 2093584 2K40205<K5 10 2093588 2K40205<K9 19 2093598 2K4020;>AL 5 2093617 2K4020BL 47 2093622 2K4020BL>H81:C 14 2093669 2K4020BLAO 313 2093683 2K405B 30 2093996 2K405BAO 217 2094026 2K40= 13 2094243 2K40=0 55 2094256 2K40==K5 6 2094311 2K40==K9 281 2094317 2K40==KE 5 2094598 2K40=> 197 2094603 2K40=K 5 2094800 2K40AB 80 2094805 2K40BL 100 2094885 2K40BL4>G5@=8570?8A8 5 2094985 2K40BL@5:C@A82=> 6 2094990 2K40G0 105 2094996 2K40G5 5 2095101 2K40G8 64 2095106 2K40GC 15 2095170 2K40NBAO 10 2095185 2K40QBAO 8 2095195 2K428305BAO 4 2095203 2K42830BL 8 2095207 2K42830BLAO 4 2095215 2K42865=85 8 2095219 2K42865=8O 8 2095227 2K45;5= 10 2095235 2K45;5=0 4 2095245 2K45;5=85 532 2095249 2K45;5=857=0G5=89 13 2095781 2K45;5=85B>G5: 9 2095794 2K45;5=88 12 2095803 2K45;5=8O 330 2095815 2K45;5==0O 23 2096145 2K45;5==>3> 13 2096168 2K45;5==>5 4 2096181 2K45;5==>9 63 2096185 2K45;5==K5 37 2096248 2K45;5==K540BK 29 2096285 2K45;5==K57=0G5=8O 9 2096314 2K45;5==K58=B5@20;K 9 2096323 2K45;5==K5>1;0AB8 17 2096332 2K45;5==K5>1;0AB8B01;8G=>3>4>:C<5=B0 59 2096349 2K45;5==K5AB@>:8 131 2096408 2K45;5==K5AB@>:8B01;8G=>3>?>;O 48 2096539 2K45;5==K5M;5<5=BK 29 2096587 2K45;5==K9 339 2096616 2K45;5==K9B5:AB 54 2096955 2K45;5==K< 5 2097009 2K45;5==KE 168 2097014 2K45;5=> 5 2097182 2K45;5=K 9 2097187 2K45;8BL 80 2097196 2K45;8BL2A5 9 2097276 2K45;8BL2A5AB@>:8 10 2097285 2K45;8BL7=0G8<CNG0ABL 20 2097295 2K45;8BL>1;0ABL 10 2097315 2K45;O5<0O 5 2097325 2K45;O5<>9 25 2097330 2K45;O5<K9 35 2097355 2K45;O5<KE 9 2097390 2K45;O5B 32 2097399 2K45;O5BAO 41 2097431 2K45;OBL 54 2097472 2K45;OBL>B@8F0B5;L=K5 192 2097526 2K45;OBLAO 41 2097718 2K7202H53> 47 2097759 2K7202H89 47 2097806 2K7205BAO 4 2097853 2K720; 6 2097857 2K720;8 5 2097863 2K720= 519 2097868 2K720=0 1542 2098387 2K720==>3> 14 2099929 2K720==>9 28 2099943 2K720==K9 2941 2099971 2K720==KE 4 2102912 2K720=> 956 2102916 2K720=K 77 2103872 2K720BL 670 2103949 2K720BLhttp<5B>4 10 2104619 2K720BLhttp<5B>40A8=E 10 2104629 2K720BL8A:;NG5=85 35 2104639 2K720BL8AE>4=>5A>1KB85 12 2104674 2K720BL?0C7C 11 2104686 2K720BLA@07C 6 2104697 2K720BLAO 38 2104703 2K7>2 5892 2104741 2K7>20 2069 2110633 2K7>20< 5 2112702 2K7>20<8 4 2112707 2K7>20E 35 2112711 2K7>25 1780 2112746 2K7>25< 3 2114526 2K7>25B 43 2114529 2K7>25BAO 38 2114572 2K7>2>2 342 2114610 2K7>2>< 693 2114952 2K7>2A5@25@0 9 2115645 2K7>2C 356 2115654 2K7>2K 159 2116010 2K7K205<0O 4 2116169 2K7K205<>3> 8 2116173 2K7K205<>5 10 2116181 2K7K205<>< 5 2116191 2K7K205<CN 40 2116196 2K7K205<K5 3 2116236 2K7K205<K9 169 2116239 2K7K205<KE 53 2116408 2K7K205B 628 2116461 2K7K205BAO 2657 2117089 2K7K20BL 1076 2119746 2K7K20BLAO 2829 2120822 2K7K20NB 18 2123651 2K7K20NBAO 58 2123669 2K7K20NI0O 5 2123727 2K7K20NI53> 16 2123732 2K7K20NI59 11 2123748 2K7K20NI85 6 2123759 2K7K20NI89 37 2123765 2K9B8 4 2123802 2K:;NG05B 26 2123806 2K:;NG05BAO 6 2123832 2K:;NG0B5;L 10 2123838 2K:;NG0B5;O 4 2123848 2K:;NG0BL 32 2123852 2K:;NG0BLAO 6 2123884 2K:;NG5= 100 2123890 2K:;NG5=0 30 2123990 2K:;NG5=85 64 2124020 2K:;NG5=88 9 2124084 2K:;NG5=8O 20 2124093 2K:;NG5==>< 8 2124113 2K:;NG5==><C 5 2124121 2K:;NG5==K9 190 2124126 2K:;NG5==K< 7 2124316 2K:;NG5=> 26 2124323 2K:;NG5=K 10 2124349 2K:;NG8BL 73 2124359 2K=5A5==K9 10 2124432 2K=5A5=K 10 2124442 2K=C645==K9 4 2124452 2K=C645==K<8 4 2124456 2K?040BL 69 2124460 2K?040NI53> 117 2124529 2K?040NI55 8 2124646 2K?040NI5< 60 2124654 2K?040NI89 238 2124714 2K?040NI89A?8A>:>B:@KB 10 2124952 2K?045B 4 2124962 2K?0ABL 4 2124966 2K?8A0BLAG5B 5 2124970 2K?8A:0 15 2124975 2K?8A:0AG5B0 34 2124990 2K?8AK205BAO 83 2125024 2K?8AK20BLAO 83 2125107 2K?>; 4 2125190 2K?>;=5= 426 2125194 2K?>;=5=0 797 2125620 2K?>;=5=70?CA: 9 2126417 2K?>;=5=85 5455 2126426 2K?>;=5=85< 499 2131881 2K?>;=5=85CA;>28O 5 2132380 2K?>;=5=88 762 2132385 2K?>;=5=8N 50 2133147 2K?>;=5=8O 3916 2133197 2K?>;=5==>3> 10 2137113 2K?>;=5==>5 22 2137123 2K?>;=5==>5459AB285 12 2137145 2K?>;=5==>9 14 2137157 2K?>;=5==CN 15 2137171 2K?>;=5==K5 11 2137186 2K?>;=5==K9 1691 2137197 2K?>;=5==KE 17 2138888 2K?>;=5=> 380 2138905 2K?>;=5=K 130 2139285 2K?>;=5BAO 4 2139415 2K?>;=82 132 2139419 2K?>;=82H53> 36 2139551 2K?>;=82H55AO 4 2139587 2K?>;=82H89 36 2139591 2K?>;=8; 19 2139627 2K?>;=8;0AL 6 2139646 2K?>;=8< 7 2139652 2K?>;=8<K9 7 2139659 2K?>;=8B 11 2139666 2K?>;=8BAO 19 2139677 2K?>;=8BL 883 2139696 2K?>;=8BL0CB5=B8D8:0F8N 42 2140579 2K?>;=8BL2K1>@872K?040NI53>A?8A:0 10 2140621 2K?>;=8BL2K1>@87<5=N 10 2140631 2K?>;=8BL2K1>@87<5=N@0AH8D@>2:8 10 2140641 2K?>;=8BL2K1>@87A?8A:0 10 2140651 2K?>;=8BL2K1>@87A?8A:02K1>@0 10 2140661 2K?>;=8BL459AB285 33 2140671 2K?>;=8BL7040GC 75 2140704 2K?>;=8BL7040GC8=B5@0:B82=> 28 2140779 2K?>;=8BL70?@>A 6 2140807 2K?>;=8BL:><0=4C 10 2140813 2K?>;=8BL>1<5= 10 2140823 2K?>;=8BL>1@01>B:C 10 2140833 2K?>;=8BL>1@01>B:C1>B>2 10 2140843 2K?>;=8BL>1@01>B:C7040=89 11 2140853 2K?>;=8BL>1@01>B:C>?>25I5=8O 15 2140864 2K?>;=8BL>1@01>B:C?>A;570?8A825@A89 75 2140879 2K?>;=8BL>B;>65==>5@0A?>7=020=85 14 2140954 2K?>;=8BL?0:5B 13 2140968 2K?>;=8BL?0:5BA?@><56CB>G=K<840==K<8 8 2140981 2K?>;=8BL?5@5E>4 15 2140989 2K?>;=8BL?>A;52K1>@0 5 2141004 2K?>;=8BL?>A;570:@KB8O>B1>@0 8 2141009 2K?>;=8BL?>A;5>:>=G0=8O 4 2141017 2K?>;=8BL?@8>H81:5 4 2141021 2K?>;=8BL?@>25@:C?@024>ABC?0 17 2141025 2K?>;=8BL@538AB@0F8N2K3@C7:840==KE 14 2141042 2K?>;=8BL@538AB@0F8N2K3@C7:840==KE0A8=E 14 2141056 2K?>;=8BL@538AB@0F8N8=D>@<0F8>==>9107K 33 2141070 2K?>;=8BL@538AB@0F8N8=D>@<0F8>==>9107K0A8=E 23 2141103 2K?>;=8BL@538AB@0F8NA50=A0 10 2141126 2K?>;=8BLAO 40 2141136 2K?>;=8BLD>=>2>57040=85157@0AH8@5=89 10 2141176 2K?>;=8BLD>=>2>57040=85A@0AH8@5=8O<8107K40==KE 10 2141186 2K?>;=O5<0O 35 2141196 2K?>;=O5<>3> 3 2141231 2K?>;=O5<>5 53 2141234 2K?>;=O5<>5>?>25I5=85 9 2141287 2K?>;=O5<>9 14 2141296 2K?>;=O5<CN 58 2141310 2K?>;=O5<K5 18 2141368 2K?>;=O5<K9 213 2141386 2K?>;=O5<KE 32 2141599 2K?>;=O5B 1821 2141631 2K?>;=O5BAO 3569 2143452 2K?>;=O5BAO0:BC0;870F8O 9 2147021 2K?>;=O5BAO=0G0;L=>5>1=>2;5=85 9 2147030 2K?>;=O5BAO>1@01>B:0 9 2147039 2K?>;=O5BAO>1@01>B:040==KE40B00:A5;5@0B>@>< 9 2147048 2K?>;=O5BAOB5:CI55>1=>2;5=85 9 2147057 2K?>;=O;0AL 39 2147066 2K?>;=O;8AL 4 2147105 2K?>;=O;> 10 2147109 2K?>;=O;>AL 108 2147119 2K?>;=O;AO 5 2147227 2K?>;=OBAO 15 2147232 2K?>;=OBL 2065 2147247 2K?>;=OBL>1@01>B:C?>A;570?8A825@A88 16 2149312 2K?>;=OBL>1@01>B:C?>A;570?8A825@A888AB>@8840==KE 100 2149328 2K?>;=OBLAO 4474 2149428 2K?>;=ONB 4 2153902 2K?>;=ONBAO 412 2153906 2K?>;=ONI0O 4 2154318 2K?>;=ONI0OAO 12 2154322 2K?>;=ONI53> 13 2154334 2K?>;=ONI53>AO 6 2154347 2K?>;=ONI85 4 2154353 2K?>;=ONI89 33 2154357 2K?>;=ONI89AO 18 2154390 2K?>;=OO 4 2154408 2K?@O<;5=0 4 2154412 2K?@O<;5==K9 4 2154416 2K?C:;0O 244 2154420 2K?C:;0O?>25@E=>ABL 13 2154664 2K?C:;K9 244 2154677 2K?CA:?@>4C:F88 5 2154921 2K?CAB82H53> 5 2154926 2K?CAB82H89 41 2154931 2K?CAB8BL 36 2154972 2K@010BK205B 5 2155008 2K@010BK20BL 5 2155013 2K@02=5=K 20 2155018 2K@02=820=85 416 2155038 2K@02=820=852B01;8F540==KE 9 2155454 2K@02=820=85:=>?>: 15 2155463 2K@02=820=85:=>?>::><0=4=>9?0=5;8 31 2155478 2K@02=820=85< 4 2155509 2K@02=820=85M;5<5=B>28703>;>2:>2 27 2155513 2K@02=820=88 8 2155540 2K@02=820=8O 140 2155548 2K@02=820BL 4 2155688 2K@02=820BL3@0=8FKM;5<5=B>2?>H:0;52@5<5=8 9 2155692 2K@02=820BLAO 24 2155701 2K@02=820NBAO 24 2155725 2K@065=85 1795 2155749 2K@065=85xpath 22 2157544 2K@065=852840AG5B0 10 2157566 2K@065=8528AB>G=8:540==KE 18 2157576 2K@065=8545B0;L=KE70?8A59 6 2157594 2K@065=858=45:A0AE5<K70?@>A0 39 2157600 2K@065=858AB>G=8: 20 2157639 2K@065=858B>30AE5<K70?@>A0 34 2157659 2K@065=858B>3>2KE70?8A59 6 2157693 2K@065=85:><?>=>2:840==KE 12 2157699 2K@065=85< 14 2157711 2K@065=85>B1>@0:><?>=>2:840==KEAE5<K70?@>A0 41 2157725 2K@065=85?>;O?0@0<5B@0>1;0AB8@0AH8D@>2:0:><?>=>2:840==KE 47 2157766 2K@065=85?>@O4:0AE5<K70?@>A0 43 2157813 2K@065=85?@54AB02;5=8O 28 2157856 2K@065=85?@85<=8: 20 2157884 2K@065=85AE5<K70?@>A0 140 2157904 2K@065=85C?>@O4>G820=8O:><?>=>2:840==KE 55 2158044 2K@065=88 111 2158099 2K@065=89 162 2158210 2K@065=8N 155 2158372 2K@065=8O 657 2158527 2K@065=8O8=45:A0 8 2159184 2K@065=8O8=45:A0AE5<K70?@>A0 58 2159192 2K@065=8O8B>3>2 13 2159250 2K@065=8O8B>3>2AE5<K70?@>A0 49 2159263 2K@065=8O< 28 2159312 2K@065=8O>B1>@0:><?>=>2:840==KE 9 2159340 2K@065=8O>B1>@0:><?>=>2:840==KEAE5<K70?@>A0 57 2159349 2K@065=8O?>;59 13 2159406 2K@065=8O?>;59?0@0<5B@0>1;0AB8@0AH8D@>2:0:><?>=>2:840==KE 63 2159419 2K@065=8O?>@O4:0AE5<K70?@>A0 54 2159482 2K@065=8OAE5<K70?@>A0 53 2159536 2K@065=8OC?>@O4>G820=8O 25 2159589 2K@065=8OC?>@O4>G820=8O:><?>=>2:840==KE 103 2159614 2K@065=8OE 57 2159717 2K@065=L5 162 2159774 2K@078BL 16 2159936 2K@5705BAO 17 2159952 2K@570BL 10 2159969 2K@570BLAO 27 2159979 2K@570NBAO 6 2160006 2K@>2=5=0 7 2160012 2K@>2=5==K9 21 2160019 2K@>2=5==K<8 5 2160040 2K@>2=5=K 4 2160045 2K@>2=OBL 5 2160049 2KA>:0O 43 2160054 2KA>:89 543 2160097 2KA>:>3> 17 2160640 2KA>:>5 35 2160657 2KA>:CN 18 2160692 2KA>B0 1185 2160710 2KA>B02<5AOF0E 17 2161895 2KA>B02AB@>:0EB01;8FK 21 2161912 2KA>B03>@;02>@>=:8 9 2161933 2KA>B0703>;>2:0 40 2161942 2KA>B0703>;>2:0M;5<5=B0 18 2161982 2KA>B0?>420;0 20 2162000 2KA>B0?>;O 18 2162020 2KA>B0A?8A:02K1>@0 31 2162038 2KA>B0AB@0=8FK 11 2162069 2KA>B0AB@>:8 11 2162080 2KA>B0B01;8FK 25 2162091 2KA>B0H0?:8 20 2162116 2KA>B0M;5<5=B0 18 2162136 2KA>B0OG59:8 32 2162154 2KA>B5 54 2162186 2KA>B>9 37 2162240 2KA>BC 380 2162277 2KA>BK 203 2162657 2KAB02;5= 4 2162860 2KAB02;5==K9 64 2162864 2KAB02;5=> 54 2162928 2KAB02;5=K 6 2162982 2KAB02;O5B 8 2162988 2KAB02;O5BAO 6 2162996 2KAB02;OBL 16 2163002 2KAB02;OBLAO 6 2163018 2KABC?05B 360 2163024 2KABC?0;> 10 2163384 2KABC?0BL 621 2163394 2KABC?0NB 19 2164015 2KABC?0NI0O 11 2164034 2KABC?0NI59 42 2164045 2KABC?0NI89 58 2164087 2KABC?0NI8< 5 2164145 2KAK;0BLAO 8 2164150 2KB5:05B 6 2164158 2KB5:0BL 6 2164164 2KB5A=5=85 11 2164170 2KB5A=5=8O 11 2164181 2KB5A=O5<K9 6 2164192 2KB5A=O5<KE 6 2164198 2KB5A=O5BAO 5 2164204 2KB5A=OBLAO 5 2164209 2KB5A=ONI85 6 2164214 2KB5A=ONI85284K@0AG5B0 199 2164220 2KB5A=ONI85284K@0AG5B0AB@>:0 84 2164419 2KB5A=ONI89 56 2164503 2KB5A=ONI8E 50 2164559 2KE>4 108 2164609 2KE>40 45 2164717 2KE>45 37 2164762 2KE>48742>9=>3>F8:;0 6 2164799 2KE>48B 65 2164805 2KE>48BL 74 2164870 2KE>4=>3> 40 2164944 2KE>4=>9 97 2164984 2KE>4=>9?>B>: 5 2165081 2KE>4=K5 9 2165086 2KE>4=K540==K5 96 2165095 2KE>4=K< 12 2165191 2KE>4=KE 8 2165203 2KE>4>2 4 2165211 2KE>4OI59 16 2165215 2KE>4OI89 16 2165231 2KG5B 5 2165247 2KG5B>< 5 2165252 2KG8A;5= 4 2165257 2KG8A;5=85 375 2165261 2KG8A;5=88 24 2165636 2KG8A;5=89 26 2165660 2KG8A;5=8N 11 2165686 2KG8A;5=8O 244 2165697 2KG8A;5=8OE 5 2165941 2KG8A;5==0O 5 2165946 2KG8A;5==>3> 5 2165951 2KG8A;5==CN 15 2165956 2KG8A;5==K5 12 2165971 2KG8A;5==K9 66 2165983 2KG8A;5==K<8 4 2166049 2KG8A;5=> 5 2166053 2KG8A;5=K 10 2166058 2KG8A;5=L5 26 2166068 2KG8A;8BL 97 2166094 2KG8A;8BL2K@065=85xpath 22 2166191 2KG8A;8BL2K@065=85A3@C??8@>2:>9<0AA82 6 2166213 2KG8A;8BLA>E@0=O5<>57=0G5=85?0@>;O?>;L7>20B5;O 17 2166219 2KG8A;O5<>3> 34 2166236 2KG8A;O5<>5 15 2166270 2KG8A;O5<>5?>;5AE5<K:><?>=>2:840==KE 130 2166285 2KG8A;O5<>< 5 2166415 2KG8A;O5<K5?>;O 24 2166420 2KG8A;O5<K5?>;OAE5<K:><?>=>2:840==KE 81 2166444 2KG8A;O5<K9 63 2166525 2KG8A;O5<KE 18 2166588 2KG8A;O5B 155 2166606 2KG8A;O5BAO 194 2166761 2KG8A;O; 36 2166955 2KG8A;OBL 224 2166991 2KG8A;OBLAO 251 2167215 2KG8A;ONBAO 27 2167466 2KG8B05<0O 5 2167493 2KG8B05<K5B8?K 5 2167498 2KG8B05<K9 5 2167503 2KG8B05B 5 2167508 2KG8B05BAO 5 2167513 2KG8B0=85 20 2167518 2KG8B0=8O 4 2167538 2KG8B0BL 5 2167542 2KG8B0BLAO 46 2167547 2KH0 335 2167593 2KH5 335 2167928 2KH5; 4 2168263 2KH5?5@5G8A;5==K5 214 2168267 2KH5?5@5G8A;5==K9 220 2168481 2KH5?5@5G8A;5==KE 6 2168701 2KH5?@82545==>< 12 2168707 2KH5?@82545==K9 12 2168719 2KH5AB>OI53> 30 2168731 2KH5AB>OI5<C 6 2168761 2KH5AB>OI89 126 2168767 2KH5AB>OI8E 95 2168893 2KO2;5= 4 2168988 2KO2;5=0 4 2168992 2KO2;5=85 8 2168996 2KO2;5=88 4 2169004 2KO2;5=8O 4 2169008 2KO2;5==K9 14 2169012 2KO2;5=> 9 2169026 2KOA=8BL 10 2169035 2L5B=0< 12 2169045 2L5B=0<A:89 38 2169057 2L5B=0<A:>3> 14 2169095 2OG59:5 9 2169109 3 26 2169118 3030 13 2169144 307>2>9 12 2169157 307>2K9 12 2169169 30;5@5O 17 2169181 30;8A89A:89 14 2169198 30;>G:0 10 2169212 30;>G:8 5 2169222 30=B 604 2169227 30=B0 604 2169831 30?0 9 2170435 30@0=B8@>20= 4 2170444 30@0=B8@>20=0 4 2170448 30@0=B8@>20==>9 4 2170452 30@0=B8@>20==K9 8 2170456 30@0=B8@>20BL 11 2170464 30@0=B8@>20BLAO 152 2170475 30@0=B8@C5BAO 152 2170627 31 35 2170779 320B5<0;0 12 2170814 32>748 5 2170826 32>748B8 5 2170831 32>748BL 5 2170836 32>74L 5 2170841 33 17 2170846 3333 29 2170863 3333<<44 5 2170892 3333<<44GG<<AA 10 2170897 345 827 2170907 3458A:0BL 15 2171734 345?@>25@OBL 5 2171749 35=5@0; 12 2171754 35=5@0B>@ 22 2171766 35=5@0B>@0 9 2171788 35=5@0B>@<0:5B0:><?>=>2:840==KE 12 2171797 35=5@0B>@<0:5B0:><?>=>2:840==KE4;O:>;;5:F887=0G5=89 11 2171809 35=5@0B>@A;CG09=KE?0@>;59 16 2171820 35=5@0B>@A;CG09=KEG8A5; 23 2171836 35=5@0F88 138 2171859 35=5@0F8N 4 2171997 35=5@0F8O 154 2172001 35=5@8@>20;0AL 77 2172155 35=5@8@>20BL 439 2172232 35=5@8@>20BLAO 1272 2172671 35=5@8@C5<>3> 8 2173943 35=5@8@C5<><C 4 2173951 35=5@8@C5<K9 12 2173955 35=5@8@C5B 430 2173967 35=5@8@C5BcO 4 2174397 35=5@8@C5BAO 1173 2174401 35=5@8@CBAO 4 2175574 35=5@8@CNBAO 15 2175578 35=5@8@CNI5< 5 2175593 35=5@8@CNI89 5 2175598 35=8B82 12 2175603 35>3@0D8G5A:0O 28 2175615 35>3@0D8G5A:0OAE5<0 264 2175643 35>3@0D8G5A:85 9 2175907 35>3@0D8G5A:85:>>@48=0BK 125 2175916 35>3@0D8G5A:89 508 2176041 35>3@0D8G5A:8< 9 2176549 35>3@0D8G5A:8E 4 2176558 35>3@0D8G5A:>3> 4 2176562 35>3@0D8G5A:>9 446 2176566 35>3@0D8G5A:CN 21 2177012 35>7>= 35 2177033 35>7>=0 63 2177068 35>7>=5 10 2177131 35>7>=>9 4 2177141 35>7>=C 8 2177145 35>7>=K 62 2177153 35>;>:0F88 5 2177215 35>?>78F8>=8@>20=85 19 2177220 35>?>78F8>=8@>20=852D>=>2><@568<5 9 2177239 35>?>78F8>=8@>20=85< 7 2177248 35>?>78F8>=8@>20=8O 59 2177255 35@<0= 11 2177314 35@<0=89 17 2177325 35@<0=8O 17 2177342 35@F53>28=0 16 2177359 3830=B 46 2177375 38?5@AAK;:0 547 2177421 38?5@AAK;:0703>;>2:0 9 2177968 38?5@AAK;:0:><0=4=>9?0=5;8 9 2177977 38?5@AAK;:0<=>65AB25==KE7=0G5=89 9 2177986 38?5@AAK;:0?5@5=5A5==>3>703>;>2:0H:0;K2@5<5=8 13 2177995 38?5@AAK;:0M;5<5=B087<5@5=8O 17 2178008 38?5@AAK;:0M;5<5=B0H:0;K2@5<5=8 18 2178025 38?5@AAK;:0OG59:8 9 2178043 38?5@AAK;:5 6 2178052 38?5@AAK;:8 144 2178058 38?5@AAK;:>9 51 2178202 38?5@AAK;:C 92 2178253 38?5@AAK;>: 37 2178345 38?>B57 12 2178382 38?>B570 21 2178394 38?>B57K 4 2178415 38AB>3@0<< 22 2178419 38AB>3@0<<0 215 2178441 38AB>3@0<<03>@87>=B0;L=0O 29 2178656 38AB>3@0<<03>@87>=B0;L=0O>1J5<=0O 57 2178685 38AB>3@0<<0=>@<8@>20==0O 17 2178742 38AB>3@0<<0=>@<8@>20==0O3>@87>=B0;L=0O 17 2178759 38AB>3@0<<0=>@<8@>20==0O3>@87>=B0;L=0O>1J5<=0O 45 2178776 38AB>3@0<<0=>@<8@>20==0O>1J5<=0O 45 2178821 38AB>3@0<<0>1J5<=0O 75 2178866 38AB>3@0<<0A=0:>?;5=85< 45 2178941 38AB>3@0<<0A=0:>?;5=85<3>@87>=B0;L=0O 45 2178986 38AB>3@0<<0A=0:>?;5=85<3>@87>=B0;L=0O>1J5<=0O 45 2179031 38AB>3@0<<0A=0:>?;5=85<>1J5<=0O 45 2179076 38AB>3@0<<0E 65 2179121 38AB>3@0<<5 8 2179186 38AB>3@0<<>9 4 2179194 38AB>3@0<<K 8 2179198 38D 38 2179206 3;02 10 2179244 3;020 43 2179254 3;025 23 2179297 3;02=0O 9 2179320 3;02=0OD>@<0 6 2179329 3;02=>3> 209 2179335 3;02=>5 312 2179544 3;02=>9 12 2179856 3;02=>< 50 2179868 3;02=><C 25 2179918 3;02=CN 13 2179943 3;02=K5 9 2179956 3;02=K9 378 2179965 3;02=K91CE30;B5@ 8 2180343 3;02=K98=B5@D59A 19 2180351 3;02=K9<5=5465@ 11 2180370 3;02=K9AB8;L 15 2180381 3;02=K9C75; 36 2180396 3;02=K< 44 2180432 3;02C 6 2180476 3;02K 4 2180482 3;04:0O 4 2180486 3;04:0O:@820O 32 2180490 3;04:89 12 2180522 3;04:8E 4 2180534 3;04:>9 4 2180538 3;07 4 2180542 3;070 4 2180546 3;0A=>9 6 2180550 3;0A=K9 6 2180556 3;>1 7 2180562 3;>10 7 2180569 3;>10;L=0O 9 2180576 3;>10;L=89 879 2180585 3;>10;L=>3> 718 2181464 3;>10;L=>9 5 2182182 3;>10;L=>< 21 2182187 3;>10;L=><C 156 2182208 3;>10;L=CN 22 2182364 3;>10;L=K5 21 2182386 3;>10;L=K5AB0=40@B=K5:><0=4K 9 2182407 3;>10;L=K9 5649 2182416 3;>10;L=K9:;NG:0;5=40@O 23 2188065 3;>10;L=K9:;NG:>=B0:B0 14 2188088 3;>10;L=K9:;NGA>1KB8O:0;5=40@O 9 2188102 3;>10;L=K9?>8A: 13 2188111 3;>10;L=K< 4 2188124 3;>10;L=KE 23 2188128 3;>1@01>B:0>?>25I5=8O 7 2188151 3;C18=0 239 2188158 3;C18=0>1J5<=>94803@0<<K 30 2188397 3;C18=0F25B0 47 2188427 3;C18=5 172 2188474 3;C18==K9 5 2188646 3;C18==KE 5 2188651 3;C18=C 15 2188656 3;C18=K 4 2188671 3;C1>:89 261 2188675 3;C1>:>3> 219 2188936 3;C1>:>5 168 2189155 3;C1>:>5:>?8@>20=85 210 2189323 3;C75; 10 2189533 3=>< 12 2189543 3=><0 12 2189555 3> 43 2189567 3>2>@8B 6 2189610 3>2>@8BL 6 2189616 3>4 685 2189622 3>40 266 2190307 3>40< 35 2190573 3>40E 4 2190608 3>4>2>9 4 2190612 3>4>< 4 2190616 3>4>B=0G0;0?5@8>40 9 2190620 3>4>B=0G0;0?5@8>40445 9 2190629 3>4C 88 2190638 3>4K 5 2190726 3>;40 11 2190731 3>;;0=4A:89 16 2190742 3>;>2=>9 4 2190758 3>;>A 60 2190762 3>;>A0 44 2190822 3>;>A>2 4 2190866 3>;>A>2>9 4 2190870 3>;C10 42 2190874 3>;C1>9 42 2190916 3>;C1>9A:@0A=K<>BB5=:>< 16 2190958 3>;C1>9A>AB0;L=K<>BB5=:>< 11 2190974 3>=4C@0A 12 2190985 3>=:>=3 18 2190997 3>@ 6 2191015 3>@0 6 2191021 3>@074> 10 2191027 3>@074K9 10 2191037 3>@87>=B0;5= 4 2191047 3>@87>=B0;8 166 2191051 3>@87>=B0;L 166 2191217 3>@87>=B0;L=0O 84 2191383 3>@87>=B0;L=0O2A5340 9 2191467 3>@87>=B0;L=0O5A;82>7<>6=> 9 2191476 3>@87>=B0;L=0O?>445@6:0<0AHB010 23 2191485 3>@87>=B0;L=0O?>;>A0?@>:@CB:8 45 2191508 3>@87>=B0;L=0OB>G=>ABL 9 2191553 3>@87>=B0;L=89 148 2191562 3>@87>=B0;L=> 132 2191710 3>@87>=B0;L=>3> 134 2191842 3>@87>=B0;L=>5 89 2191976 3>@87>=B0;L=>5?>;>65=85 364 2192065 3>@87>=B0;L=>5?>;>65=8523@C??5 60 2192429 3>@87>=B0;L=>5?>;>65=852:>;>=:5 11 2192489 3>@87>=B0;L=>5?>;>65=852?>420;5 24 2192500 3>@87>=B0;L=>5?>;>65=852H0?:5 33 2192524 3>@87>=B0;L=>5?>;>65=85:0@B8=:8 21 2192557 3>@87>=B0;L=>5?>;>65=85?>4G8=5==KE 27 2192578 3>@87>=B0;L=>5?>;>65=85M;5<5=B0 89 2192605 3>@87>=B0;L=>5@0A?>;>65=85>1I8E8B>3>2 15 2192694 3>@87>=B0;L=>9 86 2192709 3>@87>=B0;L=>< 4 2192795 3>@87>=B0;L=><C 14 2192799 3>@87>=B0;L=CN 25 2192813 3>@87>=B0;L=K5 19 2192838 3>@87>=B0;L=K5;8=88 29 2192857 3>@87>=B0;L=K5;8=882B01;8F540==KE 9 2192886 3>@87>=B0;L=K9 652 2192895 3>@87>=B0;L=K98=B5@20; 27 2193547 3>@87>=B0;L=K9>BABC? 27 2193574 3>@87>=B0;L=K9C@>25=L 5 2193601 3>@87>=B0;L=K9H03A5B:8 9 2193606 3>@87>=B0;L=K< 4 2193615 3>@87>=B0;L=K<8 8 2193619 3>@87>=B0;L=KE 48 2193627 3>@>4 53 2193675 3>@>40 11 2193728 3>@OG89 12 2193739 3>@OG8E 12 2193751 3>A=><5@ 23 2193763 3>AC40@AB20E 10 2193786 3>AC40@AB2> 10 2193796 3>B 19 2193806 3>B>2 19 2193825 3>B>20 4 2193844 3>B>20:>B>1@065=8N 9 2193848 3>B>289 23 2193857 3>B>28;8AL 4 2193880 3>B>28B8 19 2193884 3>B>28BLAO 4 2193903 3>B>2=>ABL 30 2193907 3>B>2> 23 2193937 3>B>2K5 6 2193960 3>B>2K9 99 2193966 3>B>2KE 24 2194065 3@040F88 4 2194089 3@040F8O 4 2194093 3@0485=B 78 2194097 3@0485=B=0O 38 2194175 3@0485=B=>9 28 2194213 3@0485=B=K9 64 2194241 3@04CA 60 2194305 3@04CA0< 4 2194365 3@04CA0E 59 2194369 3@0640=A:89 4 2194428 3@0640=A:89AC?@C3 9 2194432 3@0<< 9 2194441 3@0<<0B8: 76 2194450 3@0<<0B8:0 76 2194526 3@0<<0B8:8 33 2194602 3@0<<0B8:8@0A?>7=020=8O@5G8 6 2194635 3@0<<0B8:C 18 2194641 3@0<<>2 6 2194659 3@0=8F 67 2194665 3@0=8F0 1289 2194732 3@0=8F00:B82=>3>>:=0 11 2196021 3@0=8F02B>@>3>M;5<5=B0 12 2196032 3@0=8F087<5=5=8O0;3>@8B<0@5H5=8O 21 2196044 3@0=8F0< 24 2196065 3@0=8F0<8 18 2196089 3@0=8F0=50:B82=>3>>:=0 11 2196107 3@0=8F0?5@2>3>M;5<5=B0 12 2196118 3@0=8F0A25@EC 32 2196130 3@0=8F0A;520 32 2196162 3@0=8F0A=87C 33 2196194 3@0=8F0A?@020 33 2196227 3@0=8F0E 5 2196260 3@0=8F0M;5<5=B0C?@02;5=8O 58 2196265 3@0=8F5 58 2196323 3@0=8F59 71 2196381 3@0=8FC 93 2196452 3@0=8FK 685 2196545 3@0=8FK?>A;54>20B5;L=>AB8 6 2197230 3@0=8FO 58 2197236 3@0=8G=89 46 2197294 3@0=8G=>3> 42 2197340 3@0=8G=>5 18 2197382 3@0=8G=><C 4 2197400 3@0=8G=K5 16 2197404 3@0=8G=K9 76 2197420 3@0=B 5 2197496 3@0D 372 2197501 3@0D0 372 2197873 3@0D0< 5 2198245 3@0D0<8 5 2198250 3@0D5 28 2198255 3@0D8: 331 2198283 3@0D8:0 329 2198614 3@0D8:0E 14 2198943 3@0D8:5 4 2198957 3@0D8:8 8 2198961 3@0D8:>2 4 2198969 3@0D8:>< 5 2198973 3@0D8:?>H030< 50 2198978 3@0D8:@01>BK 7 2199028 3@0D8:A=0:>?;5=85< 45 2199035 3@0D8:A>1;0ABO<8 50 2199080 3@0D8:A>1;0ABO<88=0:>?;5=85< 45 2199130 3@0D8:A>1;0ABO<8=>@<8@>20==K9 45 2199175 3@0D8G5A:0O 39 2199220 3@0D8G5A:0OAE5<0 232 2199259 3@0D8G5A:8 4 2199491 3@0D8G5A:89 1229 2199495 3@0D8G5A:>3> 21 2200724 3@0D8G5A:>9 1160 2200745 3@0D8G5A:>< 9 2201905 3@0D8G5A:CN 39 2201914 3@0DAB2> 4 2201953 3@0DC 10 2201957 3@0DK 44 2201967 3@5=;0=48O 12 2202011 3@5=;0=4A:89 14 2202023 3@5F8O 12 2202037 3@5G5A:89 20 2202049 3@825= 8 2202069 3@82=0 14 2202077 3@82=K 8 2202091 3@83>@80=A:89 5 2202099 3@83>@80=A:>3> 5 2202104 3@8= 7 2202109 3@8=C 6 2202116 3@8D5;L=> 35 2202122 3@8D5;L=>A5@K9 11 2202157 3@8D5;L=>A8=89 11 2202168 3@C78=A:89 38 2202179 3@C78=A:>3> 14 2202217 3@C78O 12 2202231 3@C?? 504 2202243 3@C??0 2773 2202747 3@C??02K1@0==KE?>;59:><?>=>2:840==KE 111 2205520 3@C??04>ABC?=KEB01;8FAE5<K70?@>A0 31 2205631 3@C??08 9 2205662 3@C??08;8 9 2205671 3@C??0:=>?>: 30 2205680 3@C??0:>;>=>: 17 2205710 3@C??0:><0=4 283 2205727 3@C??0< 33 2206010 3@C??0<8 12 2206043 3@C??0<8M;5<5=B0< 9 2206055 3@C??0<>45;8 25 2206064 3@C??0<>45;8xs 843 2206089 3@C??0=0:>?;5=8O 9 2206932 3@C??0=0:>?;5=8O24803@0<<5 5 2206941 3@C??0=0AB@>9:8A>AB0208=B5@D59A0:;85=BA:>3>?@8;>65=8O 72 2206946 3@C??0=5 9 2207018 3@C??0>AB0B:0 10 2207027 3@C??0?>;L7>20B5;LA:8E=0AB@>5: 15 2207037 3@C??0@57C;LB0B0?>8A:0?>@53C;O@=><C2K@065=8N 24 2207052 3@C??0D>@<K 284 2207076 3@C??0E 21 2207360 3@C??0M;5<5=B>2>B1>@0:><?>=>2:840==KE 192 2207381 3@C??5 248 2207573 3@C??8@>20BL 43 2207821 3@C??8@>20BLAO 5 2207864 3@C??8@>2:0 1630 2207869 3@C??8@>2:04803@0<<K:><?>=>2:840==KE 284 2209499 3@C??8@>2:04803@0<<K<0:5B0:><?>=>2:840==KE 159 2209783 3@C??8@>2:0:>;>=>: 24 2209942 3@C??8@>2:0:><?>=>2:840==KE 301 2209966 3@C??8@>2:0< 29 2210267 3@C??8@>2:0<0:5B0:><?>=>2:840==KE 150 2210296 3@C??8@>2:0<8 5 2210446 3@C??8@>2:0?>4G8=5==KEM;5<5=B>2D>@<K 37 2210451 3@C??8@>2:0@5AC@A0 11 2210488 3@C??8@>2:0B01;8FK:><?>=>2:840==KE 296 2210499 3@C??8@>2:0B01;8FK<0:5B0:><?>=>2:840==KE 147 2210795 3@C??8@>2:0E 45 2210942 3@C??8@>2:0F8D@G8A5; 9 2210987 3@C??8@>2:5 164 2210996 3@C??8@>2:8 960 2211160 3@C??8@>2:84803@0<<K<0:5B0:><?>=>2:840==KE 74 2212120 3@C??8@>2:84;O7=0G5=893@C??8@>2>: 8 2212194 3@C??8@>2:8<0:5B0:><?>=>2:840==KE 74 2212202 3@C??8@>2:>9 19 2212276 3@C??8@>2:C 96 2212295 3@C??8@>2>: 197 2212391 3@C??8@C5<K5 6 2212588 3@C??8@C5<K9 31 2212594 3@C??8@C5<K<8 6 2212625 3@C??8@C5<KE 29 2212631 3@C??8@C5B 5 2212660 3@C??8@CNI89 24 2212665 3@C??8@CNI8< 24 2212689 3@C??>20O 34 2212713 3@C??>20O>1@01>B:0 10 2212747 3@C??>2>3> 19 2212757 3@C??>2>5 25 2212776 3@C??>2>5>1AC645=85 11 2212801 3@C??>2>9 141 2212812 3@C??>2K5 10 2212953 3@C??>2K< 19 2212963 3@C??>2KE 29 2212982 3@C??>9 88 2213011 3@C??C 249 2213099 3@C??K 1501 2213348 3@C??K8M;5<5=BK 41 2214849 3@C??K:><0=4 9 2214890 3@C??KA25@EC 18 2214899 3AG 5 2214917 3CO@0B8 14 2214922 4 617 2214936 40 96 2215553 4020; 4 2215649 4020BL 29 2215653 405B 16 2215682 4065 209 2215698 40;55 253 2215907 40;5:89 122 2216160 40;5:> 5 2216282 40;L=53> 4 2216287 40;L=59H0O 15 2216291 40;L=59H53> 91 2216306 40;L=59H55 253 2216397 40;L=59H59 9 2216650 40;L=59H5< 152 2216659 40;L=59H85 4 2216811 40;L=59H89 295 2216815 40;L=59H8<8 4 2217110 40;L=59H8E 6 2217114 40;L=59HCN 4 2217120 40;L=89 122 2217124 40;L=OO 4 2217246 40;L=OOA2O7L 9 2217250 40;L=V9 121 2217259 40;LH5 117 2217380 40<? 29 2217497 40<?0 15 2217526 40<?K 10 2217541 40=5B 49 2217551 40=5B>B<5=0 9 2217600 40=8O 12 2217609 40==0O 674 2217621 40==>3> 8579 2218295 40==>5 3094 2226874 40==>9 1166 2229968 40==>< 1658 2231134 40==><C 4859 2232792 40==CN 152 2237651 40==K5 22700 2237803 40==K504@5A0 92 2260503 40==K50:BC0;L=K 7 2260595 40==K50CB5=B8D8:0F88 15 2260602 40==K5254CI8E@538AB@>2 9 2260617 40==K525@A88 56 2260626 40==K52K1>@0 103 2260682 40==K53@0D8:0 6 2260785 40==K53@C??>2>9>1@01>B:8:><?>=>2:840==KE 24 2260791 40==K570?>;=5=8O 155 2260815 40==K570?@>A0?>45;8BLAO 46 2260970 40==K570?@>A0?>45;8BLAO70?CA:0 9 2261016 40==K570?CA:0 5 2261025 40==K57=0G5=8O4803@0<<K30=B0 24 2261030 40==K587>1@065=8O 9 2261054 40==K58=D>@<0F8>==>9107K@01>BKA@5GLN 9 2261063 40==K5:0;5=40@O 44 2261072 40==K5:0;5=40@OCG5B=>970?8A8 39 2261116 40==K5:0@B8=:8 28 2261155 40==K5:28B0=F882AB@>5==>9?>:C?:8 36 2261183 40==K5:><?LNB5@0 13 2261219 40==K5:>=B0:B0 150 2261232 40==K5:>=B0:B0CG5B=>970?8A8 38 2261382 40==K5:>=D83C@0F88 4 2261420 40==K5<5AB>?>;>65=8O 70 2261424 40==K5<C;LB8<5480 80 2261494 40==K5?5@5E>40?>=02830F8>==>9AAK;:5 46 2261574 40==K5?5@5E>40?>=02830F8>==>9AAK;:570?CA:0 14 2261620 40==K5?>;L7>20B5;O>A 22 2261634 40==K5?@8;>65=8O 14 2261656 40==K5@0AH8@5=8O 4 2261670 40==K5@0AH8D@>2:8 46 2261674 40==K5@0AH8D@>2:8:><?>=>2:840==KE 50 2261720 40==K5@538AB@0F88 5 2261770 40==K5@538AB@0F888=D>@<0F8>==>9107KA8AB5<K2708<>459AB28O 30 2261775 40==K5@538AB@0F88A8AB5<K2708<>459AB28O 8 2261805 40==K5A>1KB8O 5 2261813 40==K5A>1KB8O:0;5=40@O 89 2261818 40==K5A>1KB8O:0;5=40@OCG5B=>970?8A8 35 2261907 40==K5AB@>:8 149 2261942 40==K5D;06:0 11 2262091 40==K5D>@<K27=0G5=85 37 2262102 40==K5D>@<K45@52> 36 2262139 40==K5D>@<K:>;;5:F8O 160 2262175 40==K5D>@<K:>;;5:F8OM;5<5=B>245@520 61 2262335 40==K5D>@<KAB@C:BC@0 72 2262396 40==K5D>@<KAB@C:BC@0A:>;;5:F859 139 2262468 40==K5D>@<KM;5<5=B45@520 70 2262607 40==K5D>@<KM;5<5=B:>;;5:F88 123 2262677 40==K5D@07 13 2262800 40==K5D@07K@0A?>7=020=8O@5G8 34 2262813 40==K5E 5 2262847 40==K9 9513 2262852 40==K< 1260 2272365 40==K<8 887 2273625 40==KE 16295 2274512 40=KE 4 2290807 40@BA 10 2290811 40AB 5 2290821 40B 237 2290826 40B0 8754 2291063 40B00:BC0;L=>AB8 10 2299817 40B02@5<O 74 2299827 40B03@0=8FK 6 2299901 40B03@0D8:0 14 2299907 40B04;O?@>25@:8 5 2299921 40B04>:C<5=B0 20 2299926 40B07025@H5=8O?>A;54=53>70?CA:0 5 2299946 40B070<5I5=8O 26 2299951 40B087<5=5=8O 27 2299977 40B08=B5@20;0 12 2300004 40B08A?>;=5=8O 5 2300016 40B0:>= 33 2300021 40B0:>=F0 21 2300054 40B0:C@A0 6 2300075 40B0< 71 2300081 40B0<8 57 2300152 40B0=0?><8=0=8O 14 2300209 40B0=0G 28 2300223 40B0=0G0;0 133 2300251 40B0=0G0;0?5@8>40 23 2300384 40B0=0G0;0?>A;54=53>70?CA:0 5 2300407 40B0>1<5=0 50 2300412 40B0>:>=G0=8O 127 2300462 40B0>:>=G0=8O?5@8>40 23 2300589 40B0>B?@02:8 25 2300612 40B0>B?@02:8=0G0;> 9 2300637 40B0>B?@02:8>:>=G0=85 9 2300646 40B0>B?@02;5=85utc 9 2300655 40B0>B?@02;5=8O 26 2300664 40B0>B?@02;5=8O27>=5>B?@028B5;O 9 2300690 40B0>G8AB:8 11 2300699 40B0?;0B560 6 2300710 40B0?>;CG5=8O 50 2300716 40B0?>A;54=59>G8AB:8 18 2300766 40B0?>AB@>5=8O 11 2300784 40B0?>O2;5=8OC=825@A0;L=>52@5<O 9 2300795 40B0?@8>1@5B5=8O 9 2300804 40B0@>645=8O 13 2300813 40B0A2545=89 6 2300826 40B0A>740=8O 15 2300832 40B0CAB0=>2:8?0@>;O 57 2300847 40B0CAB0@520=8O 14 2300904 40B0CAB0@520=8O=0G0;> 9 2300918 40B0CAB0@520=8O>:>=G0=85 10 2300927 40B5 209 2300937 40B5;L=K9 16 2301146 40B82 12 2301162 40B>9 183 2301174 40BA:89 14 2301357 40BC 619 2301371 40BK 951 2301990 40BK:>=F0 6 2302941 40BK=0G0;0 6 2302947 40BL 5 2302953 42 14 2302958 420 1021 2302972 4204F0BL 6 2303993 42064K 63 2303999 4240==K5 16 2304062 425 798 2304078 425=04F0B>3> 6 2304876 425=04F0BK9 7 2304882 42830; 4 2304889 42830BL 4 2304893 42830BLAO 5 2304897 42865=85 668 2304902 42865=88 51 2305570 42865=89 252 2305621 42865=8O 345 2305873 42865=8O1C 20 2306218 42865=8O83@0=8FK?5@8>40 19 2306238 42865=8O< 10 2306257 42865=8OAAC1:>=B> 12 2306267 42865=L5 252 2306279 4286:0 46 2306531 4286>: 50 2306577 42>5B>G85 47 2306627 42>5B>G85< 12 2306674 42>5B>G8O 17 2306686 42>8G=0O 6 2306703 42>8G=0OAB@>:0 6 2306709 42>8G=>3> 38 2306715 42>8G=>5 9 2306753 42>8G=>< 40 2306762 42>8G=><C 25 2306802 42>8G=CN 5 2306827 42>8G=K5 326 2306832 42>8G=K540==K5 993 2307158 42>8G=K540==K5?>4?8A8 9 2308151 42>8G=K9 1255 2308160 42>8G=K< 4 2309415 42>8G=K<8 42 2309419 42>8G=KE 874 2309461 42>9=0O 42 2310335 42>9=>5 4 2310377 42>9=>5?>4G5@:820=85 9 2310381 42>9=>9 208 2310390 42>9=>< 91 2310598 42>9=K5 8 2310689 42>9=K<8 11 2310697 42>9=KE 36 2310708 42C< 38 2310744 42C<5@=K5 4 2310782 42C<5@=K9 28 2310786 42C<8 6 2310814 42C<O 94 2310820 42CAB>@>==59 22 2310914 42CAB>@>==89 34 2310936 42CAB>@>==NN 8 2310970 42CAB>@>==OO 4 2310978 42CAB>@>==OO?5G0BL 35 2310982 42CE 549 2311017 42CE1C:25==>5 6 2311566 42CE1C:25==K9 18 2311572 42CE:>=5G=0O 8 2311590 42CE:>=5G=K9 8 2311598 42CE<5@=K5 24 2311606 42CE<5@=K9 30 2311630 42CE?>78F8>==>3> 4 2311660 42CE?>78F8>==K9 4 2311664 42CED0:B>@=0O 36 2311668 42CED0:B>@=K9 36 2311704 42CO7KG=>5 5 2311740 42CO7KG=K9 8 2311745 42CO7KG=K< 3 2311753 44 34 2311756 44tGG 4 2311790 442 13 2311794 444 6 2311807 4444 10 2311813 450:B828@>20= 4 2311823 450:B828@>20==K9 4 2311827 4515B 118 2311831 4515B0 71 2311949 4515B:@548B 11 2312020 4515B>289 45 2312031 4515B>2>3> 40 2312076 4515B>2>5 5 2312116 4515B>2><C 5 2312121 4515B>2K9 151 2312126 4515B>2K< 8 2312277 4515B>2KE 10 2312285 4515B>< 4 2312295 4515BC 5 2312299 4515BC5<K9 4 2312304 4515BC5<KE 4 2312308 4518B 29 2312312 4518B>@ 4 2312341 4518B>@K 4 2312345 454C?;8:0F88 4 2312349 454C?;8F8@>20==KE 4 2312353 459AB285 3668 2312357 459AB2851 16 2316025 459AB2851?@8A>740=887040G 6 2316041 459AB285:=>?:8 5 2316047 459AB285:=>?:8?0=5;8:=>?>:A>>1I5=8OA8AB5<K2708<>459AB28O 56 2316052 459AB285< 25 2316108 459AB285>1@01>B:8@0AH8D@>2:8:><?>=>2:840==KE 64 2316133 459AB285?5@5B0A:820=8O 34 2316197 459AB285?5@5B0A:820=8O2=CB@8?;0=8@>2I8:0 29 2316231 459AB285?>AB@>8B5;Odom 34 2316260 459AB285?@870:@KB88D>@<K 6 2316294 459AB285?@8=060B88 6 2316300 459AB285?@8=54>ABC?=>AB8=0AB@>5::><?>=>2:840==KE 20 2316306 459AB285?@8=5A>>B25BAB288?0@>;59?>;L7>20B5;59B@51>20=8O<?@80CB5=B8D8:0F88 6 2316326 459AB285?@8=5A>>B25BAB288?0@>;59B@51>20=8O<?@80CB5=B8D8:0F88 9 2316332 459AB285?@8=5A>>B25BAB288?0@>;OB@51>20=8O<?@80CB5=B8D8:0F88 34 2316341 459AB285A>1J5:B>< 5 2316375 459AB285A>>1I5=8OA8AB5<K2708<>459AB28O 61 2316380 459AB285M;5<5=B0?;0=8@>2I8:0 101 2316441 459AB285M;5<5=B0@57C;LB0B03;>10;L=>3>?>8A:0 48 2316542 459AB288 75 2316590 459AB289 1013 2316665 459AB28B5;L=> 18 2317678 459AB28B5;L=>5 6 2317696 459AB28B5;L=>AB8 5 2317702 459AB28B5;L=>ABL 66 2317707 459AB28B5;L=K9 24 2317773 459AB28N 42 2317797 459AB28O 1610 2317839 459AB28O< 10 2319449 459AB28O<8 9 2319459 459AB28OE 10 2319468 459AB2>20BL 209 2319478 459AB2C5B 156 2319687 459AB2CNB 9 2319843 459AB2CNI55 10 2319852 459AB2CNI85 4 2319862 459AB2CNI89 29 2319866 459AB2CNI8E 5 2319895 45:01@L 13 2319900 45:01@O 13 2319913 45:040 196 2319926 45:040< 35 2320122 45:045 9 2320157 45:04K 82 2320166 45:;0@0B82=K9 4 2320248 45:;0@0B82=K< 4 2320252 45:;0@0F88 4 2320256 45:;0@0F8O 4 2320260 45:>45@ 20 2320264 45:>48@>20=85 15 2320284 45:>48@>20=8O 15 2320299 45:>48@>20BLAO 6 2320314 45:>48@C5BAO 6 2320320 45:>@0B82=0O 5 2320326 45:>@0B82=>9 12 2320331 45:>@0B82=K9 17 2320343 45:>@0F859 4 2320360 45:>@0F88 336 2320364 45:>@0F89 4 2320700 45:>@0F8O 358 2320704 45:>@0F8OD>@<K 216 2321062 45;05< 16 2321278 45;05<K9 16 2321294 45;05B 120 2321310 45;05BAO 93 2321430 45;0BL 157 2321523 45;0BLAO 105 2321680 45;0NB 12 2321785 45;5 5 2321797 45;538@>20=85 10 2321802 45;538@>20=85< 10 2321812 45;5=85 84 2321822 45;5=89 22 2321906 45;5=8O 29 2321928 45;5=8O< 4 2321957 45;5=L5 22 2321961 45;8<>3> 4 2321983 45;8<>5 4 2321987 45;8<K9 4 2321991 45;8B 9 2321995 45;8B5;L 4 2322004 45;8B5;O 4 2322008 45;8BAO 4 2322012 45;8BL 9 2322016 45;8BLAO 8 2322025 45;> 10 2322033 45;OBAO 8 2322043 45<>:>=D83C@0F8O 20 2322051 45<>=AB@0F88 8 2322071 45<>=AB@0F8O 8 2322079 45<>=AB@8@>20BL 5 2322087 45<>=AB@8@C5B 5 2322092 45<>A 4 2322097 45=4@>3@0<<0 376 2322101 45=4@>3@0<<5 12 2322477 45=4@>3@0<<C 4 2322489 45=4@>3@0<<K 232 2322493 45=56=>3> 5 2322725 45=56=K9 24 2322730 45=56=KE 19 2322754 45=L 930 2322773 45=L2<5AOF5 18 2323703 45=L30 13 2323721 45=L38 13 2323734 45=L3>40 33 2323747 45=L<5AOF0 17 2323780 45=L<5AOF045=L=545;8 9 2323797 45=L=545;8 50 2323806 45=L=545;82<5AOF5 23 2323856 45=L=545;845=L<5AOF0 9 2323879 45=L>B=0G0;0?5@8>40 9 2323888 45=L@>645=8O 14 2323897 45=L@>645=8O1C4CI53>3>40 5 2323911 45=LA=0G0;03>40 9 2323916 45=LA=0G0;0:20@B0;0 9 2323925 45=LA=0G0;0<5AOF0 9 2323934 45@520 675 2323943 45@525 589 2324618 45@52> 1565 2325207 45@52>7=0G5=89 98 2326772 45@52>< 15 2326870 45@52>@57C;LB0B>2 6 2326885 45@52>A>AB020 23 2326891 45@52>AB@0=8F 6 2326914 45@52>F5;59 5 2326920 45@52C 4 2326925 45A5@80;870F88 17 2326929 45A5@80;870F8O 4 2326946 45A5@80;87>20= 6 2326950 45A5@80;87>20BL 5 2326956 45AOB0O 6 2326961 45AOB8G=0O 3 2326967 45AOB8G=>5 20 2326970 45AOB8G=>9 5 2326990 45AOB8G=CN 4 2326995 45AOB8G=K5 8 2326999 45AOB8G=K9 89 2327007 45AOB8G=KE 46 2327096 45AOB:0 6 2327142 45AOB:8 6 2327148 45AOB:>2 6 2327154 45AOB>: 12 2327160 45AOBK9 10 2327172 45AOBL 4 2327182 45B0;59 8 2327186 45B0;8 4 2327194 45B0;878@CNI89 10 2327198 45B0;878@CNI8< 10 2327208 45B0;L 12 2327218 45B0;L=0O 8 2327230 45B0;L=0O70?8AL 26 2327238 45B0;L=89 8 2327264 45B0;L=> 4 2327272 45B0;L=>5@0A?8A0=85 6 2327276 45B0;L=>9 4 2327282 45B0;L=CN 5 2327286 45B0;L=K5 55 2327291 45B0;L=K570?8A8 6 2327346 45B0;L=K570?8A8A?8A:0 6 2327352 45B0;L=K5@0A?8A0=8O4=O 12 2327358 45B0;L=K9 269 2327370 45B0;L=K<8 4 2327639 45B0;L=KE 191 2327643 45B5@<8=0F88 4 2327834 45B5@<8=0F8O 4 2327838 45BA:0O 43 2327842 45BA:85 43 2327885 45BA:89 49 2327928 45BL 530 2327977 45D5:B 8 2328507 45D5:BK 8 2328515 45D7=0G 8 2328523 45D8A 29 2328531 45D8A>< 24 2328560 45OB5;L=>AB8 5 2328584 45OB5;L=>ABL 5 2328589 4681CB8 12 2328594 468=A 81 2328606 468=A>20O 6 2328687 468=A>2>9 37 2328693 468=A>2K9 39 2328730 468=AK 81 2328769 48030@<<0E 27 2328850 4803=>AB8: 5 2328877 4803=>AB8:0 5 2328882 4803=>AB8:8 5 2328887 4803>=0;L 4 2328892 4803>=0;LN 4 2328896 4803@0<< 251 2328900 4803@0<<0 3418 2329151 4803@0<<01 4 2332569 4803@0<<02 4 2332573 4803@0<<03 4 2332577 4803@0<<030=B0 366 2332581 4803@0<<0:><?>=>2:840==KE 258 2332947 4803@0<<0<0:5B0:><?>=>2:840==KE 91 2333205 4803@0<<0E 87 2333296 4803@0<<5 344 2333383 4803@0<<>9 25 2333727 4803@0<<C 71 2333752 4803@0<<K 2281 2333823 480;>3 1214 2336104 480;>30 615 2337318 480;>30E 5 2337933 480;>32>?@>A 11 2337938 480;>32>A:;8F0=85 11 2337949 480;>32K1>@0?>;L7>20B5;598AB>@8840==KE 34 2337960 480;>32K1>@0B8?04803@0<<K 32 2337994 480;>32K1>@0D09;0 146 2338026 480;>32K1>@0F25B0 35 2338172 480;>32K1>@0H@8DB0 33 2338207 480;>35 317 2338240 480;>38 4 2338557 480;>38=D>@<0F8O 11 2338561 480;>3>2 33 2338572 480;>3>2>3> 5 2338605 480;>3>2>5 52 2338610 480;>3>2>< 3 2338662 480;>3>2K9 56 2338665 480;>3>< 86 2338721 480;>3>B1>@025@A898AB>@8840==KE 34 2338807 480;>3>B:@KB8OD09;0 14 2338841 480;>3?5G0B8 67 2338855 480;>3@0A?8A0=8O@53;0<5=B=>3>7040=8O 39 2338922 480;>3@0A?8A0=8OM;5<5=B0?;0=8@>2I8:0 34 2338961 480;>3@540:B8@>20=8OAB0=40@B=>3>?5@8>40 42 2338995 480;>3AB>? 11 2339037 480<5B@ 63 2339048 480<5B@0 4 2339111 480?07>= 829 2339115 480?07>=0 229 2339944 480?07>=5 290 2340173 480?07>=>2 36 2340463 480?07>=>< 12 2340499 480?07>=?>@B>2 6 2340511 480?07>=C 5 2340517 480?07>=K 35 2340522 480?07>=K?>@B>2 11 2340557 4810 7 2340568 482 27 2340575 4820 27 2340602 4820= 10 2340629 482> 27 2340639 4830@0<<K 4 2340666 485= 11 2340670 487JN=:F8O 6 2340681 48< 28 2340687 48<0 28 2340715 48=0 6 2340743 48=0<8: 5 2340749 48=0<8:0 5 2340754 48=0<8:0?@>406 6 2340759 48=0<8:C 5 2340765 48=0<8G5A:0O 5 2340770 48=0<8G5A:8 111 2340775 48=0<8G5A:85 28 2340886 48=0<8G5A:89 672 2340914 48=0<8G5A:89A?8A>: 219 2341586 48=0<8G5A:8< 25 2341805 48=0<8G5A:8<8 10 2341830 48=0<8G5A:8E 109 2341840 48=0<8G5A:>3> 450 2341949 48=0<8G5A:>5AG8BK20=8540==KE 9 2342399 48=0<8G5A:>< 69 2342408 48=0<8G5A:><C 4 2342477 48?07>=5 5 2342481 48@5:B82 30 2342486 48@5:B820 329 2342516 48@5:B820<8 12 2342845 48@5:B820E 5 2342857 48@5:B825 15 2342862 48@5:B82>9 230 2342877 48@5:B82C 5 2343107 48@5:B82K 41 2343112 48@5:B>@ 30 2343153 48@5:B>@88 14 2343183 48@5:B>@89 14 2343197 48@5:B>@8O 14 2343211 48A: 249 2343225 48A:0 75 2343474 48A:5 103 2343549 48A:>289 10 2343652 48A:>2>3> 10 2343662 48A:>2>< 4 2343672 48A:>2K9 14 2343676 48A:@5B870F88 12 2343690 48A:@5B870F8O 12 2343702 48A:@5B=>5 4 2343714 48A:@5B=>< 4 2343718 48A:@5B=K5 34 2343722 48A:@5B=K5?>;O 9 2343756 48A:@5B=K9 43 2343765 48A:@5B=KE 4 2343808 48AB0=F88 12 2343812 48AB0=F8O 12 2343824 48AB@81CB82 6 2343836 48AB@81CB820 6 2343842 48DD5@5=F80;L=0O 10 2343848 48DD5@5=F80;L=>3> 8 2343858 48DD5@5=F80;L=>9 24 2343866 48DD5@5=F80;L=CN 18 2343890 48DD5@5=F80;L=K9 44 2343908 4;8= 9 2343952 4;8=0 1445 2343961 4;8=0:>40 45 2345406 4;8=0:>40?>4B25@645=8O 54 2345451 4;8=0:>40?>4B25@645=8O0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 2345505 4;8=0=08<5=>20=8O 59 2345541 4;8=0=><5@0 36 2345600 4;8=0=><5@0AB@>:8 23 2345636 4;8=0?0@>;O 5 2345659 4;8=0?>@O4:0 13 2345664 4;8=0AB@>:8 16 2345677 4;8=0CB>G=5=8O?5@8>40 9 2345693 4;8=5 28 2345702 4;8=55 4 2345730 4;8==0O 16 2345734 4;8==55 12 2345750 4;8==>5 12 2345762 4;8==K5 6 2345774 4;8==K9 60 2345780 4;8==K9B5:AB 15 2345840 4;8==K<8 4 2345855 4;8==KE 5 2345859 4;8=>9 49 2345864 4;8=C 351 2345913 4;8=K 497 2346264 4;8B5;L=>5 24 2346761 4;8B5;L=>AB8 42 2346785 4;8B5;L=>ABL 105 2346827 4;8B5;L=>ABL1;>:8@>2:8 45 2346932 4;8B5;L=>ABL1;>:8@>2:870?@>A0>1=>2;5=8O:>40?>4B25@645=8O 54 2346977 4;8B5;L=>ABL1;>:8@>2:870?@>A0>1=>2;5=8O:>40?>4B25@645=8O0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 2347031 4;8B5;L=>ABL2K7>20 22 2347067 4;8B5;L=>ABL2K7>2>22A53> 11 2347089 4;8B5;L=>ABL2K7>2>2705<8= 11 2347100 4;8B5;L=>ABL2K7>2>2A5@28A0B5:CI55 11 2347111 4;8B5;L=>ABL2K7>2>2A5@28A>2 22 2347122 4;8B5;L=>ABL2K7>2>2A5@28A>22A53> 11 2347144 4;8B5;L=>ABL2K7>2>2A5@28A>2705<8= 11 2347155 4;8B5;L=>ABL2K7>2>2AC14 22 2347166 4;8B5;L=>ABL2K7>2>2AC142A53> 11 2347188 4;8B5;L=>ABL2K7>2>2AC14705<8= 11 2347199 4;8B5;L=>ABL2K7>2>2AC14B5:CI55 11 2347210 4;8B5;L=>ABL2K7>2>2B5:CI55 11 2347221 4;8B5;L=>ABL=0:>?;5=8O 22 2347232 4;8B5;L=>ABLB5:CI53>2K7>20AC14 11 2347254 4;8B5;L=>ABLN 5 2347265 4;8B5;L=K5 5 2347270 4;8B5;L=K9 34 2347275 4;8B5;L=KE 5 2347309 4;8BL 39049 2347314 4;8BLAO 19 2386363 4;D 25 2386382 4;O 39049 2386407 4;O2A5E?>;L7>20B5;59 30 2425456 4;O3@C??K 17 2425486 4;O3@C??K8M;5<5=B0 17 2425503 4;O?>;L7>20B5;O 13 2425520 4;OB5:CI53>@57C;LB0B0 9 2425533 4;OD>@<K=0G8A;5=8OA:84>: 15 2425542 4;OM;5<5=B0 17 2425557 4= 9 2425574 4=52=>9 4 2425583 4=59 83 2425587 4=591 7 2425670 4=592 8 2425677 4=594>=>2>3>3>40 6 2425685 4=5< 16 2425691 4=8 46 2425707 4=8=545;8 23 2425753 4=N 8 2425776 4=O 395 2425784 4=O< 59 2426179 4=OE 8 2426238 4> 3019 2426246 4>1028; 6 2429265 4>1028;8 6 2429271 4>1028< 33 2429277 4>1028B 4 2429310 4>1028B8 4152 2429314 4>1028B8AO 18 2433466 4>1028BL 3866 2433484 4>1028BLactivex 17 2437350 4>1028BL0@E82=CN<5B:C2@5<5=8 18 2437367 4>1028BL0@E82=CN<5B:C2@5<5=80A8=E 16 2437385 4>1028BL0A8=E 15 2437401 4>1028BL204<8=8AB@0B>@K01>=5=B0 10 2437416 4>1028BL2871@0==>5 11 2437426 4>1028BL2A?8A>:87?0@>;59 15 2437437 4>1028BL2A?8A>:87A>E@0=O5<KE7=0G5=89?0@>;59 11 2437452 4>1028BL40==K5 50 2437463 4>1028BL4515B 12 2437513 4>1028BL480?07>=?>@B>2 12 2437525 4>1028BL4>?>;=8B5;L=K540==K5 10 2437537 4>1028BL4>G5@=89 420 2437547 4>1028BL:0:4>G5@=85 9 2437967 4>1028BL:0;5=40@L 14 2437976 4>1028BL:40B5 18 2437990 4>1028BL:>=B0:B 14 2438008 4>1028BL:>?8N 10 2438022 4>1028BL:@548B 12 2438032 4>1028BL;>:0;L=>5C254><;5=85 10 2438044 4>1028BL<5AOF 19 2438054 4>1028BL>1@01>BG8: 10 2438073 4>1028BL>B>1@0605<K9>1J5:B 10 2438083 4>1028BL>B>1@0605<K9>1J5:B0A8=E 10 2438093 4>1028BL>BG5B 6 2438103 4>1028BL?0@0<5B@ 25 2438109 4>1028BL?>4?8AL 10 2438134 4>1028BL?>4?8AL0A8=E 10 2438144 4>1028BL?@54AB02;5=85?>;O4>?>;=8B5;L=KE40==KE 11 2438154 4>1028BL?@8E>4 19 2438165 4>1028BL?CAB>57=0G5=85 9 2438184 4>1028BL@0AE>4 19 2438193 4>1028BLA>1KB85 14 2438212 4>1028BLAB@>:C 48 2438226 4>1028BLAO 22 2438274 4>1028BLB>:5=4>ABC?0 10 2438296 4>1028BLD09; 11 2438306 4>1028BLM;5<5=BA?8A:0 5 2438317 4>102;5= 504 2438322 4>102;5=0 199 2438826 4>102;5=85 1449 2439025 4>102;5=85< 515 2440474 4>102;5=85<=>65AB25==KE7=0G5=89 26 2440989 4>102;5=85?@54AB02;5=89 23 2441015 4>102;5=85H01;>=02B>@>3>D0:B>@00CB5=B8D8:0F88 36 2441038 4>102;5=88 171 2441074 4>102;5=8N 20 2441245 4>102;5=8O 533 2441265 4>102;5==0O 9 2441798 4>102;5==0OAB@>:0 5 2441807 4>102;5==>3> 23 2441812 4>102;5==>5 4 2441835 4>102;5==>9 20 2441839 4>102;5==K5 31 2441859 4>102;5==K9 1243 2441890 4>102;5==K< 13 2443133 4>102;5==KE 113 2443146 4>102;5=> 223 2443259 4>102;5=K 168 2443482 4>102;O5<0O 62 2443650 4>102;O5<>3> 887 2443712 4>102;O5<>5 66 2444599 4>102;O5<>9 34 2444665 4>102;O5<K5 14 2444699 4>102;O5<K5@5:2878BK 5 2444713 4>102;O5<K5B8?K 5 2444718 4>102;O5<K9 1568 2444723 4>102;O5<KE 8 2446291 4>102;O5B 1634 2446299 4>102;O5BAO 1005 2447933 4>102;OBL 2634 2448938 4>102;OBLbom 28 2451572 4>102;OBLAO 1156 2451600 4>102;ONB 4 2452756 4>102;ONBAO 145 2452760 4>102;OO 10 2452905 4>102>G=>5 5 2452915 4>102>G=>5459AB285 5 2452920 4>102>G=K9 5 2452925 4>102LB5 6 2452930 4>102OB 4 2452936 4>102OBAO 22 2452940 4>1:;NG52>5A;>2> 3 2452962 4>1@> 13 2452965 4>1@K9 19 2452978 4>1K20BLAO 4 2452997 4>1K20NBAO 4 2453001 4>25@5==>9 19 2453005 4>25@5==K9 19 2453024 4>25@85 4 2453043 4>25@8O 4 2453047 4>25@ONI59 42 2453051 4>25@ONI89 42 2453093 4>40BK>B?@02;5=8O 10 2453135 4>640BLAO 10 2453145 4>640BLAO7025@H5=8O 33 2453155 4>6840BLAO 30 2453188 4>6840OAL 11 2453218 4>: 105 2453229 4>:1 12 2453334 4>:2 13 2453346 4>:pdf 4 2453359 4>:0 105 2453363 4>:2K1>@:0 9 2453468 4>:>1@075F 6 2453477 4>:>=F0MB>3>3>40 9 2453483 4>:>=F0MB>3>:20@B0;0 9 2453492 4>:>=F0MB>3><5AOF0 9 2453501 4>:>=F0MB>3>?>;C3>48O 9 2453510 4>:>=F0MB>945:04K 9 2453519 4>:>=F0MB>9=545;8 9 2453528 4>:C 10 2453537 4>:C<5=B 12838 2453547 4>:C<5=Bdom 1117 2466385 4>:C<5=Bhtml 1679 2467502 4>:C<5=Bpdf 152 2469181 4>:C<5=B0 7047 2469333 4>:C<5=B0;L=K9 10 2476380 4>:C<5=B0< 25 2476390 4>:C<5=B0<8 16 2476415 4>:C<5=B0E 11 2476431 4>:C<5=B0F88 26 2476442 4>:C<5=B0F8O 120 2476468 4>:C<5=B0F8Oxs 835 2476588 4>:C<5=B2;045;5F 589 2477423 4>:C<5=B2K1>@:0 95 2478012 4>:C<5=B5 817 2478107 4>:C<5=B70I8I5=?0@>;5< 12 2478924 4>:C<5=B70I8I5=?0@>;5<0A8=E 12 2478936 4>:C<5=B8@>20BL 10 2478948 4>:C<5=B<0:5B 5 2478958 4>:C<5=B<5=5465@ 147 2478963 4>:C<5=B=0945= 9 2479110 4>:C<5=B>1J5:B 478 2479119 4>:C<5=B>2 1035 2479597 4>:C<5=B>< 819 2480632 4>:C<5=B@57C;LB0B 15 2481451 4>:C<5=BA?8A>: 121 2481466 4>:C<5=BAAK;:0 623 2481587 4>:C<5=BAD>@<8@>20= 22 2482210 4>:C<5=BB01;8G=0OG0ABL 18 2482232 4>:C<5=BC 223 2482250 4>:C<5=BK 781 2482473 4>:C<5=BK<5=5465@ 30 2483254 4>:C<5=BK=0G8A;5=89 7 2483284 4>;389 14 2483291 4>;3>3> 4 2483305 4>;3>B0 52 2483309 4>;3>B02>AB>G=>93@0=8FK 22 2483361 4>;3>B070?04=>93@0=8FK 22 2483383 4>;3>BC 36 2483405 4>;65= 1506 2483441 4>;6=0 678 2484947 4>;6=> 2164 2485625 4>;6=>AB8 4 2487789 4>;6=>ABL 35 2487793 4>;6=K 867 2487828 4>;6=K9 4723 2488695 4>;8 4 2493418 4>;;0@ 54 2493422 4>;;0@0 16 2493476 4>;;0@>2 6 2493492 4>;;0@K 23 2493498 4>;LH5 10 2493521 4>;O 4 2493531 4>< 2708 2493535 4><0 8 2496243 4><0H=59 14 2496251 4><0H=5< 5 2496265 4><0H=89 79 2496270 4><0H=89D0:A 9 2496349 4><0H=OO 4 2496358 4><0H=OOAB@0=8F0 9 2496362 4><0H=V9 4 2496371 4><5= 100 2496375 4><5=0 29 2496475 4><5=0E 10 2496504 4><5==>5 10 2496514 4><5==K9 10 2496524 4><5=C 10 2496534 4><8=8:0=A:0O 12 2496544 4><8=8:0=A:89 12 2496556 4><=0 67 2496568 4>= 18 2496635 4>=0AB@>8BL 5 2496653 4>=3 7 2496658 4>=> 18 2496665 4>? 76 2496683 4>?8A0=0 5 2496759 4>?8A0==K9 40 2496764 4>?8A0=K 35 2496804 4>?8A0BL 16 2496839 4>?8AK205B 12 2496855 4>?8AK20=85 60 2496867 4>?8AK20=85< 60 2496927 4>?8AK20BL 24 2496987 4>?>;=5=85 621 2497011 4>?>;=5=85< 8 2497632 4>?>;=5=85?5@8>40 16 2497640 4>?>;=5=85?5@8>40<0:5B0:><?>=>2:840==KE 34 2497656 4>?>;=5=85M;5<5=B0D>@<K 91 2497690 4>?>;=5=89 8 2497781 4>?>;=5=8O 547 2497789 4>?>;=5=8OA5@B8D8:0B0 17 2498336 4>?>;=5=8OA5@B8D8:0B0:0:8AE>4=K540==K5 18 2498353 4>?>;=5==>3> 16 2498371 4>?>;=5==K9 42 2498387 4>?>;=5=> 11 2498429 4>?>;=5=L5 8 2498440 4>?>;=8B5;L=0O 161 2498448 4>?>;=8B5;L=0O3@0<<0B8:0 10 2498609 4>?>;=8B5;L=0O8=D>@<0F8O 158 2498619 4>?>;=8B5;L=0O8=D>@<0F8O70?@>A0 9 2498777 4>?>;=8B5;L=0O8=D>@<0F8O>BG5B0 9 2498786 4>?>;=8B5;L=0O:0@B8=:0H0?:8 11 2498795 4>?>;=8B5;L=0O>AL7=0G5=89 30 2498806 4>?>;=8B5;L=0O?@>25@:0?>;L7>20B5;O 13 2498836 4>?>;=8B5;L=0OD>@<0 36 2498849 4>?>;=8B5;L=0OD>@<03@C??K 18 2498885 4>?>;=8B5;L=0OD>@<04;O2K1>@0 87 2498903 4>?>;=8B5;L=0OD>@<04;O2K1>@03@C??K 18 2498990 4>?>;=8B5;L=0OD>@<0703@C7:8 13 2499008 4>?>;=8B5;L=0OD>@<070?8A8 9 2499021 4>?>;=8B5;L=0OD>@<0:>=AB0=B 9 2499030 4>?>;=8B5;L=0OD>@<0=0AB@>5: 9 2499039 4>?>;=8B5;L=0OD>@<0>1J5:B0 72 2499048 4>?>;=8B5;L=0OD>@<0A>E@0=5=8O 13 2499120 4>?>;=8B5;L=0OD>@<0A?8A:0 117 2499133 4>?>;=8B5;L=0OH:0;07=0G5=89 30 2499250 4>?>;=8B5;L=85 4 2499280 4>?>;=8B5;L=> 366 2499284 4>?>;=8B5;L=>3> 108 2499650 4>?>;=8B5;L=>5 51 2499758 4>?>;=8B5;L=>9 141 2499809 4>?>;=8B5;L=>< 37 2499950 4>?>;=8B5;L=><C 4 2499987 4>?>;=8B5;L=CN 74 2499991 4>?>;=8B5;L=K5 975 2500065 4>?>;=8B5;L=K53@0<<0B8:8 9 2501040 4>?>;=8B5;L=K540==K5 74 2501049 4>?>;=8B5;L=K540==K570?CA:0?@8;>65=8O<>18;L=>3>CAB@>9AB20 52 2501123 4>?>;=8B5;L=K540==K5?5@5E>402<>18;L=>5?@8;>65=85 9 2501175 4>?>;=8B5;L=K57=0G5=8OE0@0:B5@8AB8: 19 2501184 4>?>;=8B5;L=K58=45:AK 157 2501203 4>?>;=8B5;L=K5=0AB@>9:8 11 2501360 4>?>;=8B5;L=K5=0AB@>9:80CB5=B8D8:0F88 50 2501371 4>?>;=8B5;L=K5=0G8A;5=8OA>B@C4=8:>2>@30=870F88 10 2501421 4>?>;=8B5;L=K5?0@0<5B@K 1205 2501431 4>?>;=8B5;L=K5?0@0<5B@K:><0=4=>9AB@>:8 18 2502636 4>?>;=8B5;L=K5?0@0<5B@K=02830F8>==>9AAK;:8 6 2502654 4>?>;=8B5;L=K5?0@0<5B@KA>740=8O 9 2502660 4>?>;=8B5;L=K5?0@0<5B@KDC=:F882>AAB0=>2;5=8O 19 2502669 4>?>;=8B5;L=K5?0@0<5B@KDC=:F88?@5>1@07>20=8O 7 2502688 4>?>;=8B5;L=K5?>;O 9 2502695 4>?>;=8B5;L=K5?C=:BK<5=N 24 2502704 4>?>;=8B5;L=K5A2>9AB20 253 2502728 4>?>;=8B5;L=K5A;>20@8?>;=>B5:AB>2>3>?>8A:0 14 2502981 4>?>;=8B5;L=K5D09;K 9 2502995 4>?>;=8B5;L=K9 2301 2503004 4>?>;=8B5;L=K98=45:A 33 2505305 4>?>;=8B5;L=K9?0@0<5B@ 26 2505338 4>?>;=8B5;L=K9?0@0<5B@:;85=B0;8F5=78@>20=8O 5 2505364 4>?>;=8B5;L=K9@568<>B>1@065=8O 25 2505369 4>?>;=8B5;L=K9F25B 32 2505394 4>?>;=8B5;L=K< 110 2505426 4>?>;=8B5;L=K<8 15 2505536 4>?>;=8B5;L=KE 264 2505551 4>?>;=8BL 23 2505815 4>?>;=O5BAO 13 2505838 4>?>;=OBL 7 2505851 4>?>;=OBLAO 31 2505858 4>?>;=ONBAO 10 2505889 4>?>;=ONI89 8 2505899 4>?>;=ONI8E 8 2505907 4>?>;=OO 7 2505915 4>??0@0<5B@ 4 2505922 4>??0@0<5B@K 6 2505926 4>?A2>9AB20 5 2505932 4>?CA:05B 639 2505937 4>?CA:05BAO 718 2506576 4>?CA:05BAO?CAB>9 12 2507294 4>?CA:0BL 712 2507306 4>?CA:0BLAO 834 2508018 4>?CA:0NB 17 2508852 4>?CA:0NBAO 136 2508869 4>?CA:0NI89 5 2509005 4>?CA:0NI8E 5 2509010 4>?CAB8< 32 2509015 4>?CAB8<0O 13 2509047 4>?CAB8<0O4;8=0 105 2509060 4>?CAB8<0O4;8=0:>40 43 2509165 4>?CAB8<0O4;8=0=><5@0 42 2509208 4>?CAB8<0OAB@0=0?>;CG5=8O;8F5=789 19 2509250 4>?CAB8<89 86 2509269 4>?CAB8<> 450 2509355 4>?CAB8<>3> 86 2509805 4>?CAB8<>5 82 2509891 4>?CAB8<>5>B:;>=5=85:>;8G5AB20>H81>:A5@25@0 11 2509973 4>?CAB8<>9 32 2509984 4>?CAB8<>AB8 5 2510016 4>?CAB8<>ABL 10 2510021 4>?CAB8<CN 58 2510031 4>?CAB8<K 36 2510089 4>?CAB8<K5 557 2510125 4>?CAB8<K5459AB28O 13 2510682 4>?CAB8<K5459AB28O?5@5B0A:820=8O 29 2510695 4>?CAB8<K57=0G5=8O 9 2510724 4>?CAB8<K5B8?K 16 2510733 4>?CAB8<K5B8?K2E>4OI8E70?@>A>2?>45;8BLAO 9 2510749 4>?CAB8<K9 1620 2510758 4>?CAB8<K97=0: 58 2512378 4>?CAB8<K9=><5@A>>1I5=8O 28 2512436 4>?CAB8<K< 32 2512464 4>?CAB8<K<8 70 2512496 4>?CAB8<KE 220 2512566 4>?CAB8B8 460 2512786 4>?CAB8BL 42 2513246 4>@01>B0BL 4 2513288 4>@>389 11 2513292 4>@>38E 11 2513303 4>@>3>9 11 2513314 4>A 18 2513325 4>A<>B@5; 4 2513343 4>A<>B@5BL 4 2513347 4>AB028B8 4 2513351 4>AB028BL 4 2513355 4>AB02:0 101 2513359 4>AB02:5 9 2513460 4>AB02:8 60 2513469 4>AB02;O5<>5C254><;5=85 63 2513529 4>AB02;O5<>< 4 2513592 4>AB02;O5<K5 11 2513596 4>AB02;O5<K5C254><;5=8O 9 2513607 4>AB02;O5<K9 41 2513616 4>AB02;O5<KE 29 2513657 4>AB02;O5B 15 2513686 4>AB02;OBL 15 2513701 4>AB0B>G=> 112 2513716 4>AB0B>G=>3> 12 2513828 4>AB0B>G=K5 5 2513840 4>AB0B>G=K9 134 2513845 4>AB0B>G=KE 5 2513979 4>AB83=CB 185 2513984 4>AB83=CB> 12 2514169 4>AB83=CBK9 197 2514181 4>AB83=CBL 185 2514378 4>AB865=85 65 2514563 4>AB865=88 38 2514628 4>AB865=8O 26 2514666 4>AB8GL 185 2514692 4>AB>25@=>AB8 4 2514877 4>AB>25@=>ABL 23 2514881 4>AB>25@=K9 4 2514904 4>AB>25@=K< 4 2514908 4>ABC? 4543 2514912 4>ABC?0 1700 2519455 4>ABC?2:;NG5= 48 2521155 4>ABC?2K:;NG5= 48 2521203 4>ABC?5 46 2521251 4>ABC?5= 132266 2521297 4>ABC?5=A?8A>:7=0G5=89 19 2653563 4>ABC?::@8?B>3@0D88 47 2653582 4>ABC?:>2A5<D09;0< 9 2653629 4>ABC?:>A=>2=><CA5@25@C 10 2653638 4>ABC?:D09;C 37 2653648 4>ABC?=0 445 2653685 4>ABC?=02;>:0;L=><20@80=B5 9 2654130 4>ABC?=02>2=5H=5<20@80=B5 9 2654139 4>ABC?=02K3@C7:0 9 2654148 4>ABC?=04;O?>;CG5=8O 9 2654157 4>ABC?=070?8AL 33 2654166 4>ABC?=0O 58 2654199 4>ABC?=0O2;>65==0OB01;8F0 5 2654257 4>ABC?=0O2;>65==0OB01;8F0AE5<K70?@>A0 43 2654262 4>ABC?=0O?@>872>48B5;L=>ABL 11 2654305 4>ABC?=0OB01;8F0 5 2654316 4>ABC?=0OB01;8F0AE5<K70?@>A0 44 2654321 4>ABC?=89 633 2654365 4>ABC?=> 893 2654998 4>ABC?=>3> 112 2655891 4>ABC?=>5 84 2656003 4>ABC?=>5?>;5 4 2656087 4>ABC?=>5?>;5:><?>=>2:840==KE 106 2656091 4>ABC?=>5?>;5>B1>@0:><?>=>2:840==KE 181 2656197 4>ABC?=>5?>;5AE5<K70?@>A0 58 2656378 4>ABC?=>87<5=5=85?>78F88 105 2656436 4>ABC?=>9 141 2656541 4>ABC?=>< 4 2656682 4>ABC?=><C 21 2656686 4>ABC?=>@540:B8@>20=85A>>1I5=8O 9 2656707 4>ABC?=>AB8 235 2656716 4>ABC?=>ABL 91063 2656951 4>ABC?=>ABL4;O2K1>@0 13 2748014 4>ABC?=>ABL4;O>D>@<;5=8O 9 2748027 4>ABC?=>ABL?>;CG5=8O;8F5=789 19 2748036 4>ABC?=>ABLF5=B@0;8F5=78@>20=8O?>;CG5=8O;8F5=789 19 2748055 4>ABC?=>ABLN 61 2748074 4>ABC?=>GB5=85 33 2748135 4>ABC?=CN 4 2748168 4>ABC?=K 631 2748172 4>ABC?=K2845>:>=D5@5=F88 9 2748803 4>ABC?=K5 381 2748812 4>ABC?=K5284KA@02=5=8O 11 2749193 4>ABC?=K5459AB28O 24 2749204 4>ABC?=K54;O?>:C?:8 5 2749228 4>ABC?=K54;O@0AH8@5=8O<>4C;8 47 2749233 4>ABC?=K57=0G5=8O 73 2749280 4>ABC?=K587<5@5=8O 15 2749353 4>ABC?=K5>1J5:BK 16 2749368 4>ABC?=K5>1J5:BK=0AB@>9:8:><?>=>2:840==KE 22 2749384 4>ABC?=K5?0@0<5B@K 161 2749406 4>ABC?=K5?0@0<5B@K:><?>=>2:840==KE 98 2749567 4>ABC?=K5?>;O 116 2749665 4>ABC?=K5?>;O2K1>@0 22 2749781 4>ABC?=K5?>;O3@C??8@>2>: 11 2749803 4>ABC?=K5?>;O4>?>;=5=8O?5@8>40 11 2749814 4>ABC?=K5?>;O4>?>;=8B5;L=KE>B1>@>2 11 2749825 4>ABC?=K5?>;O7=0G5=89 22 2749836 4>ABC?=K5?>;O:><?>=>2:840==KE 150 2749858 4>ABC?=K5?>;O>B1>@0 63 2750008 4>ABC?=K5?>;O>B1>@0M;5<5=B>2AB@C:BC@K 11 2750071 4>ABC?=K5?>;O>D>@<;O5<KE?>;59 11 2750082 4>ABC?=K5?>;O?0@0<5B@>2 31 2750093 4>ABC?=K5?>;O?0@0<5B@>240==KE 11 2750124 4>ABC?=K5?>;O?>;59 11 2750135 4>ABC?=K5?>;O?>;593@C??8@>2>: 11 2750146 4>ABC?=K5?>;O?>@O4:0 22 2750157 4>ABC?=K5?>;OAE5<K70?@>A0 73 2750179 4>ABC?=K5B01;8FK 9 2750252 4>ABC?=K5B01;8FKAE5<K70?@>A0 33 2750261 4>ABC?=K5B8?K 28 2750294 4>ABC?=K5B8?K4803@0<<K 21 2750322 4>ABC?=K9 133547 2750343 4>ABC?=K9>1J5:B=0AB@>9:8:><?>=>2:840==KE 32 2883890 4>ABC?=K9?0@0<5B@:><?>=>2:840==KE 134 2883922 4>ABC?=K< 46 2884056 4>ABC?=K<8 81 2884102 4>ABC?=KE 824 2884183 4>ABC?>< 35 2885007 4>B 4 2885042 4>E>4 4 2885046 4>E>40<8 4 2885050 4>E>4=K52;>65=8O2 5 2885054 4>E>4K=4D; 3 2885059 4>G5@=53> 297 2885062 4>G5@=55 10 2885359 4>G5@=59 5 2885369 4>G5@=85 724 2885374 4>G5@=85C7;K 442 2886098 4>G5@=89 3612 2886540 4>G5@=8< 819 2890152 4>G5@=8<8 276 2890971 4>G5@=8E 2526 2891247 4>G5@=OO 11 2893773 4>G5@=OO2K1>@:0 6 2893784 4? 25 2893790 4@ 79 2893815 4@030 100 2893894 4@525A=K9 12 2893994 4@52>284=>9 4 2894006 4@52>284=CN 15 2894010 4@52>284=K9 19 2894025 4@>1=0O 54 2894044 4@>1=>3> 6 2894098 4@>1=>9 190 2894104 4@>1=CN 31 2894294 4@>1=K9 242 2894325 4@>1=K< 4 2894567 4@>1=KE 10 2894571 4@>1L 6 2894581 4@>1LN 6 2894587 4@C3 184 2894593 4@C30 61 2894777 4@C30O 37 2894838 4@C35 621 2894875 4@C385 1875 2895496 4@C389 1859 2897371 4@C38< 204 2899230 4@C38<8 327 2899434 4@C38E 868 2899761 4@C3>3> 463 2900629 4@C3>5 237 2901092 4@C3>9 4165 2901329 4@C3>9D0:A 9 2905494 4@C3>< 80 2905503 4@C3><C 40 2905583 4@C3C 5 2905623 4@C3CN 151 2905628 4B 97 2905779 4C1;8:0B 20 2905876 4C1;8:0B>2 4 2905896 4C1;8:0BK 16 2905900 4C1;8@>20=85 14 2905916 4C1;8@>20=8O 9 2905930 4C1;8@>20BL 4 2905939 4C1;8@>20BLAO 4 2905943 4C1;8@C5B 4 2905947 4C1;8@CNBAO 4 2905951 4C1;8@CNI85 4 2905955 4C1;8@CNI85AO 4 2905959 4C1;8@CNI89 4 2905963 4C1;8@CNI89AO 4 2905967 4C30 8 2905971 4CH 8 2905979 4CH0 8 2905987 4D 19 2905995 4K<G0B> 5 2906014 4K<G0B>15;K9 11 2906019 4K@:0 4 2906030 4K@:8 4 2906034 4N9< 51 2906038 4N9<0 20 2906089 4V; 4 2906109 5 571 2906113 52:;84>20<5B@8:0 9 2906684 52:;84>20<5B@8:02:204@0B5 9 2906693 538?5B 12 2906702 53> 3512 2906714 540 32 2910226 548= 5 2910258 548=8F 21 2910263 548=8F0 437 2910284 548=8F087<5@5=8O 16 2910721 548=8F087<5@5=8O=><5=:;0BC@K 11 2910737 548=8F08=B5@20;0M:2820;5=B=>AB82@5<5=8 4 2910748 548=8F0<0:A8<0;L=>3>8=B5@20;0 4 2910752 548=8F0<8=8<0;L=>3>8=B5@20;0 4 2910756 548=8F0?5@8>48G5A:>3>20@80=B0 44 2910760 548=8F0E 235 2910804 548=8F59 14 2911039 548=8FC 10 2911053 548=8FK 107 2911063 548=8FK87<5@5=8O 5 2911170 548=8G=>3> 11 2911175 548=8G=>5 25 2911186 548=8G=K9 36 2911211 548=>2@5<5==> 4 2911247 548=>2@5<5==K9 4 2911251 548=>5 3 2911255 548=>9 17 2911258 548=>< 8 2911275 548=AB25==0O 20 2911283 548=AB25==> 16 2911303 548=AB25==>3> 19 2911319 548=AB25==>5 52 2911338 548=AB25==>9 16 2911390 548=AB25==>< 11 2911406 548=AB25==CN 11 2911417 548=AB25==K9 296 2911428 548=AB25==K< 62 2911724 548=K9 35 2911786 55 523 2911821 59 28 2912344 5;5<5=B 398 2912372 5<:>AB8 9 2912770 5<:>ABL 15 2912779 5<:>ABLN 8 2912794 5<C 504 2912802 5@0 185 2913306 5A;8 30783 2913491 5AB5AB25==> 4 2944274 5AB5AB25==>3> 4 2944278 5AB5AB25==K9 8 2944282 5ABL 1500 2944290 5ABLnull 17 2945790 5ABL0B@81CB 261 2945807 5ABL0B@81CBK 420 2946068 5ABL4>G5@=85C7;K 420 2946488 5ABL87<5=5=8O@0AH8@5=8O<8:>=D83C@0F88 696 2946908 5D 101 2947604 5D0 101 2947705 5I5 540 2947806 5IQ 8 2948346 5Q 26 2948354 6 15 2948380 640BL 63 2948395 65 1926 2948458 65;05<>5 11 2950384 65;05<K9 15 2950395 65;0B5;L=> 4 2950410 65;0B5;L=K9 4 2950414 65;0BL 4 2950418 65;B0O 24 2950422 65;B> 5 2950446 65;B>3> 5 2950451 65;B>75;5=K9 11 2950456 65;BK9 118 2950467 65=A:85 81 2950585 65=A:89 100 2950666 65AB:89 45 2950766 65AB:> 45 2950811 65AB>:89 5 2950856 65AB>:> 5 2950861 687=8 27 2950866 687=L 27 2950893 68@=>AB8 12 2950920 68@=>ABL 12 2950932 68@=K9H@8DB 5 2950944 6C@=0; 950 2950949 6C@=0;sms 26 2951899 6C@=0;0 621 2951925 6C@=0;0< 5 2952546 6C@=0;0<8 10 2952551 6C@=0;0E 5 2952561 6C@=0;4>:C<5=B>2 363 2952566 6C@=0;4>:C<5=B>22K1>@:0 54 2952929 6C@=0;4>:C<5=B>2<5=5465@ 53 2952983 6C@=0;4>:C<5=B>2A?8A>: 45 2953036 6C@=0;5 142 2953081 6C@=0;72>=:>2 26 2953223 6C@=0;>2 56 2953249 6C@=0;>< 29 2953305 6C@=0;@538AB@0F88 29 2953334 6C@=0;@538AB@0F88?>?>;L7>20B5;N 11 2953363 6C@=0;A?8A>: 3 2953374 6C@=0;C 10 2953377 6C@=0;K 33 2953387 6C@=0;K4>:C<5=B>2 47 2953420 6C@=0;K4>:C<5=B>2<5=5465@ 24 2953467 6C@=0;KB@0=70:F89:>?89107K40==KE 6 2953491 70 1441 2953497 7010;0=A>2>AB8 5 2954938 7010;0=A>2K9 49 2954943 701820BL 19 2954992 701;>:8@>20= 208 2955011 701;>:8@>20=0 29 2955219 701;>:8@>20==>3> 22 2955248 701;>:8@>20==>9 62 2955270 701;>:8@>20==K5 5 2955332 701;>:8@>20==K9 328 2955337 701;>:8@>20=> 5 2955665 701;>:8@>20=K 9 2955670 701;>:8@>20BL 184 2955679 701;>:8@>20BL40==K54;O@540:B8@>20=8O 21 2955863 701;>:8@>20BL40==K5D>@<K4;O@540:B8@>20=8O 17 2955884 701;>:8@>20BL70?8AL=0<5B:C0A8=E 14 2955901 701;>:8@>20BL@01>BC?>;L7>20B5;O 28 2955915 702545==K9 4 2955943 702545==KE 4 2955947 7025@5==CN 4 2955951 7025@5==K9 4 2955955 7025@H05< 5 2955959 7025@H05<K9 5 2955964 7025@H05B 142 2955969 7025@H05BAO 133 2956111 7025@H0;>AL 4 2956244 7025@H0BAO 9 2956248 7025@H0BL 151 2956257 7025@H0BL?@>1;5<=K5?@>F5AAK 11 2956408 7025@H0BLAO 168 2956419 7025@H0NBAO 31 2956587 7025@H5= 194 2956618 7025@H5=0 254 2956812 7025@H5=85 1768 2957066 7025@H5=852E>4OI53> 9 2958834 7025@H5=858AE>4OI53> 9 2958843 7025@H5=85< 31 2958852 7025@H5=85<>=>?>;L=>3>@568<0?@8=0G0;5A50=A0 52 2958883 7025@H5=85@01>BK 16 2958935 7025@H5=88 307 2958951 7025@H5=89 269 2959258 7025@H5=8N 54 2959527 7025@H5=8O 1324 2959581 7025@H5==0O 5 2960905 7025@H5==>AB8 10 2960910 7025@H5==>ABL 50 2960920 7025@H5==>ABL?>C<>;G0=8N 16 2960970 7025@H5==>ABL?@>AB>3>B8?0xs 25 2960986 7025@H5==>ABLA>AB02=>3>B8?0xs 20 2961011 7025@H5==>ABLAE5<Kxs 30 2961031 7025@H5==K5 5 2961061 7025@H5==K9 577 2961066 7025@H5==K< 6 2961643 7025@H5==KE 5 2961649 7025@H5=> 112 2961654 7025@H5=>020@89=> 9 2961766 7025@H5=>>1=>2;5=85?>@F88CA?5H=> 9 2961775 7025@H5=>A>H81:>9 18 2961784 7025@H5=>CA?5H=> 9 2961802 7025@H5=K 5 2961811 7025@H5=L5 15 2961816 7025@H82H53>AO 4 2961831 7025@H82H89AO 4 2961835 7025@H8;0AL 45 2961839 7025@H8;AO 20 2961884 7025@H8B 6 2961904 7025@H8B8 162 2961910 7025@H8BAO 14 2962072 7025@H8BL 37 2962086 7025@H8BL70?8AL6C@=0;0459AB289?>;L7>20B5;O 10 2962123 7025@H8BL@01>BCA8AB5<K 13 2962133 7025@H8BLA50=A 21 2962146 7025@H8BLAO 88 2962167 7025AB8 6 2962255 7028A0=85 5 2962261 7028A5BL 1000 2962266 7028A8<> 4 2963266 7028A8<>5 5 2963270 7028A8<>AB8 1137 2963275 7028A8<>ABL 1184 2964412 7028A8<>ABL>B284>2@0AG5B0 13 2965596 7028A8<K9 14 2965609 7028A8<K<8 5 2965623 7028A8<KE 4 2965628 7028A8B 876 2965632 7028A8B>B@50;870F88 9 2966508 7028AOB 75 2966517 7028AOI53> 4 2966592 7028AOI85 27 2966596 7028AOI89 41 2966623 702B@0 9 2966664 702B@0H=53> 8 2966673 702B@0H=89 8 2966681 703;0285 8 2966689 703;028O 8 2966697 703;02=K5 18 2966705 703;02=K9 23 2966723 703;02=K<8 5 2966746 703>;>2:0 952 2966751 703>;>2:0< 39 2967703 703>;>2:0E 12 2967742 703>;>2:5 166 2967754 703>;>2:8 202 2967920 703>;>2:88B5:CI0OAB@0=8F0 9 2968122 703>;>2:>2 135 2968131 703>;>2:>< 32 2968266 703>;>2:C 47 2968298 703>;>2>: 2641 2968345 703>;>2>:0:B82=>3>>:=0 11 2970986 703>;>2>:0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 2970997 703>;>2>:3@C??8@>2:8 5 2971033 703>;>2>:3@C??8@>2:8:>;>=:8 6 2971038 703>;>2>:3@C??8@>2:8A?8A:0 5 2971044 703>;>2>:85@0@E88 9 2971049 703>;>2>:85@0@E8G5A:>93@C??8@>2:8 5 2971058 703>;>2>:85@0@E8G5A:>93@C??8@>2:8:>;>=:8 6 2971063 703>;>2>:85@0@E8G5A:>93@C??8@>2:8A?8A:0 6 2971069 703>;>2>:8?>420; 9 2971075 703>;>2>::>;>=:8 5 2971084 703>;>2>:=50:B82=>3>>:=0 11 2971089 703>;>2>:>B>1@0605BAO 10 2971100 703>;>2>:A25@=CB>3>>B>1@065=8O 9 2971110 703>;>2>:A;520 9 2971119 703>;>2>:A?@020 9 2971128 703>;>2>:B01;8FK 6 2971137 703>;>2>:D>@<K 9 2971143 703@C602H53>AO 4 2971152 703@C602H89AO 14 2971156 703@C602H8EAO 10 2971170 703@C605<>3> 56 2971180 703@C605<K5 25 2971236 703@C605<K9 120 2971261 703@C605<KE 42 2971381 703@C605B 306 2971423 703@C605BAO 56 2971729 703@C60BL 331 2971785 703@C60BLAO 160 2972116 703@C60NBAO 97 2972276 703@C65= 23 2972373 703@C65=0 52 2972396 703@C65==CN 20 2972448 703@C65==K5 28 2972468 703@C65==K9 242 2972496 703@C65==KE 4 2972738 703@C65=> 17 2972742 703@C65=K 97 2972759 703@C78B 5 2972856 703@C78B8 259 2972861 703@C78BL 268 2973120 703@C78BL2845>>1JO2;5=85A2>7=03@0645=85<0A8=E 14 2973388 703@C78BL2=5H=NN:><?>=5=BC 53 2973402 703@C78BL2K3@C7:C40==KE 14 2973455 703@C78BL2K3@C7:C40==KE0A8=E 14 2973469 703@C78BL48DD5@5=F80;L=CN@575@2=CN:>?8N 22 2973483 703@C78BL70?@>A=0?>;CG5=85;8F5=788 14 2973505 703@C78BL7=0G5=8O 13 2973519 703@C78BL87D09;0 16 2973532 703@C78BL:>;>=:C 173 2973548 703@C78BL=0AB@>9:8 18 2973721 703@C78BL=0AB@>9:8>BG5B0 11 2973739 703@C78BL=0AB@>9:C?>C<>;G0=8N 12 2973750 703@C78BL?>;=>M:@0==CN@5:;0<C0A8=E 14 2973762 703@C78BL?>;=CN@575@2=CN:>?8N 22 2973776 703@C78BL?>;L7>20B5;LA:85=0AB@>9:8 17 2973798 703@C78BL@5:;0<=K910==5@0A8=E 14 2973815 703@C78BLB01;8FCAB8;59xsl 10 2973829 703@C78BLB01;8FCAB8;59xsl87AB@>:8 10 2973839 703@C78BLB01;8FCAB8;59xsl87C7;0 10 2973849 703@C78BLB01;8FCAB8;59xsl87D09;0 10 2973859 703@C78BLD8:A8@>20==K5=0AB@>9:8 12 2973869 703@C7:0 594 2973881 703@C7:0E 25 2974475 703@C7:5 81 2974500 703@C7:8 317 2974581 703@C7:>9 12 2974898 703@C7:C 32 2974910 703@C7>G=K9 21 2974942 703@C7>G=KE 21 2974963 7040205<>3> 34 2974984 7040205<>5 10 2975018 7040205<>9 8 2975028 7040205<CN 5 2975036 7040205<K5 4 2975041 7040205<K9 108 2975045 7040205<K< 4 2975153 7040205<KE 27 2975157 704020BL 1137 2975184 704020BLAO 1421 2976321 704020BLBL 6 2977742 70405B 1013 2977748 70405BAO 1205 2978761 70405BAO<0AHB01>< 9 2979966 7040= 2131 2979975 7040=0 670 2982106 7040=85 1248 2982776 7040=85< 17 2984024 7040=88 161 2984041 7040=89 251 2984202 7040=8N 10 2984453 7040=8O 625 2984463 7040=8O< 10 2985088 7040=8O<8 12 2985098 7040=8OE 20 2985110 7040==0O 490 2985130 7040==0O>1;0ABL 21 2985620 7040==>3> 615 2985641 7040==>5 343 2986256 7040==>9 321 2986599 7040==>< 116 2986920 7040==><C 294 2987036 7040==>N 4 2987330 7040==CN 440 2987334 7040==K5 148 2987774 7040==K9 5176 2987922 7040==K< 709 2993098 7040==K<8 89 2993807 7040==KE 173 2993896 7040=> 2766 2994069 7040=K 725 2996835 7040=L5 251 2997560 7040B8 3013 2997811 7040BL 772 3000824 7040BL2>?@>A>?@>4>;65=88 6 3001596 7040G 438 3001602 7040G0 2740 3002040 7040G02K1>@:0 119 3004780 7040G0< 5 3004899 7040G0<5=5465@ 166 3004904 7040G0<8 10 3005070 7040G0>1J5:B 471 3005080 7040G0A?8A>: 41 3005551 7040G0AAK;:0 362 3005592 7040G0B01;8G=0OG0ABL 18 3005954 7040G5 14 3005972 7040G59 40 3005986 7040G8 1734 3006026 7040G8<5=5465@ 30 3007760 7040G8?>8A?>;=8B5;N 6 3007790 7040GC 184 3007796 7040NBAO 82 3007980 7040NI0O 42 3008062 7040NI55 10 3008104 7040NI59 18 3008114 7040NI89 75 3008132 7040NICN 5 3008207 7040QB 4 3008212 70420820=85 4 3008216 70459AB2>20= 22 3008220 70459AB2>20==K9 60 3008242 70459AB2>20=> 5 3008302 70459AB2>20=K 33 3008307 7045@6820BL 13 3008340 7045@6820O 13 3008353 7045@6:0 41 3008366 7045@6:02K3@C7:8:>=D83C@0F88@01>G8<?@>F5AA><1570:B82=KE?>;L7>20B5;59 47 3008407 7045@6:8 37 3008454 704=59 12 3008491 704=89 27 3008503 704=8< 4 3008530 704=OO 17 3008534 704=V9 17 3008551 7060B>9 9 3008568 7060BK9 9 3008577 706830;:0 12 3008586 707>@ 4 3008598 707>@>2 4 3008602 708<AB2>20= 288 3008606 708<AB2>20=85 293 3008894 708<AB2>20=88 281 3009187 708<AB2>20=8O 10 3009468 708<AB2>20==0O 4 3009478 708<AB2>20==>3> 290 3009482 708<AB2>20==>9 14 3009772 708<AB2>20==>< 5 3009786 708<AB2>20==K9 389 3009791 708<AB2>20==K< 4 3010180 708<AB2>20==KE 281 3010184 708<AB2>20BL 9 3010465 708<AB2>20BLAO 20 3010474 708<AB2C5BAO 9 3010494 708<AB2CNBAO 15 3010503 70:07 54 3010518 70:070==K9 60 3010572 70:070==K< 60 3010632 70:07?>:C?0B5;O 6 3010692 70:07K 16 3010698 70:07K?>AB02I8:0< 6 3010714 70:0=G8205B 20 3010720 70:0=G8205BAO 61 3010740 70:0=G820BL 46 3010801 70:0=G820BLAO 77 3010847 70:0=G820NI89AO 7 3010924 70:0=G820NI8EAO 7 3010931 70:0=G820O 26 3010938 70:;04:0 533 3010964 70:;04:0:>=F0 55 3011497 70:;04:0< 8 3011552 70:;04:0<8 15 3011560 70:;04:0=0G0;0 55 3011575 70:;04:0D>@<0B8@>20==>3>4>:C<5=B0 126 3011630 70:;04:0E 27 3011756 70:;04:5 80 3011783 70:;04:8 158 3011863 70:;04:8A25@EC 18 3012021 70:;04:8A;5203>@87>=B0;L=> 17 3012039 70:;04:8A=87C 9 3012056 70:;04:8A?@0203>@87>=B0;L=> 13 3012065 70:;04:>9 5 3012078 70:;04:C 80 3012083 70:;04>: 184 3012163 70:;NG05BAO 27 3012347 70:;NG0BL 33 3012374 70:;NG0BLAO 39 3012407 70:;NG0NBAO 9 3012446 70:;NG5=0 7 3012455 70:;NG5==0O 5 3012462 70:;NG5==K5 12 3012467 70:;NG5==K9 22 3012479 70:;NG5==KE 5 3012501 70:;NG5=> 10 3012506 70:;NG5=K 5 3012516 70:;NG8B5;L=>< 5 3012521 70:;NG8B5;L=K9 10 3012526 70:;NG8B5;L=KE 5 3012536 70:>48@>20=0 5 3012541 70:>48@>20==0O 10 3012546 70:>48@>20==>3> 13 3012556 70:>48@>20==>9 5 3012569 70:>48@>20==CN 10 3012574 70:>48@>20==K5 17 3012584 70:>48@>20==K9 65 3012601 70:>48@>20==K<8 4 3012666 70:>48@>20=K 8 3012670 70:>48@>20BL 10 3012678 70:>=><5@=>AB59 4 3012688 70:>=><5@=>ABL 4 3012692 70:>=G5=> 4 3012696 70:>=G8;0AL 12 3012700 70:>=G8;>AL 8 3012712 70:>=G8;AO 12 3012720 70:>=G8B 4 3012732 70:>=G8BL 21 3012736 70:>=G8BL02B>3@C??8@>2:C:>;>=>: 24 3012757 70:>=G8BL02B>3@C??8@>2:CAB@>: 28 3012781 70:>=G8BL2K2>4 34 3012809 70:>=G8BL3@C??C:>;>=>: 20 3012843 70:>=G8BL3@C??CAB@>: 22 3012863 70:>=G8BL70?8AL 56 3012885 70:>=G8BL@540:B8@>20=85 11 3012941 70:>=G8BL@540:B8@>20=85AB@>:8 33 3012952 70:>=G8BL@540:B8@>20=85B5:CI59>1;0AB8 10 3012985 70:>=G8BLAO 36 3012995 70:>=G8BLGB5=85 55 3013031 70:@0A:0 10 3013086 70:@0A:8 8 3013096 70:@0H5==0O 4 3013104 70:@0H5==K9 4 3013108 70:@0H8205<K5 8 3013112 70:@0H8205<K9 10 3013120 70:@0H8205<K<8 8 3013130 70:@0H8205BAO 8 3013138 70:@0H820=85 8 3013146 70:@0H820=85< 8 3013154 70:@0H820BLAO 8 3013162 70:@5?;OBL 4 3013170 70:@5?;ONB 4 3013174 70:@>5B 14 3013178 70:@>5BAO 5 3013192 70:@K205<0O 9 3013197 70:@K205<K9 9 3013206 70:@K205B 133 3013215 70:@K205BAO 58 3013348 70:@K20BL 142 3013406 70:@K20BL?@82K1>@5 43 3013548 70:@K20BL?@870:@KB882;045;LF0 44 3013591 70:@K20BLAO 68 3013635 70:@K20NBAO 6 3013703 70:@K; 8 3013709 70:@K;8 31 3013717 70:@KB 98 3013748 70:@KB0 52 3013846 70:@KB85 628 3013898 70:@KB85< 64 3014526 70:@KB88 159 3014590 70:@KB8N 14 3014749 70:@KB8O 332 3014763 70:@KB> 62 3015095 70:@KB>3> 33 3015157 70:@KB><C 4 3015190 70:@KBK5 21 3015194 70:@KBK9 296 3015215 70:@KBK< 33 3015511 70:@KBL 610 3015544 70:@KBL0A8=E 126 3016154 70:@KBL2K?040NI89A?8A>: 10 3016280 70:@KBL8?>;CG8BL42>8G=K540==K5 10 3016290 70:@KBL?0=5;LA>>1I5=89?>;L7>20B5;N 10 3016300 70:@KBLA:0=8@>20=854>:C<5=B>2 10 3016310 70:@KBLA:0=8@>20=85HB@8E:>4>2 10 3016320 70:@KBLA?@02:C 12 3016330 70:@KBLAO 5 3016342 70:@KBLD09; 11 3016347 70:@KBLD>@<C 6 3016358 70:C?>G=0OF5=0 46 3016364 70:C?>G=>9 6 3016410 70:C?>G=K9 6 3016416 70:MH8@>20= 6 3016422 70:MH8@>20==KE 6 3016428 70;82:0 4 3016434 70;82:8 4 3016438 70<54;5=85 4 3016442 70<54;5=8N 4 3016446 70<54;8BAO 4 3016450 70<54;8BLAO 4 3016454 70<5=0 158 3016458 70<5=5 14 3016616 70<5=5= 195 3016630 70<5=5=0 27 3016825 70<5=5==K9 295 3016852 70<5=5=> 28 3017147 70<5=5=K 45 3017175 70<5=8B 6 3017220 70<5=8BL 77 3017226 70<5=8BL40==K5 50 3017303 70<5=8BL4>G5@=85 9 3017353 70<5=8BL4>G5@=89 420 3017362 70<5=8BL?>;=K9B5:AB 42 3017782 70<5=8BLAB@>:C 13 3017824 70<5=>9 60 3017837 70<5=C 16 3017897 70<5=K 33 3017913 70<5=O5<>3> 4 3017946 70<5=O5<K9 214 3017950 70<5=O5B 273 3018164 70<5=O5BAO 149 3018437 70<5=OB 16 3018586 70<5=OBL 367 3018602 70<5=OBLAO 264 3018969 70<5=ONBAO 115 3019233 70<5=ONI89 8 3019348 70<5=ONI8E 8 3019356 70<5@ 5 3019364 70<5@>2 4 3019369 70<5@K 4 3019373 70<5AB8BL 4 3019377 70<5B8< 20 3019381 70<5B8B8 4 3019401 70<5B8BL 24 3019405 70<5B:0 15 3019429 70<5B:C 4 3019444 70<5G0=85 1362 3019448 70<5I05<>9 5 3020810 70<5I05<K9 25 3020815 70<5I05<KE 20 3020840 70<5I05B 56 3020860 70<5I05BAO 22 3020916 70<5I0BL 148 3020938 70<5I0BLAO 34 3021086 70<5I0NBAO 12 3021120 70<5I0NI0O 25 3021132 70<5I0NI53> 12 3021157 70<5I0NI85 4 3021169 70<5I0NI85M;5<5=BK 25 3021173 70<5I0NI89 84 3021198 70<5I0NI8< 16 3021282 70<5I0NI8E 20 3021298 70<5I0O 8 3021318 70<5I5= 124 3021326 70<5I5=85 178 3021450 70<5I5=8O 68 3021628 70<5I5==K9 128 3021696 70<:=CBK9 4 3021824 70<:=CBKE 4 3021828 70<H0 5 3021832 70<H0A25B;K9 11 3021837 70<K:05BAO 5 3021848 70<K:0BLAO 5 3021853 70=5A 20 3021858 70=5A5=0 10 3021878 70=5A5=85 12 3021888 70=5A5=89 10 3021900 70=5A5=8O 12 3021910 70=5A5==K9 15 3021922 70=5A5=K 5 3021937 70=5AB8 26 3021942 70=8<05<>3> 38 3021968 70=8<05<>9 32 3022006 70=8<05<K9 60 3022038 70=8<05<KE 8 3022098 70=8<05B 25 3022106 70=8<0;0 4 3022131 70=8<0BL 49 3022135 70=8<0NB 6 3022184 70=>2> 66 3022190 70=>A8B8 5 3022256 70=>A8BL 5 3022261 70=OB 15 3022266 70=OB85 15 3022281 70=OB8O 15 3022296 70=OB>3> 20 3022311 70=OB>9 32 3022331 70=OB>ABL 9 3022363 70=OBBO 30 3022372 70=OBK9 92 3022402 70=OBL 75 3022494 70> 8 3022569 70?04 4 3022577 70?04=>9 9 3022581 70?04=K9 9 3022590 70?5@5BL 24 3022599 70?88A8 8 3022623 70?8A 6551 3022631 70?8A0; 8 3029182 70?8A0= 403 3029190 70?8A0=0 69 3029593 70?8A0=89 69 3029662 70?8A0==0O 10 3029731 70?8A0==>3> 96 3029741 70?8A0==>5 13 3029837 70?8A0==>9 10 3029850 70?8A0==><C 8 3029860 70?8A0==CN 10 3029868 70?8A0==K5 16 3029878 70?8A0==K9 1266 3029894 70?8A0==K< 44 3031160 70?8A0==K<8 6 3031204 70?8A0==KE 59 3031210 70?8A0=> 341 3031269 70?8A0=K 173 3031610 70?8A0B8 341 3031783 70?8A0BL 2012 3032124 70?8A0BLbom 60 3034136 70?8A0BLjson 38 3034196 70?8A0BLxdto 14 3034234 70?8A0BLxml 103 3034248 70?8A0BL0A8=E 252 3034351 70?8A0BL0B@81CB 70 3034603 70?8A0BL109B 18 3034673 70?8A0BL109B0A8=E 18 3034691 70?8A0BL157>1@01>B:8 44 3034709 70?8A0BL1CD5@42>8G=KE40==KE 21 3034753 70?8A0BL1CD5@42>8G=KE40==KE0A8=E 21 3034774 70?8A0BL25@A8N 16 3034795 70?8A0BL2;>65=8O 23 3034811 70?8A0BL2;>65=8O0A8=E 23 3034834 70?8A0BL2D>@<5 189 3034857 70?8A0BL40BCjson 11 3035046 70?8A0BL7=0G5=85 39 3035057 70?8A0BL7=0G5=85json 11 3035096 70?8A0BL870:@KBL 11 3035107 70?8A0BL87<5=5=8O 28 3035118 70?8A0BL8<OA2>9AB20 35 3035146 70?8A0BL8=AB@C:F8N>1@01>B:8 33 3035181 70?8A0BL:><<5=B0@89 56 3035214 70?8A0BL:>=5F0B@81CB0 30 3035270 70?8A0BL:>=5F<0AA820 15 3035300 70?8A0BL:>=5F>1J5:B0 23 3035315 70?8A0BL:>=5FM;5<5=B0 141 3035338 70?8A0BL=0G0;>0B@81CB0 51 3035479 70?8A0BL=0G0;><0AA820 15 3035530 70?8A0BL=0G0;>>1J5:B0 23 3035545 70?8A0BL=0G0;>M;5<5=B0 152 3035568 70?8A0BL>1JO2;5=85xml 47 3035720 70?8A0BL>B>1@0605<K9>1J5:B 18 3035767 70?8A0BL>B>1@0605<K9>1J5:B0A8=E 18 3035785 70?8A0BL?>18B>2>58 10 3035803 70?8A0BL?>18B>2>58;8 10 3035813 70?8A0BL?>18B>2>58=5 10 3035823 70?8A0BL?>18B>2>58A:;NG8B5;L=>58;8 10 3035833 70?8A0BL?>4?8AL 19 3035843 70?8A0BL?>4?8AL0A8=E 19 3035862 70?8A0BLA5:F8Ncdata 42 3035881 70?8A0BLA8<2>;K 25 3035923 70?8A0BLA8<2>;K0A8=E 20 3035948 70?8A0BLA>45@68<>52D09; 40 3035968 70?8A0BLA>>1I5=850A8=E 15 3036008 70?8A0BLA>>1I5=85A87<5=5=8O<8 5 3036023 70?8A0BLA>>B25BAB285?@>AB@0=AB208<5= 72 3036028 70?8A0BLAAK;:C=0ACI=>ABL 30 3036100 70?8A0BLAB@>:C 41 3036130 70?8A0BLAB@>:C0A8=E 20 3036171 70?8A0BLAE5<C 10 3036191 70?8A0BLB5:AB 98 3036201 70?8A0BLB5:CI89 30 3036299 70?8A0BLB8?4>:C<5=B0 36 3036329 70?8A0BLC40;5=852;>65=89 18 3036365 70?8A0BLC40;5=852;>65=890A8=E 18 3036383 70?8A0BLD09;4;O?5G0B8 24 3036401 70?8A0BLD09;4;O?5G0B80A8=E 23 3036425 70?8A0BLF5;>516 28 3036448 70?8A0BLF5;>5160A8=E 18 3036476 70?8A0BLF5;>532 28 3036494 70?8A0BLF5;>5320A8=E 19 3036522 70?8A0BLF5;>564 28 3036541 70?8A0BLF5;>5640A8=E 18 3036569 70?8A59 3400 3036587 70?8A8 6551 3039987 70?8A8<0:5B0:><?>=>2:840==KE 114 3046538 70?8A8B01;8FK<0:5B0:><?>=>2:840==KE 111 3046652 70?8AK205< 10 3046763 70?8AK205<0O 82 3046773 70?8AK205<0O40B0CAB0=>2:8?0@>;O 13 3046855 70?8AK205<>3> 80 3046868 70?8AK205<>5 43 3046948 70?8AK205<>9 13 3046991 70?8AK205<>< 12 3047004 70?8AK205<K5 20 3047016 70?8AK205<K9 480 3047036 70?8AK205<KE 107 3047516 70?8AK205B 708 3047623 70?8AK205BAO 544 3048331 70?8AK20;>AL 4 3048875 70?8AK20;AO 43 3048879 70?8AK20BL 1015 3048922 70?8AK20BL2K1@0==K5 9 3049937 70?8AK20BL40<??@87025@H5=88?>?@52KH5=8N?0<OB8 23 3049946 70?8AK20BL<>48D8F8@>20==K5 9 3049969 70?8AK20BLAO 918 3049978 70?8AK20NBAO 325 3050896 70?8AK20NI89 4 3051221 70?8AL 30689 3051225 70?8ALdom 37 3081914 70?8ALfastinfoset 171 3081951 70?8ALhtml 52 3082122 70?8ALjson 155 3082174 70?8ALndef2=5H=53>B8?0 31 3082329 70?8ALpdf 170 3082360 70?8ALxml 330 3082530 70?8ALzipD09;0 68 3082860 70?8AL0C48>2D>=>2><@568<5 9 3082928 70?8AL40==KE 338 3082937 70?8AL42865=89?@8?@>2545=88 36 3083275 70?8AL6C@=0;0sms 59 3083311 70?8AL6C@=0;072>=:>2 35 3083370 70?8AL6C@=0;0@538AB@0F88 27 3083405 70?8AL8AB>@8840==KE 121 3083432 70?8AL=0945=0 10 3083553 70?8AL?5@5@0AG5B>2 19 3083563 70?8AL@07@5H5=0 11 3083582 70?8ALA>>1I5=8O 37 3083593 70?8ALA>>1I5=8O>1<5=0 77 3083630 70?8ALB5:AB0 60 3083707 70?8ALB5:CI59AB@>:8A?8A:0 9 3083767 70?8ALC40;5=0 15 3083776 70?8ALC7;>2dom 175 3083791 70?8ALD09;00@E820 58 3083966 70?8ALD0:B8G5A:>3>?5@8>40459AB28O 19 3084024 70?8ALN 288 3084043 70?8AO< 194 3084331 70?8AO<8 88 3084525 70?8AOE 100 3084613 70?8H5< 7 3084713 70?>;=5= 290 3084720 70?>;=5=0 33 3085010 70?>;=5=85 1220 3085043 70?>;=5=85< 20 3086263 70?>;=5=85?>4?8A0=85 9 3086283 70?>;=5=85?>4?8A0=850==>B8@>20=85 9 3086292 70?>;=5=85?>4A:07:87=0G5=89 32 3086301 70?>;=5=85?>4A:07:87=0G5=894803@0<<K 55 3086333 70?>;=5=85?>A;54>20B5;L=>AB59 37 3086388 70?>;=5=85@0AH8D@>2:8 18 3086425 70?>;=5=88 23 3086443 70?>;=5=8O 975 3086466 70?>;=5==0O 35 3087441 70?>;=5==>3> 5 3087476 70?>;=5==>9 5 3087481 70?>;=5==>ABL 89 3087486 70?>;=5==CN 72 3087575 70?>;=5==K5 10 3087647 70?>;=5==K9 826 3087657 70?>;=5==K< 11 3088483 70?>;=5==K<8 14 3088494 70?>;=5==KE 15 3088508 70?>;=5=> 278 3088523 70?>;=5=K 81 3088801 70?>;=8BAO 6 3088882 70?>;=8BL 433 3088888 70?>;=8BL7=0G5=8O 13 3089321 70?>;=8BL7=0G5=8OA2>9AB2 32 3089334 70?>;=8BL=0AB@>9:8 26 3089366 70?>;=8BL?><5B:8 14 3089392 70?>;=8BL?@8?5@5>B:@KB88A4@C3>3>A5@25@0 11 3089406 70?>;=8BL?@>D8;L 19 3089417 70?>;=8BLAO 18 3089436 70?>;=8BLF25B04803@0<< 4 3089454 70?>;=8BLF25B0A5@89 17 3089458 70?>;=O5<>5 4 3089475 70?>;=O5<>9 4 3089479 70?>;=O5<K9 8 3089483 70?>;=O5B 97 3089491 70?>;=O5BAO 1008 3089588 70?>;=OBAO 12 3090596 70?>;=OBL 182 3090608 70?>;=OBL02B><0B8G5A:8 13 3090790 70?>;=OBL8740==KE70?>;=5=8O 81 3090803 70?>;=OBL?0@0<5B@K 6 3090884 70?>;=OBLAO 1178 3090890 70?>;=ONBAO 122 3092068 70?>;=ONI89 65 3092190 70?>;=OO 4 3092255 70?><8=05B 4 3092259 70?><8=05BAO 8 3092263 70?><8=0=85 4 3092271 70?><8=0=8O 4 3092275 70?><8=0BL 4 3092279 70?><8=0BLAO 10 3092283 70?><8=0NBAO 5 3092293 70?><8=0NI89AO?0@>;L 5 3092298 70?><=5==>3> 4 3092303 70?><=5==K9 4 3092307 70?><=8BL 29 3092311 70?@0H8205<0ODC=:F8>=0;L=>ABL<>18;L=>3>?@8;>65=8O 6 3092340 70?@0H8205<>3> 18 3092346 70?@0H8205<K9 42 3092364 70?@0H8205<KE 24 3092406 70?@0H8205B 24 3092430 70?@0H8205BAO 55 3092454 70?@0H8209B5 5 3092509 70?@0H820;8AL 6 3092514 70?@0H820;>AL 5 3092520 70?@0H820BL 34 3092525 70?@0H820BL2>7<>6=>ABL 6 3092559 70?@0H820BL?>;L7>20B5;LA:>5?@54AB02;5=85 19 3092565 70?@0H820BLAO 85 3092584 70?@0H820NBAO 4 3092669 70?@0H820NI89 4 3092673 70?@5B 98 3092677 70?@5B0 64 3092775 70?@5B8BL 92 3092839 70?@5B8BL;>:0;L=>5@0A?>7=020=85@5G8 47 3092931 70?@5B8BL?5@5B0A:820=858@0ABO3820=85 9 3092978 70?@5B8BL@0ABO3820=85 9 3092987 70?@5B8BL@540:B8@>20=85 9 3092996 70?@5B>< 10 3093005 70?@5I05B 83 3093015 70?@5I05BAO 5 3093098 70?@5I0BL 97 3093103 70?@5I0BL=570?>;=5==K57=0G5=8O 29 3093200 70?@5I0BLAO 10 3093229 70?@5I0NI55 10 3093239 70?@5I0NI89 10 3093249 70?@5I5= 111 3093259 70?@5I5=0 72 3093370 70?@5I5=85 25 3093442 70?@5I5=8O 8 3093467 70?@5I5==K5?>4AB0=>2:8 16 3093475 70?@5I5==K5?>4AB0=>2:8xs 20 3093491 70?@5I5==K9 532 3093511 70?@5I5==KE 15 3094043 70?@5I5=> 296 3094058 70?@5I5=>2>AAB0=02;820BL?0@>;L 9 3094354 70?@5I5=>87<5=OBL?0@>;L 69 3094363 70?@5I5=>>B:@KB85D>@< 11 3094432 70?@5I5=K 38 3094443 70?@>A 4061 3094481 70?@>A0 2067 3098542 70?@>A0<8 32 3100609 70?@>A0E 25 3100641 70?@>A2K1>@0AE5<K70?@>A0 137 3100666 70?@>A5 559 3100803 70?@>A82H59 42 3101362 70?@>A82H89 42 3101404 70?@>A8;8 4 3101446 70?@>A8< 4 3101450 70?@>A8B 17 3101454 70?@>A8B8 32 3101471 70?@>A8BL 29 3101503 70?@>A8BL<5AB>?>;>65=85 9 3101532 70?@>A8BL@07@5H5=85?>;L7>20B5;O 23 3101541 70?@>A8BL@07@5H5=85?>;L7>20B5;O0A8=E 23 3101564 70?@>A8BLB5;5D>= 9 3101587 70?@>A=0?>;CG5=85;8F5=788 200 3101596 70?@>A>1=>2;5=8O 13 3101796 70?@>A>2 1160 3101809 70?@>A>< 15 3102969 70?@>A?>4B25@645=8O 5 3102984 70?@>AC 40 3102989 70?@>AC=8GB>65=8OB01;8FKAE5<K70?@>A0 40 3103029 70?@>AK 101 3103069 70?@>H5= 18 3103170 70?@>H5==0O 5 3103188 70?@>H5==>5 12 3103193 70?@>H5==K5 4 3103205 70?@>H5==K9 62 3103209 70?@>H5==KE 5 3103271 70?@>H5=> 12 3103276 70?@>H5=K 6 3103288 70?CA: 1423 3103294 70?CA:0 1016 3104717 70?CA:05<>3> 15 3105733 70?CA:05<>5 9 3105748 70?CA:05<K5 5 3105757 70?CA:05<K9 25 3105762 70?CA:05B 61 3105787 70?CA:05BAO 35 3105848 70?CA:09B5 5 3105883 70?CA:0<8 4 3105888 70?CA:0B8 5 3105892 70?CA:0BL 70 3105897 70?CA:0BLAO 54 3105967 70?CA:0E 5 3106021 70?CA:0NBAO 9 3106026 70?CA:5 443 3106035 70?CA:>< 4 3106478 70?CA:?@8;>65=8O<>18;L=>3>CAB@>9AB20 112 3106482 70?CAB82H53> 11 3106594 70?CAB82H89 37 3106605 70?CAB8B8 186 3106642 70?CAB8BL 101 3106828 70?CAB8BL0A8=E 22 3106929 70?CAB8BL157>6840=8O 18 3106951 70?CAB8BL?@8;>65=85 49 3106969 70?CAB8BL?@8;>65=850A8=E 22 3107018 70?CAB8BLA8AB5<C 15 3107040 70?CI5= 128 3107055 70?CI5=0 25 3107183 70?CI5=89 25 3107208 70?CI5==>3> 194 3107233 70?CI5==><C 4 3107427 70?CI5==K9 336 3107431 70?CI5==K< 4 3107767 70?CI5=> 122 3107771 70?CI5=K 31 3107893 70?OB0O 493 3107924 70?OB>9 90 3108417 70?OBCN 143 3108507 70?OBK5 5 3108650 70?OBK<8 257 3108655 70@0=55 41 3108912 70@538AB@8@>20= 96 3108953 70@538AB@8@>20=0 38 3109049 70@538AB@8@>20==> 6 3109087 70@538AB@8@>20==>3> 35 3109093 70@538AB@8@>20==>9 15 3109128 70@538AB@8@>20==K5 5 3109143 70@538AB@8@>20==K9 404 3109148 70@538AB@8@>20==KE 116 3109552 70@538AB@8@>20=> 55 3109668 70@538AB@8@>20=K 36 3109723 70@538AB@8@>20BL 37 3109759 70@538AB@8@>20BL87<5=5=8O 15 3109796 70@538AB@8@C5< 6 3109811 70@575@28@>20==K5 15 3109817 70@575@28@>20==K9 19 3109832 70@575@28@>20==K<8 6 3109851 70@O 49 3109857 70AB02:0 9 3109906 70AK?0=85 10 3109915 70AK?0=88 5 3109925 70AK?0=8O 5 3109930 70B5< 262 3109935 70B5=5==0O?>25@E=>ABL 13 3110197 70B5=8BL 5 3110210 70B5=8BLD;06:8 11 3110215 70B@038205B 5 3110226 70B@03820BL 26 3110231 70B@03820NB 21 3110257 70B@03820NI89 20 3110278 70B@03820NI8<8 20 3110298 70B@0B0 44 3110318 70B@0B0<8 4 3110362 70B@0B8B8 70 3110366 70B@0BK 5 3110436 70B@0G5==>5 14 3110441 70B@0G5==>< 10 3110455 70B@0G5==K9 94 3110465 70B@0G5=> 70 3110559 70B@0G8205<>5 20 3110629 70B@0G8205<K9 20 3110649 70B@>=C2H85 5 3110669 70B@>=C2H89 10 3110674 70B@>=C2H8E 5 3110684 70BCE05B 6 3110689 70BCE0BL 6 3110695 70D8:A8@>20= 13 3110701 70D8:A8@>20=0 10 3110714 70D8:A8@>20==>AB8 5 3110724 70D8:A8@>20==K5 36 3110729 70D8:A8@>20==K9 64 3110765 70D8:A8@>20==KE 20 3110829 70D8:A8@>20BL 18 3110849 70D8:A8@>20BLB01;8FC 11 3110867 70D8:A8@>20BLB@0=70:F8N 48 3110878 70E20B 16 3110926 70E20B0 10 3110942 70E20BC 5 3110952 70E20G5==K9 22 3110957 70E20G5=> 22 3110979 70F8:;5==>9 5 3111001 70F8:;5==>ABL 28 3111006 70F8:;5==>ABLN 20 3111034 70F8:;5==K9 5 3111054 70F8:;5=> 20 3111059 70F8:;8==>ABL 25 3111079 70F8:;8B8 20 3111104 70F8:;8BAO 6 3111124 70F8:;8BLAO 6 3111130 70G5@:820=85 10 3111136 70G5@:820=8O 4 3111146 70G5@:=CB>3> 9 3111150 70G5@:=CBK9 12 3111159 70G5@:=CBL 10 3111171 70H8D@>20= 101 3111181 70H8D@>20==>AB8 9 3111282 70H8D@>20==K5 38 3111291 70H8D@>20==K540==K5 5 3111329 70H8D@>20==K9 188 3111334 70H8D@>20==KE 58 3111522 70H8D@>20BL 51 3111580 70H8D@>20BL0A8=E 21 3111631 70I8B0 390 3111652 70I8B0>B>?0A=KE459AB289 192 3112042 70I8B8BL 16 3112234 70I8B>9 8 3112250 70I8BC 6 3112258 70I8BK 307 3112264 70I8I5= 10 3112571 70I8I5==>3> 98 3112581 70I8I5==>5 110 3112679 70I8I5==>5?@8CAB0=>2:5A>548=5=8O 9 3112789 70I8I5==>5A>548=5=85 68 3112798 70I8I5==>5A>548=5=85nss 11 3112866 70I8I5==>5A>548=5=85openssl 104 3112877 70I8I5==>5A>548=5=85:@8?B>?@> 35 3112981 70I8I5==>5A>548=5=85:@8B>?@> 7 3113016 70I8I5==>< 4 3113023 70I8I5==><C 8 3113027 70I8I5==>ABL 19 3113035 70I8I5==>ABLN 4 3113054 70I8I5==K9 249 3113058 70I8I5==KE 38 3113307 70O2:0 16 3113345 70O2:8 11 3113361 70O2>: 5 3113372 72574 6 3113377 725740 21 3113383 72574>G:0 158 3113404 72574>G:0<8 40 3113562 72574>G:8 6 3113602 72574>G:C 47 3113608 72>=:0 23 3113655 72>=:0E 5 3113678 72>=:5 5 3113683 72>=:89 39 3113688 72>=:>2 56 3113727 72>=>: 95 3113783 72C: 99 3113878 72C:0 66 3113977 72C:>2 9 3114043 72C:>289 15 3114052 72C:>2>3> 15 3114067 72C:>2>5 14 3114082 72C:>2>5>?>25I5=85 29 3114096 72C:>2>9 29 3114125 72C:>2KE 5 3114154 740=85 4 3114159 745AL 30 3114163 75;0=48O 12 3114193 75;5=0O 24 3114205 75;5=0O;C609:0 11 3114229 75;5=89 34 3114240 75;5=> 5 3114274 75;5=>20B> 10 3114279 75;5=>20B>65;BK9 11 3114289 75;5=>20B>;8<>==K9 11 3114300 75;5=>20BK9 10 3114311 75;5=>3> 13 3114321 75;5=>65;BK9 11 3114334 75;5=>9 8 3114345 75;5=CN 4 3114353 75;5=K9 196 3114357 75;5=K9;5A 11 3114553 75<;O 4 3114564 75@:0;L=>A25@EC 13 3114568 75@:0;L=>A;520 13 3114581 78; 9 3114594 78<0 35 3114603 78<10125 12 3114638 78<>9 25 3114650 7=0: 456 3114675 7=0:0 67 3115131 7=0:0<8 3 3115198 7=0:2>?@>A0 9 3115201 7=0:8 172 3115210 7=0:>2 56 3115382 7=0:>2>5 9 3115438 7=0:>2K9 9 3115447 7=0:>< 15 3115456 7=0:><K 3 3115471 7=0:><K9 18 3115474 7=0; 5 3115492 7=0BL 5 3115497 7=0G 26 3115502 7=0G0=85?5@5G8A;5=8O 6 3115528 7=0G0I53> 42 3115534 7=0G0I85 16 3115576 7=0G0I89 73 3115592 7=0G0I8<8 5 3115665 7=0G0I8E 10 3115670 7=0G5=8 4 3115680 7=0G5=85 58701 3115684 7=0G5=851 56 3174385 7=0G5=8510 6 3174441 7=0G5=852 20 3174447 7=0G5=853 4 3174467 7=0G5=85n 18 3174471 7=0G5=85xdto 129 3174489 7=0G5=850B@81CB0 39 3174618 7=0G5=85240==K5D>@<K 27 3174657 7=0G5=852>7=03@0645=8O 5 3174684 7=0G5=852@5:2878BD>@<K 27 3174689 7=0G5=852AB@>:C2=CB@ 18 3174716 7=0G5=852D09; 18 3174734 7=0G5=852K1>@0 32 3174752 7=0G5=853@0D8:0 13 3174784 7=0G5=8545=4@>3@0<<K 5 3174797 7=0G5=854803@0<<K 116 3174802 7=0G5=854803@0<<K30=B0 106 3174918 7=0G5=854;O?@>25@:8 8 3175024 7=0G5=854>87<5=5=8O 12 3175032 7=0G5=8570?>;=5=8O 81 3175044 7=0G5=8570?>;=5=> 173 3175125 7=0G5=8587AB@>:82=CB@ 18 3175298 7=0G5=8587D09;0 18 3175316 7=0G5=85:0@B8=:8 11 3175334 7=0G5=85:;NG0 36 3175345 7=0G5=85:>?8@>20=8O 81 3175381 7=0G5=85< 1834 3175462 7=0G5=85=570?>;=5==>3>@>48B5;O 18 3177296 7=0G5=85>B1>@0 16 3177314 7=0G5=85>B1>@0284>2 9 3177330 7=0G5=85?0@0<5B@0:><?>=>2:840==KE 287 3177339 7=0G5=85?0@0<5B@0<0:5B0:><?>=>2:840==KE 58 3177626 7=0G5=85?0@0<5B@0=0AB@>5::><?>=>2:840==KE 169 3177684 7=0G5=85?5@5G8A;5=8O 278 3177853 7=0G5=85?5@8>40 21 3178131 7=0G5=85?> 31 3178152 7=0G5=85?>4?8A8 9 3178183 7=0G5=85?>8A:0 10 3178192 7=0G5=85?>;O 34 3178202 7=0G5=85?>;O0=0;87040==KE 19 3178236 7=0G5=85?>;O@0AH8D@>2:8:><?>=>2:840==KE 64 3178255 7=0G5=85?><5B:8 6 3178319 7=0G5=85?>A;587<5=5=8O 14 3178325 7=0G5=85?>C<>;G0=8N 21 3178339 7=0G5=85?@>F5=B 9 3178360 7=0G5=85@0745;5=8O40==KE 9 3178369 7=0G5=85@07<5@ 9 3178378 7=0G5=85@5:2878B0 49 3178387 7=0G5=85@5AC@A0 9 3178436 7=0G5=85@>48B5;O 20 3178445 7=0G5=85A 30 3178465 7=0G5=85A5@88 6 3178495 7=0G5=85A5@88A;>O35>3@0D8G5A:>9AE5<K 38 3178501 7=0G5=85B8? 10 3178539 7=0G5=85B>G:8 13 3178549 7=0G5=85C7;0 720 3178562 7=0G5=85D;06:0 11 3179282 7=0G5=85M;5<5=B0 8 3179293 7=0G5=88 646 3179301 7=0G5=89 5677 3179947 7=0G5=8N 1474 3185624 7=0G5=8O 14158 3187098 7=0G5=8O2;>65==KE?0@0<5B@>2 31 3201256 7=0G5=8O3@C??8@>2>: 14 3201287 7=0G5=8O70?>;=5=8O 81 3201301 7=0G5=8O87<5@5=89 141 3201382 7=0G5=8O:;NG0 30 3201523 7=0G5=8O:>;>=:8 6 3201553 7=0G5=8O< 890 3201559 7=0G5=8O<8 624 3202449 7=0G5=8O=>@<0;870F88 15 3203073 7=0G5=8O?0@0<5B@>2 52 3203088 7=0G5=8O?0@0<5B@>22K2>403@C??8@>2:84803@0<<K:><?>=>2:840==KE 75 3203140 7=0G5=8O?0@0<5B@>22K2>403@C??8@>2:8:><?>=>2:840==KE 89 3203215 7=0G5=8O?0@0<5B@>22K2>403@C??8@>2:8B01;8FK:><?>=>2:840==KE 89 3203304 7=0G5=8O?0@0<5B@>22K2>404803@0<<K:><?>=>2:840==KE 93 3203393 7=0G5=8O?0@0<5B@>22K2>40:><?>=>2:840==KE 95 3203486 7=0G5=8O?0@0<5B@>22K2>40B01;8FK:><?>=>2:840==KE 89 3203581 7=0G5=8O?0@0<5B@>240==KE:><?>=>2:840==KE 99 3203670 7=0G5=8O?0@0<5B@>2<0:5B0:><?>=>2:840==KE 90 3203769 7=0G5=8O?5@5G8A;5=8O 9 3203859 7=0G5=8O?>4AB0=>2>: 5 3203868 7=0G5=8O?>4AB0=>2>:H01;>=0A>>1I5=8O 9 3203873 7=0G5=8O?>;59 16 3203882 7=0G5=8O?>;59?@>3=>70 9 3203898 7=0G5=8O?>;59@0AH8D@>2:8:><?>=>2:840==KE 88 3203907 7=0G5=8O?>A;54=53>C@>2=O 17 3203995 7=0G5=8O?@02?>;L7>20B5;O 5 3204012 7=0G5=8OAC1:>=B> 6 3204017 7=0G5=8OE 71 3204023 7=0G5=8OE0@0:B5@8AB8: 9 3204094 7=0G5=8OE0@0:B5@8AB8:70?@>A 25 3204103 7=0G5=8OE0@0:B5@8AB8:B01;8F0 27 3204128 7=0G5=L5 5677 3204155 7=0G8<89 10 3209832 7=0G8<>3> 8 3209842 7=0G8<>9 8 3209850 7=0G8<><C 8 3209858 7=0G8<>AB8 4 3209866 7=0G8<>ABL 19 3209870 7=0G8<CN 9 3209889 7=0G8<K5 22 3209898 7=0G8<K9 66 3209920 7=0G8<KE 26 3209986 7=0G8B 64 3210012 7=0G8B5;L=><C 10 3210076 7=0G8B5;L=CN 6 3210086 7=0G8B5;L=K9 26 3210092 7=0G8BL 64 3210118 7=0G:5 4 3210182 7=0G:8 6 3210186 7=0G:>< 9 3210192 7=0G=89 6 3210201 7=0G>: 30 3210207 7>;>B8ABK9 32 3210237 7>;>B>9 12 3210269 7>=0 20 3210281 7>=C 4 3210301 7>=K 5 3210305 7@5=85 7 3210310 7@5=8O 7 3210317 8 44273 3210324 81 13 3254597 82 13 3254610 83 11 3254623 81 28 3254634 820= 33 3254662 820=>2 26 3254695 820=>28G 25 3254721 825AB10=: 26 3254746 82@8B 14 3254772 83=>@8@>20= 18 3254786 83=>@8@>20=85 28 3254804 83=>@8@>20=8O 28 3254832 83=>@8@>20==K9 20 3254860 83=>@8@>20=> 8 3254880 83=>@8@>20BL 95 3254888 83=>@8@>20BL2@5<O459AB28O 9 3254983 83=>@8@>20BL459AB28B5;L=>ABL?>4?8A8 9 3254992 83=>@8@>20BL7=0G5=8Onull 10 3255001 83=>@8@>20BL8=AB@C:F88>1@01>B:8 14 3255011 83=>@8@>20BL:><<5=B0@88 15 3255025 83=>@8@>20BL=570?>;=5==K57=0G5=8O 4 3255040 83=>@8@>20BL>1JO2;5=85xml 14 3255044 83=>@8@>20BL>H81:8A5@28A0?@>25@:8@0A:@KB8O?0@>;O 45 3255058 83=>@8@>20BL?@>15;K 9 3255103 83=>@8@>20BL?@>15;L=K5A8<2>;K 15 3255112 83=>@8@>20BL?@>25@:C2A?8A:5>B>720==KEA5@B8D8:0B>2 9 3255127 83=>@8@>20BL?CAB>5?@>AB@0=AB2> 9 3255136 83=>@8@>20BL@538AB@ 37 3255145 83=>@8@>20BLAO 1017 3255182 83=>@8@>20BLB8?4>:C<5=B0 14 3256199 83=>@8@C5<K5 16 3256213 83=>@8@C5<K9 16 3256229 83=>@8@C5B 4 3256245 83=>@8@C5BAO 701 3256249 83=>@8@CNBAO 255 3256950 83=>@8@CO 5 3257205 83@05B 5 3257210 83@0BL 5 3257215 84 7 3257220 843@C??K 36 3257227 845=B8D8:0B>@ 4253 3257263 845=B8D8:0B>@0 531 3261516 845=B8D8:0B>@0< 23 3262047 845=B8D8:0B>@0<8 42 3262070 845=B8D8:0B>@2K3@C7:840==KEA8AB5<K2708<>459AB28O 79 3262112 845=B8D8:0B>@35>7>=K 5 3262191 845=B8D8:0B>@4>ABC?0 32 3262196 845=B8D8:0B>@5 5 3262228 845=B8D8:0B>@70?8A8 65 3262233 845=B8D8:0B>@7=0G5=8O 20 3262298 845=B8D8:0B>@7=0G5=8O4803@0<<K30=B0 37 3262318 845=B8D8:0B>@8=B53@0F88A8AB5<K2708<>459AB28O 29 3262355 845=B8D8:0B>@8=B5@20;04803@0<<K30=B0 17 3262384 845=B8D8:0B>@8=D>@<0F8>==>9107K 78 3262401 845=B8D8:0B>@:;0AB5@0 11 3262479 845=B8D8:0B>@:;85=B0 15 3262490 845=B8D8:0B>@:;NG0 9 3262505 845=B8D8:0B>@:><?>=>2:840==KE 263 3262514 845=B8D8:0B>@:>=D83C@0F88 5 3262777 845=B8D8:0B>@<5=5465@0:;0AB5@0 11 3262782 845=B8D8:0B>@<>45;8 19 3262793 845=B8D8:0B>@<>45;8@0A?>7=020=8O@5G8 29 3262812 845=B8D8:0B>@=07=0G5=8O 16 3262841 845=B8D8:0B>@=0AB@>9:8 17 3262857 845=B8D8:0B>@>1AC645=8O 24 3262874 845=B8D8:0B>@>1AC645=8OA8AB5<K2708<>459AB28O 147 3262898 845=B8D8:0B>@>1J5:B0 41 3263045 845=B8D8:0B>@>2 157 3263086 845=B8D8:0B>@>< 251 3263243 845=B8D8:0B>@>B;>65==>3>@0A?>7=020=8O@5G8 33 3263494 845=B8D8:0B>@?>4?8AG8:04>AB02;O5<KEC254><;5=89 42 3263527 845=B8D8:0B>@?>:C?:8 19 3263569 845=B8D8:0B>@?>;L7>20B5;LA:>9=0AB@>9:8 251 3263588 845=B8D8:0B>@?>;L7>20B5;O2=5H=59A8AB5<K 9 3263839 845=B8D8:0B>@?>;L7>20B5;O8=D>@<0F8>==>9107K 9 3263848 845=B8D8:0B>@?>;L7>20B5;O?@>20945@0openid 36 3263857 845=B8D8:0B>@?>;L7>20B5;OA8AB5<K2708<>459AB28O 133 3263893 845=B8D8:0B>@?@8;>65=8O 25 3264026 845=B8D8:0B>@?@8;>65=8OA8AB5<K2708<>459AB28O 39 3264051 845=B8D8:0B>@?@>F5AA0 55 3264090 845=B8D8:0B>@@01>G53>?@>F5AA0 11 3264145 845=B8D8:0B>@@01>G53>A5@25@0 11 3264156 845=B8D8:0B>@@0AH8D@>2:8 60 3264167 845=B8D8:0B>@@0AH8D@>2:8:><?>=>2:840==KE 75 3264227 845=B8D8:0B>@@5:;0<=>3>1;>:0 26 3264302 845=B8D8:0B>@@5AC@A0 7 3264328 845=B8D8:0B>@A50=A0 22 3264335 845=B8D8:0B>@A>1KB8O 6 3264357 845=B8D8:0B>@A>548=5=8O 33 3264363 845=B8D8:0B>@A>>1I5=8O 24 3264396 845=B8D8:0B>@A>>1I5=8O70?@>A0 22 3264420 845=B8D8:0B>@A>>1I5=8OA8AB5<K2708<>459AB28O 42 3264442 845=B8D8:0B>@AB@>:8 5 3264484 845=B8D8:0B>@B01;8FK 9 3264489 845=B8D8:0B>@B5:CI53>?>;L7>20B5;O 10 3264498 845=B8D8:0B>@B5:CI53>?@8;>65=8O 10 3264508 845=B8D8:0B>@B>:5=04>ABC?0 36 3264518 845=B8D8:0B>@B@51>20=8O 11 3264554 845=B8D8:0B>@C 334 3264565 845=B8D8:0B>@CAB@>9AB20 9 3264899 845=B8D8:0B>@CG5B=>970?8A8 12 3264908 845=B8D8:0B>@D09;0 18 3264920 845=B8D8:0B>@D>@<K 22 3264938 845=B8D8:0B>@D>@<K88<O@5:2878B0 6 3264960 845=B8D8:0B>@H01;>=0A>>1I5=8OA8AB5<K2708<>459AB28O 35 3264966 845=B8D8:0B>@K 118 3265001 845=B8D8:0B>@K<5=5465@>2 11 3265119 845=B8D8:0B>@K?>:C?>: 23 3265130 845=B8D8:0B>@KAB@0=8F 4 3265153 845=B8D8:0F88 230 3265157 845=B8D8:0F8>==CN 4 3265387 845=B8D8:0F8>==K9 4 3265391 845=B8D8:0F8N 5 3265395 845=B8D8:0F8O 235 3265400 845=B8D8F8@>20= 8 3265635 845=B8D8F8@>20==K9 8 3265643 845=B8D8F8@>20BL 64 3265651 845=B8D8F8@>20BLAO 40 3265715 845=B8D8F8@C5B 51 3265755 845=B8D8F8@C5BAO 28 3265806 845=B8D8F8@CNI0O 20 3265834 845=B8D8F8@CNI55 42 3265854 845=B8D8F8@CNI89 118 3265896 845=B8D8F8@CNI8E 44 3266014 845=B8D8F8@CNICN 8 3266058 845=B8G5= 10 3266066 845=B8G=0 17 3266076 845=B8G=>AB8 222 3266093 845=B8G=>ABL 395 3266315 845=B8G=CN 8 3266710 845=B8G=K 7 3266718 845=B8G=K9 46 3266725 845=B8G=K<8 4 3266771 845=BD8:0B>@ 8 3266775 845B 47 3266783 84@5:2878B0 7 3266830 84A?@02>G=8:0 7 3266837 84B8 4 3266844 84CB 5 3266848 84CI89 8 3266853 84CI8E 8 3266861 84D>@<K 7 3266869 84K 18 3266876 84QB 8 3266894 85@0@E859 29 3266902 85@0@E88 507 3266931 85@0@E8G5A:0O 41 3267438 85@0@E8G5A:0O3@C??8@>2:04803@0<<K<0:5B0:><?>=>2:840==KE 34 3267479 85@0@E8G5A:0O3@C??8@>2:0<0:5B0:><?>=>2:840==KE 21 3267513 85@0@E8G5A:0O3@C??8@>2:0B01;8FK<0:5B0:><?>=>2:840==KE 64 3267534 85@0@E8G5A:8 10 3267598 85@0@E8G5A:85 15 3267608 85@0@E8G5A:8570?8A8<0:5B0:><?>=>2:840==KE 6 3267623 85@0@E8G5A:8570?8A8B01;8FK<0:5B0:><?>=>2:840==KE 6 3267629 85@0@E8G5A:89 520 3267635 85@0@E8G5A:89?>@O4>: 39 3268155 85@0@E8G5A:89?@>A<>B@ 44 3268194 85@0@E8G5A:89A?8A>: 9 3268238 85@0@E8G5A:8< 34 3268247 85@0@E8G5A:8<8 8 3268281 85@0@E8G5A:8E 127 3268289 85@0@E8G5A:>3> 97 3268416 85@0@E8G5A:>5 33 3268513 85@0@E8G5A:>9 72 3268546 85@0@E8G5A:>< 8 3268618 85@0@E8G5A:CN 34 3268626 85@0@E8G=>AB8 5 3268660 85@0@E8G=>ABL 5 3268665 85@0@E8N 12 3268670 85@0@E8O 626 3268682 85@0@E8O3@C??8M;5<5=B>2 13 3269308 85@0@E8OM;5<5=B>2 13 3269321 87 18981 3269334 87xmlB8?0 32 3288315 871560=85 5 3288347 871560BL 229 3288352 87181;8>B5:8 227 3288581 871@0==>3> 85 3288808 871@0==>5 143 3288893 871@0==>5@01>BK?>;L7>20B5;O 71 3289036 871@0==>< 4 3289107 871@0==K9 143 3289111 871@0==K< 8 3289254 871KB>G=K5 10 3289262 871KB>G=K9 10 3289272 8725AB5= 15 3289282 8725AB=> 19 3289297 8725AB=>3> 16 3289316 8725AB=K 9 3289332 8725AB=K9 64 3289341 8725AB=KE 4 3289405 872;5:05B 43 3289409 872;5:05BAO 9 3289452 872;5:0BL 44 3289461 872;5:0BLAO 18 3289505 872;5G5= 16 3289523 872;5G5=85 103 3289539 872;5G5=85B5:AB0 29 3289642 872;5G5=88 65 3289671 872;5G5=8O 8 3289736 872;5G5==>5 8 3289744 872;5G5==K9 49 3289752 872;5G5=K 18 3289801 872;5GL 52 3289819 872;5GL2A5 27 3289871 872;5GLB>;L:>B5:AB 10 3289898 872=5 20 3289908 8740B5;5 4 3289928 8740B5;L 44 3289932 8740B5;N 12 3289976 8740B5;O 28 3289988 87:0@B8=:8 4 3290016 87<5=5= 587 3290020 87<5=5=0 91 3290607 87<5=5=85 5115 3290698 87<5=5=850CB5=B8D8:0F88>AA50=A0 6 3295813 87<5=5=8570@538AB@8@>20=> 14 3295819 87<5=5=857=0G5=89?>;59 10 3295833 87<5=5=857=0G5=8O 29 3295843 87<5=5=858:>=B@>;L 14 3295872 87<5=5=858AB>@8840==KE 6 3295886 87<5=5=858AB>@8840==KE>BACBAB2CNI8E40==KE 6 3295892 87<5=5=85:><<5=B0@8O25@A888AB>@8840==KE 6 3295898 87<5=5=85< 41 3295904 87<5=5=85=0AB@>5:8AB>@8840==KE 6 3295945 87<5=5=85@07<5@0 31 3295951 87<5=5=85@07<5@0:>;>=:8 20 3295982 87<5=5=85@07<5@0>:=0 20 3296002 87<5=5=85A?>A>10>B>1@065=8O>:=0 25 3296022 87<5=5=85AB0=40@B=>90CB5=B8D8:0F88 12 3296047 87<5=5=85AB0=40@B=>90CB5=B8D8:0F88A50=A0 12 3296059 87<5=5=85B5:AB0@540:B8@>20=8O 11 3296071 87<5=5=85H01;>=02B>@>3>D0:B>@00CB5=B8D8:0F88 36 3296082 87<5=5=88 559 3296118 87<5=5=89 378 3296677 87<5=5=8N 64 3297055 87<5=5=8O 1955 3297119 87<5=5=8O70?>;=5=8O:>?89107K40==KE 6 3299074 87<5=5=8O< 13 3299080 87<5=5=8O<8 24 3299093 87<5=5=8OE 24 3299117 87<5=5==0O 6 3299141 87<5=5==>3> 133 3299147 87<5=5==>5 10 3299280 87<5=5==>9 18 3299290 87<5=5==K5 65 3299308 87<5=5==K5<5B040==K5@0AH8@5=89:>=D83C@0F8887<5=ONBAB@C:BC@C40==KE 16 3299373 87<5=5==K9 6662 3299389 87<5=5==K9A>AB0240==KE 16 3306051 87<5=5==K9A>AB028=45:A>2 11 3306067 87<5=5==K9B8? 7 3306078 87<5=5==K9M;5<5=B 6 3306085 87<5=5==K< 32 3306091 87<5=5==KE 120 3306123 87<5=5=> 5646 3306243 87<5=5=K 190 3311889 87<5=5=L5 378 3312079 87<5=82H89AO 6 3312457 87<5=82H8EAO 6 3312463 87<5=8;0AL 5 3312469 87<5=8;AO 26 3312474 87<5=8B 15 3312500 87<5=8BAO 55 3312515 87<5=8BL 341 3312570 87<5=8BL0A8=E 14 3312911 87<5=8BL:0;5=40@L 14 3312925 87<5=8BL:>=B0:B 14 3312939 87<5=8BL<0AHB01 12 3312953 87<5=8BL@5:2878BK 11 3312965 87<5=8BLA>1KB85 14 3312976 87<5=8BLAB@>:C 34 3312990 87<5=8BLAO 90 3313024 87<5=8BLD>@<C 12 3313114 87<5=8BLM;5<5=BA?8A:0 6 3313126 87<5=O5<>3> 10 3313132 87<5=O5<K9 10 3313142 87<5=O5B 98 3313152 87<5=O5B40==K5 44 3313250 87<5=O5BA>E@0=O5<K540==K5 13 3313294 87<5=O5BAB@C:BC@C40==KE 14 3313307 87<5=O5BAO 162 3313321 87<5=O;0AL 5 3313483 87<5=O;8AL 7 3313488 87<5=O;> 4 3313495 87<5=O;AO 41 3313499 87<5=OBAO 4 3313540 87<5=OBL 510 3313544 87<5=OBL02B>>1=>2;5=85 143 3314054 87<5=OBL2848<>ABL 11 3314197 87<5=OBL4>ABC?=>ABL?>;O 9 3314208 87<5=OBL85@0@E8G5A:89?@>A<>B@ 33 3314217 87<5=OBL=0AB@>9:C 11 3314250 87<5=OBL=0AB@>9:C:>;>=>: 11 3314261 87<5=OBL?>78F8N 11 3314272 87<5=OBL?>78F8N:>;>=>: 11 3314283 87<5=OBL?>@O4>:AB@>: 92 3314294 87<5=OBLA>AB02AB@>: 26 3314386 87<5=OBLA?>A>1>B>1@065=8O>:=0 15 3314412 87<5=OBLA?>A>1@540:B8@>20=8O 88 3314427 87<5=OBLAO 260 3314515 87<5=OBLB5:CI53>@>48B5;O 33 3314775 87<5=ONB 4 3314808 87<5=ONBAO 18 3314812 87<5=ONI53>AO 5 3314830 87<5=ONI85AO 5 3314835 87<5=ONI89 4 3314840 87<5=ONI89AO 10 3314844 87<5=ONI8E 4 3314854 87<5@5=85 3246 3314858 87<5@5=8504@5A0F88 14 3318104 87<5@5=85< 34 3318118 87<5@5=85?;0=8@>2I8:0 100 3318152 87<5@5=85?>AB@>8B5;O70?@>A0 61 3318252 87<5@5=85?>AB@>8B5;O>BG5B0 91 3318313 87<5@5=85@538AB@0 13 3318404 87<5@5=88 10 3318417 87<5@5=89 840 3318427 87<5@5=8N 92 3319267 87<5@5=8O 1875 3319359 87<5@5=8O:>;>=:8 37 3321234 87<5@5=8O< 243 3321271 87<5@5=8O<8 44 3321514 87<5@5=8O?>AB@>8B5;O70?@>A0 70 3321558 87<5@5=8O?>AB@>8B5;O>BG5B0 74 3321628 87<5@5=8OAB@>:8 38 3321702 87<5@5=8OE 5 3321740 87<5@5==0O 6 3321745 87<5@5==K9 6 3321751 87<5@5=L5 840 3321757 87<5@8<>3> 4 3322597 87<5@8<K9 4 3322601 87<5@8B5;L=0O 14 3322605 87<5@8B5;L=>9 72 3322619 87<5@8B5;L=K9 86 3322691 87<5@O5<K9 4 3322777 87<5@O5BAO 40 3322781 87<5@OBL 4 3322821 87<5@OBLAO 40 3322825 87=0G0;L=> 33 3322865 87=0G0;L=K9 33 3322898 87>1@0605<>5 4 3322931 87>1@0605<K9 4 3322935 87>1@0605BAO 10 3322939 87>1@060BL 4 3322949 87>1@060BLAO 10 3322953 87>1@065=85 178 3322963 87>1@065=85< 4 3323141 87>1@065=88 4 3323145 87>1@065=89 17 3323149 87>1@065=8O 102 3323166 87>1@065=L5 17 3323268 87>;8@>20==> 15 3323285 87>;OF88 36 3323300 87>;OF8O 36 3323336 87><5B@8G5A:0O 39 3323372 87><5B@8G5A:0O;5=B0 13 3323411 87><5B@8G5A:0O=5?@5@K2=0O 13 3323424 87><5B@8G5A:0O?8@0<840 21 3323437 87><5B@8G5A:89 56 3323458 87><5B@8G5A:8E 13 3323514 87><5B@8G5A:>9 4 3323527 87@08;L 12 3323531 87@0AE>4>20=0 8 3323543 87@0AE>4>20==K9 8 3323551 87@0AE>4>20BL 4 3323559 87@0AE>4>20BL?>:C?:C 22 3323563 87@0AH8@5=89 4 3323585 87B5@<8=0;0A1>@0 6 3323589 87CG05<K9 4 3323595 87CG05<KE 4 3323599 87CG5=85 4 3323603 87CG5=8O 4 3323607 87D>@<K 33 3323611 87G8A;0 4 3323644 88 6 3323648 89 7 3323654 8:>=:0 11 3323661 8:>=:01 10 3323672 8:>=:02 5 3323682 8:>=:5 4 3323687 8:>=:8 4 3323691 8:>B0 5 3323695 8;8 17864 3323700 8;;NAB@0F88 4 3341564 8;;NAB@0F8O 4 3341568 8;;NAB@8@CNI89 4 3341572 8;;NAB@8@CNICN 4 3341576 8< 61 3341580 8<2>;K 6 3341641 8<55< 5 3341647 8<55<K9 5 3341652 8<55B 5008 3341657 8<55B7=0G5=85 27 3346665 8<55B8<O 27 3346692 8<55BAO 154 3346719 8<5; 5 3346873 8<5;0 8 3346878 8<5;8 5 3346886 8<5;>AL 6 3346891 8<5= 3672 3346897 8<5=0 1887 3350569 8<5=0107K40==KE 9 3352456 8<5=08=B5@D59A>2 6 3352465 8<5=0< 749 3352471 8<5=0<8 706 3353220 8<5=0?0@0<5B@>2 33 3353926 8<5=0A2>9AB24;O2>AAB0=>2;5=8O 15 3353959 8<5=0A2>9AB24;O>1@01>B:82>AAB0=>2;5=8O 13 3353974 8<5=0A2>9AB2A>7=0G5=8O<840B0 8 3353987 8<5=0B8?>2>1J548=5=8O 15 3353995 8<5=0E 23 3354010 8<5=0G0AB59 6 3354033 8<5=5< 1571 3354039 8<5=8 4140 3355610 8<5=85 42 3359750 8<5=8B5;L=>3> 6 3359792 8<5=8B5;L=K9 21 3359798 8<5=8O 42 3359819 8<5==> 74 3359861 8<5=>20=85 30 3359935 8<5=>20=8N 13 3359965 8<5=>20=8O 17 3359978 8<5=>20==0O>1;0ABL 6 3359995 8<5=>20==CN 3 3360001 8<5=>20==K5 31 3360004 8<5=>20==K9 41 3360035 8<5=>20==K9M;5<5=B 10 3360076 8<5=>20==KE 15 3360086 8<5BL 7173 3360101 8<5NB 1028 3367274 8<5NBAO 286 3368302 8<5NI53> 124 3368588 8<5NI53>AO 9 3368712 8<5NI55 64 3368721 8<5NI55AO 9 3368785 8<5NI59 13 3368794 8<5NI5<C 11 3368807 8<5NI5<CAO 4 3368818 8<5NI85 230 3368822 8<5NI85AO 29 3369052 8<5NI89 201 3369081 8<5NI89AO 185 3369282 8<5NI8< 31 3369467 8<5NI8<8 30 3369498 8<5NI8<AO 15 3369528 8<5NI8E 159 3369543 8<5NI8EAO 114 3369702 8<5NICN 36 3369816 8<5O 4 3369852 8<8 18 3369856 8<8B0F8O 4 3369874 8<8B8@>20BL 20 3369878 8<8B8@>20BLAO 5 3369898 8<8B8@C5B 20 3369903 8<8B8@C5BAO 5 3369923 8<?>@B 80 3369928 8<?>@Bxs 846 3370008 8<?>@B0 37 3370854 8<?>@B5 14 3370891 8<?>@B8@>20= 12 3370905 8<?>@B8@>20=85 9 3370917 8<?>@B8@>20=8O 9 3370926 8<?>@B8@>20==>3> 4 3370935 8<?>@B8@>20==>9 10 3370939 8<?>@B8@>20==K9 22 3370949 8<?>@B8@>20=K 14 3370971 8<?>@B8@>20BL 19 3370985 8<?>@B8@>20BL2A5 13 3371004 8<?>@B8@>20BLAO 27 3371017 8<?>@B8@>20BLC75; 25 3371044 8<?>@B8@C5<>3> 8 3371069 8<?>@B8@C5<>9 10 3371077 8<?>@B8@C5<K5 10 3371087 8<?>@B8@C5<K9 29 3371097 8<?>@B8@C5B 12 3371126 8<?>@B8@C5BAO 12 3371138 8<?>@B8@CNBAO 23 3371150 8<?>@B<>45;8xdto 20 3371173 8<O 39486 3371193 8<Oxml 5 3410679 8<O040?B5@0 9 3410684 8<O0@E820 14 3410693 8<O0B@81CB0 30 3410707 8<O107>2>3>B8?0 22 3410737 8<O107K40==KE 47 3410759 8<O157@0AH8@5=8O 43 3410806 8<O187=5A?@>F5AA0 17 3410849 8<O28AB>G=8:540==KE 36 3410866 8<O2=5H=53>8AB>G=8:040==KE 12 3410902 8<O2E>4=>3>D09;0 24 3410914 8<O2K2>48<>3>?>:070B5;O 5 3410938 8<O2KE>4=>3>D09;0 52 3410943 8<O3@C??8@>2:8 25 3410995 8<O3@C??8@>2:81 9 3411020 8<O3@C??8@>2:82 9 3411029 8<O3@C??K 30 3411038 8<O3@C??KA5@89 9 3411068 8<O40==KE 13 3411077 8<O459AB28O 9 3411090 8<O4>:C<5=B0 10 3411099 8<O4><5=0 14 3411109 8<O6C@=0;04>:C<5=B>2 10 3411123 8<O7040G8 10 3411133 8<O7=0G5=8OA8AB5<=>3>?5@5G8A;5=8O 6 3411143 8<O85@0@E8828AB>G=8:540==KE 9 3411149 8<O87<5@5=8O 5 3411158 8<O8=45:A0 5 3411163 8<O8=45:A0E@0=5=8O 6 3411168 8<O8=B5@D59A0 6 3411174 8<O8=D>@<0F8>==>9107K 71 3411180 8<O:0=0;02=5H=53>A5@28A08=B53@0F88 9 3411251 8<O:0B0;>30 37 3411260 8<O:0B0;>302@5<5==KED09;>2 5 3411297 8<O:0B0;>304>:C<5=B>2 5 3411302 8<O:;0AA0 18 3411307 8<O:;0AA0com 6 3411325 8<O:;85=B0;8F5=78@>20=8O 5 3411331 8<O:=>?:8 12 3411336 8<O:>;>=:8 47 3411348 8<O:><0=4K 19 3411395 8<O:><?LNB5@0 121 3411414 8<O:>=AB0=BK 10 3411535 8<O:>?88 17 3411545 8<O<0:5B0 16 3411562 8<O<5B>40 66 3411578 8<O<>4C;O 42 3411644 8<O<>4C;O:@8?B>3@0D88 33 3411686 8<O=>B0F88 46 3411719 8<O>1;0AB8 23 3411765 8<O>1J5:B0 21 3411788 8<O>1J5:B0<5B040==KE 7 3411809 8<O>1J5:B0?>8A:0 12 3411816 8<O>B?@028B5;O 63 3411828 8<O>B?@028B5;O0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 3411891 8<O?0@0<5B@>2?5G0B8 11 3411927 8<O?5@5G8A;5=8O 28 3411938 8<O?;0=0284>2@0AG5B0 10 3411966 8<O?;0=0284>2E0@0:B5@8AB8: 10 3411976 8<O?;0=0>1<5=0 17 3411986 8<O?;0=0AG5B>2 10 3412003 8<O?>:070B5;O 18 3412013 8<O?>;8B8:8 5 3412031 8<O?>;8B8:8?0@>;59 57 3412036 8<O?>;L7>20B5;O 294 3412093 8<O?>;L7>20B5;O2=5H=53>A5@28A08=B53@0F88 9 3412387 8<O?>;L7>20B5;O81 6 3412396 8<O?>;L7>20B5;O8=D>@<0F8>==>9107K 23 3412402 8<O?>;L7>20B5;O8=D>@<0F8>==>9107K2K?>;=5=8O>1@01>B:8 9 3412425 8<O?>;O 217 3412434 8<O?>;OE@0=5=8O 7 3412651 8<O?>@B0 5 3412658 8<O?>A;54>20B5;L=>AB8 7 3412663 8<O?@020 6 3412670 8<O?@54>?@545;5==>3>7=0G5=8O 6 3412676 8<O?@54>?@545;5==KE40==KE 176 3412682 8<O?@8;>65=8O 78 3412858 8<O?@8=B5@0 29 3412936 8<O?@>20945@0 25 3412965 8<O?@>AB@0=AB20 13 3412990 8<O?@>D8;O 85 3413003 8<O?@>F54C@K 199 3413088 8<O?@>F54C@K>1@01>B:8>H81:8 70 3413287 8<O@538AB@0 11 3413357 8<O@538AB@01CE30;B5@88 10 3413368 8<O@538AB@0=0:>?;5=8O 10 3413378 8<O@538AB@0@0AG5B0 10 3413388 8<O@538AB@0A2545=89 10 3413398 8<O@57C;LB8@CNI53>D09;0 8 3413408 8<O@5:2878B0 82 3413416 8<O@5AC@A0 7 3413498 8<OA2>9AB20 54 3413505 8<OA5@25@0 15 3413559 8<OA5@28A0 68 3413574 8<OA5@88 5 3413642 8<OA8AB5<=>3>?5@5G8A;5=8O 11 3413647 8<OA;C61KA5@25@0 11 3413658 8<OA>1KB8O 166 3413669 8<OA>548=5=8O 9 3413835 8<OA>E@0=5=8O?>;>65=8O>:=0 22 3413844 8<OA?@02>G=8:0 16 3413866 8<OAAK;>G=>3>:;NG0 11 3413882 8<OAB@0=8FK 11 3413893 8<OB01;8FK 59 3413904 8<OB01;8FKE@0=5=8O 6 3413963 8<OB5:CI53>A5@28A0 11 3413969 8<OB5<?D09;0 8 3413980 8<OB8?0 67 3413988 8<OB8?0M;5<5=B0 11 3414055 8<OB>G:8<0@H@CB0 6 3414066 8<OB>G:8?>4:;NG5=8O 5 3414072 8<OC7;0 569 3414077 8<OCG5B=>970?8A8 9 3414646 8<OD09;0 918 3414655 8<OD09;0html 13 3415573 8<OD09;0xml 18 3415586 8<OD09;0107K 5 3415604 8<OD09;070?@>A0 15 3415609 8<OD09;070H8D@>20==>3>:>=B59=5@0 12 3415624 8<OD09;08=45:A0 9 3415636 8<OD09;08AB>G=8:0 36 3415645 8<OD09;0;8F5=788 25 3415681 8<OD09;0?@85<=8:0 36 3415706 8<OD09;0?C1;8:0F88 9 3415742 8<OD09;0A5@B8D8:0B0 12 3415751 8<OD>@<K 52 3415763 8<ODC=:F882>AAB0=>2;5=8O 19 3415815 8<ODC=:F88?@5>1@07>20=8O 8 3415834 8<OH01;>=0 5 3415842 8<OH01;>=0=0AB@>9:8 9 3415847 8<OH@8DB0 10 3415856 8<OM;5<5=B0 390 3415866 8<OM;5<5=B03@0D8G5A:>9AE5<K 5 3416256 8<OM;5<5=B0>B1>@0 6 3416261 8= 15 3416267 8=0G5 1165 3416282 8=0G55A;8 95 3417447 8=25@A8O 4 3417542 8=25@B8@>20==K9 4 3417546 8=25@B8@>20==K9F25BD>=0 9 3417550 8=25@B8@>20==K< 4 3417559 8=25@B8@>20BL 12 3417563 8=25@B8@>20BLAO 4 3417575 8=25@B8@CNBAO 4 3417579 8=4 7 3417583 8=45:A 8923 3417590 8=45:A0 12 3426513 8=45:A1 12 3426525 8=45:Axbase 56 3426537 8=45:A0 385 3426593 8=45:A0:BC0;5= 19 3426978 8=45:A0< 214 3426997 8=45:A0<8 188 3427211 8=45:A0F88 20 3427399 8=45:A0F8N 10 3427419 8=45:A0F8O 87 3427429 8=45:A5 20 3427516 8=45:A8@>20=85 235 3427536 8=45:A8@>20=8O 103 3427771 8=45:A8@>20==0O 8 3427874 8=45:A8@>20==K9 8 3427882 8=45:A8@>20BL 184 3427890 8=45:A8@>20BLA4>?C?>@O4>G820=85< 9 3428074 8=45:A8@>20BLAO 14 3428083 8=45:A8@C5<>5 6 3428097 8=45:A8@C5<K5?>;O 9 3428103 8=45:A8@C5<K9 15 3428112 8=45:A8@C5<KE 9 3428127 8=45:A8@C5B 5 3428136 8=45:A8@CNBAO 10 3428141 8=45:A:0@B8=:8 13 3428151 8=45:A:=>?:8 6 3428164 8=45:A:>;;5:F88 23 3428170 8=45:A<0:A 12 3428193 8=45:A<0@:5@0 16 3428205 8=45:A<8= 12 3428221 8=45:A=>3> 26 3428233 8=45:A=>< 4 3428259 8=45:A=><C 4 3428263 8=45:A=K5 4 3428267 8=45:A=K9 59 3428271 8=45:A=K< 10 3428330 8=45:A=K<8 5 3428340 8=45:A=KE 5 3428345 8=45:A>2 337 3428350 8=45:A>< 207 3428687 8=45:A?>=><5=:;0BC@5 5 3428894 8=45:AA5@88 4 3428899 8=45:AAB8;O 5 3428903 8=45:AAB@>:8 9 3428908 8=45:AAE5<K70?@>A0 35 3428917 8=45:AB5::>;>=:8 5 3428952 8=45:AB5:AB@0=8FK 5 3428957 8=45:AB5:AB@>:8 15 3428962 8=45:AB5:CH59:>;>=:8 6 3428977 8=45:AB>G:8 4 3428983 8=45:AC 1596 3428987 8=45:AD8;LB@0 28 3430583 8=45:AK 233 3430611 8=45:AK:>;;5:F88 41 3430844 8=45:AK=><5=:;0BC@K 5 3430885 8=45:AKAE5<K70?@>A0 54 3430890 8=45:AM;5<5=B0:>;;5:F88 50 3430944 8=45:AOG59:8 9 3430994 8=45=B 70 3431003 8=45=B8D8:0B>@ 4 3431073 8=45?5=45=B 27 3431077 8=48284C0;L=> 5 3431104 8=48284C0;L=K9 21 3431109 8=48284C0;L=K< 9 3431130 8=483> 12 3431139 8=489 40 3431151 8=48:0B>@ 250 3431191 8=48:0B>@0 173 3431441 8=48:0B>@24803@0<<5 10 3431614 8=48:0B>@5 9 3431624 8=48:0B>@>< 20 3431633 8=48:0F88 5 3431653 8=48:0F8O 5 3431658 8=48O 40 3431663 8=4>=5789A:89 14 3431703 8=4>=578O 12 3431717 8=8F80;870F859 18 3431729 8=8F80;870F88 234 3431747 8=8F80;870F8N 38 3431981 8=8F80;870F8O 329 3432019 8=8F80;878@>20= 29 3432348 8=8F80;878@>20==CN 5 3432377 8=8F80;878@>20==K5?@54>?@545;5==K540==K5?;0=0284>2@0AG5B0 6 3432382 8=8F80;878@>20==K5?@54>?@545;5==K540==K5?;0=0284>2E0@0:B5@8AB8: 6 3432388 8=8F80;878@>20==K5?@54>?@545;5==K540==K5?;0=0AG5B>2 6 3432394 8=8F80;878@>20==K5?@54>?@545;5==K540==K5A?@02>G=8:0 6 3432400 8=8F80;878@>20==K9 118 3432406 8=8F80;878@>20==KE 6 3432524 8=8F80;878@>20=K 61 3432530 8=8F80;878@>20BL 156 3432591 8=8F80;878@>20BL0A8=E 58 3432747 8=8F80;878@>20BL?@54>?@545;5==K540==K5 11 3432805 8=8F80;878@>20BLAO 92 3432816 8=8F80;878@C5< 9 3432908 8=8F80;878@C5B 47 3432917 8=8F80;878@C5BAO 85 3432964 8=8F80;878@CNBAO 7 3433049 8=8F80;878@CO 4 3433056 8=8F80;8<5=8 6 3433060 8=8F80;>BG5AB20 6 3433066 8=8F80F88 9 3433072 8=8F80F8O 9 3433081 8=8F88@>202H89 30 3433090 8=8F88@>202H8< 5 3433120 8=8F88@>20; 19 3433125 8=8F88@>20;> 5 3433144 8=8F88@>20=0 84 3433149 8=8F88@>20=85 42 3433233 8=8F88@>20=8O 4 3433275 8=8F88@>20==K9 356 3433279 8=8F88@>20=> 272 3433635 8=8F88@>20BL 158 3433907 8=8F88@>20BLAO 5 3434065 8=8F88@C5<K5 5 3434070 8=8F88@C5<K9 5 3434075 8=8F88@C5B 108 3434080 8=8F88@C5BAO 5 3434188 8=8F88@CNI53> 20 3434193 8=8F88@CNI89 20 3434213 8=:@5<5=B0;L=K9 9 3434233 8== 6 3434242 8==0 6 3434248 8=>340 10 3434254 8=>3> 5 3434264 8=>9 196 3434269 8=>< 10 3434465 8=><C 10 3434475 8=AB@C:F859 4 3434485 8=AB@C:F88 156 3434489 8=AB@C:F89 46 3434645 8=AB@C:F8N 12 3434691 8=AB@C:F8O 215 3434703 8=AB@C:F8O<8 12 3434918 8=AB@C:F8O>1@01>B:8 258 3434930 8=AB@C:F8O>1@01>B:8dom 812 3435188 8=AB@C<5=B 14 3436000 8=AB@C<5=B>2 14 3436014 8=B53@0F859 4 3436028 8=B53@0F88 448 3436032 8=B53@0F89 43 3436480 8=B53@0F8>==K9 22 3436523 8=B53@0F8>==KE 22 3436545 8=B53@0F8N 20 3436567 8=B53@0F8O 5283 3436587 8=B53@0F8OA8AB5<K2708<>459AB28O 81 3441870 8=B53@0F8OE 32 3441951 8=B53@8@>20= 17 3441983 8=B53@8@>20==K9 17 3442000 8=B5;;5:BC0;L=>3> 4 3442017 8=B5;;5:BC0;L=K9 4 3442021 8=B5?@5B8@>20BL 5 3442025 8=B5?@5B8@C5BAO 12 3442030 8=B5@0:B82=0O 55 3442042 8=B5@0:B82=0O0:B820F8O 6 3442097 8=B5@0:B82=0O>B<5=0?@>2545=8O 5 3442103 8=B5@0:B82=0O?><5B:0C40;5=8O 5 3442108 8=B5@0:B82=0O?><5B:0C40;5=8O?@54>?@545;5==KE40==KE 6 3442113 8=B5@0:B82=> 187 3442119 8=B5@0:B82=>3> 295 3442306 8=B5@0:B82=>5 45 3442601 8=B5@0:B82=>52K?>;=5=85 6 3442646 8=B5@0:B82=>54>102;5=85 5 3442652 8=B5@0:B82=>587<5=5=85?@>2545==KE 5 3442657 8=B5@0:B82=>5>B:@KB852=5H=8E>1@01>B>: 6 3442662 8=B5@0:B82=>5>B:@KB852=5H=8E>BG5B>2 6 3442668 8=B5@0:B82=>5?@>2545=85 5 3442674 8=B5@0:B82=>5?@>2545=85=5>?5@0B82=>5 5 3442679 8=B5@0:B82=>5A=OB85?><5B:8C40;5=8O 5 3442684 8=B5@0:B82=>5A=OB85?><5B:8C40;5=8O?@54>?@545;5==KE40==KE 6 3442689 8=B5@0:B82=>5C40;5=85 5 3442695 8=B5@0:B82=>5C40;5=85?><5G5==KE 5 3442700 8=B5@0:B82=>5C40;5=85?><5G5==KE?@54>?@545;5==KE40==KE 6 3442705 8=B5@0:B82=>5C40;5=85?@54>?@545;5==KE40==KE 6 3442711 8=B5@0:B82=>9 198 3442717 8=B5@0:B82=>< 204 3442915 8=B5@0:B82=><C 60 3443119 8=B5@0:B82=>AB8 4 3443179 8=B5@0:B82=>ABL 4 3443183 8=B5@0:B82=CN 15 3443187 8=B5@0:B82=K5 41 3443202 8=B5@0:B82=K9 1089 3443243 8=B5@0:B82=K9AB0@B 6 3444332 8=B5@0:B82=K< 31 3444338 8=B5@0:B82=KE 8 3444369 8=B5@20; 1642 3444377 8=B5@20;0 782 3446019 8=B5@20;0< 4 3446801 8=B5@20;0<8 16 3446805 8=B5@20;2:;NG0O3@0=8FK 13 3446821 8=B5@20;2:;NG0O=0G0;> 13 3446834 8=B5@20;2:;NG0O>:>=G0=85 13 3446847 8=B5@20;40B 7 3446860 8=B5@20;4803@0<<K30=B0 110 3446867 8=B5@20;5 79 3446977 8=B5@20;7025@H5=8O 13 3447056 8=B5@20;<564CM;5<5=B0<8D>@<K 59 3447069 8=B5@20;>2 246 3447128 8=B5@20;>< 18 3447374 8=B5@20;?>2B>@0 9 3447392 8=B5@20;?>2B>@0?@8020@89=><7025@H5=88 18 3447401 8=B5@20;C 8 3447419 8=B5@20;D>=04803@0<<K30=B0 32 3447427 8=B5@20;D>=0?;0=8@>2I8:0 80 3447459 8=B5@20;K 96 3447539 8=B5@20;KD>=0 26 3447635 8=B5@20;KD>=04803@0<<K30=B0 35 3447661 8=B5@20;M:2820;5=B=>AB82@5<5=8 4 3447696 8=B5@5AC5<>3> 5 3447700 8=B5@5AC5<K9 5 3447705 8=B5@=0F8>=0;L=K5 5 3447710 8=B5@=0F8>=0;L=K9 5 3447715 8=B5@=5B 511 3447720 8=B5@=5B0 40 3448231 8=B5@=5B>< 12 3448271 8=B5@=5B?>GB0 210 3448283 8=B5@=5B?>GB>2>52;>65=85 88 3448493 8=B5@=5B?>GB>2>5A>>1I5=85 310 3448581 8=B5@=5B?>GB>2K504@5A0 70 3448891 8=B5@=5B?>GB>2K52;>65=8O 50 3448961 8=B5@=5B?>GB>2K904@5A 103 3449011 8=B5@=5B?>GB>2K9?@>D8;L 204 3449114 8=B5@=5B?@>:A8 115 3449318 8=B5@=5BA>548=5=85 33 3449433 8=B5@=5BB5:AB?>GB>2>3>A>>1I5=8O 85 3449466 8=B5@=5BB5:ABK?>GB>2>3>A>>1I5=8O 44 3449551 8=B5@=5BC 6 3449595 8=B5@?@5B0B>@ 12 3449601 8=B5@?@5B0F88 13 3449613 8=B5@?@5B0F8O 23 3449626 8=B5@?@5B8@>20=0 5 3449649 8=B5@?@5B8@>20==K9 15 3449654 8=B5@?@5B8@>20=> 10 3449669 8=B5@?@5B8@>20BL 49 3449679 8=B5@?@5B8@>20BLAO 220 3449728 8=B5@?@5B8@C5BAO 181 3449948 8=B5@?@5B8@CNBAO 23 3450129 8=B5@D59A 1250 3450152 8=B5@D59Aodata 48 3451402 8=B5@D59A0 503 3451450 8=B5@D59A0< 5 3451953 8=B5@D59A0E 4 3451958 8=B5@D59A5 118 3451962 8=B5@D59A:;85=BA:>3>?@8;>65=8O 9 3452080 8=B5@D59A=K5 17 3452089 8=B5@D59A=K9 32 3452106 8=B5@D59A=KE 22 3452138 8=B5@D59A>2 31 3452160 8=B5@D59A>< 149 3452191 8=B5@D59AC 35 3452340 8=B5@D59AK 39 3452375 8=BD5@D59A0 4 3452414 8=CN 5 3452418 8=D> 29 3452423 8=D>@<0F859 122 3452452 8=D>@<0F88 662 3452574 8=D>@<0F8> 4 3453236 8=D>@<0F8>==0O 831 3453240 8=D>@<0F8>==0O1070 79 3454071 8=D>@<0F8>==0O107070@538AB@8@>20=0 10 3454150 8=D>@<0F8>==0O;8=8O24803@0<<5 5 3454160 8=D>@<0F8>==0O;8=8O4803@0<<K 79 3454165 8=D>@<0F8>==>3> 126 3454244 8=D>@<0F8>==>9 2757 3454370 8=D>@<0F8>==CN 227 3457127 8=D>@<0F8>==K5 35 3457354 8=D>@<0F8>==K58=B5@20;K24803@0<<5 5 3457389 8=D>@<0F8>==K58=B5@20;K4803@0<<K 75 3457394 8=D>@<0F8>==K58=B5@20;K7=0G5=89 48 3457469 8=D>@<0F8>==K58=B5@20;KB>G5: 40 3457517 8=D>@<0F8>==K5;8=8824803@0<<5 5 3457557 8=D>@<0F8>==K5;8=884803@0<<K 75 3457562 8=D>@<0F8>==K5;8=887=0G5=89 36 3457637 8=D>@<0F8>==K5;8=88B>G5: 36 3457673 8=D>@<0F8>==K9 3815 3457709 8=D>@<0F8>==K98=B5@20;24803@0<<5 5 3461524 8=D>@<0F8>==K98=B5@20;4803@0<<K 108 3461529 8=D>@<0F8>==K< 48 3461637 8=D>@<0F8>==K<8 27 3461685 8=D>@<0F8>==KE 287 3461712 8=D>@<0F8>=>9 5 3461999 8=D>@<0F8N 938 3462004 8=D>@<0F8O 114186 3462942 8=D>@<0F8O48A:@5B=>3>?>;O0=0;87040==KE 34 3577128 8=D>@<0F8O4;O?@8;>65=8O 16 3577162 8=D>@<0F8O4;O?@8;>65=8Oxs 829 3577178 8=D>@<0F8O70?>;=5=8O:>?89107K40==KE 6 3578007 8=D>@<0F8O<>4C;O 8 3578013 8=D>@<0F8O<>4C;O:@8?B>3@0D88 54 3578021 8=D>@<0F8O=5?@5@K2=>3>?>;O0=0;87040==KE 49 3578075 8=D>@<0F8O>103@530B0E 46 3578124 8=D>@<0F8O>103@530B5 51 3578170 8=D>@<0F8O>18=B5@=5BA>548=5=88 40 3578221 8=D>@<0F8O>18A?>;L7>20=88107K40==KE:>?88 20 3578261 8=D>@<0F8O>1>H81:5 211 3578281 8=D>@<0F8O>2K?>;=5=88 9 3578492 8=D>@<0F8O>70?8A825@A888AB>@8840==KE 79 3578501 8=D>@<0F8O>70?8A825@A89 60 3578580 8=D>@<0F8O>:;NG5 12 3578640 8=D>@<0F8O>:>?88107K40==KE 64 3578652 8=D>@<0F8O>?@>1;5<0E>B?@02:84>AB02;O5<KEC254><;5=89 11 3578716 8=D>@<0F8O>?@>1;5<5>B?@02:84>AB02;O5<>3>C254><;5=8O 36 3578727 8=D>@<0F8O>?@>1;5<5?@8<5=5=8O@0AH8@5=8O:>=D83C@0F88 32 3578763 8=D>@<0F8O>@0AH8@5=8OE:>=D83C@0F88 6 3578795 8=D>@<0F8O>A5B52><040?B5@5 36 3578801 8=D>@<0F8O?@8;>65=8O 9 3578837 8=D>@<0F8O?@>20945@035>?>78F8>=8@>20=8O 76 3578846 8=D>@<0F8O?@>3@0<<K?@>A<>B@0 19 3578922 8=D>@<0F8O@0AH8D@>2:8 12 3578941 8=D>@<0F8OE@0=8;8I042>8G=KE40==KE 44 3578953 8=D>@<0F8OM:@0=0:;85=B0 39 3578997 8=D>@<8@>20=85 19 3579036 8=D>@<8@>20=8O 19 3579055 8=D>@<8@>20BL 53 3579074 8=D>@<8@C5B 53 3579127 8=K5 5 3579180 8=K< 44 3579185 8=KE 19 3579229 8>@40=8O 12 3579248 8?>;L7>20BL 4 3579260 8@0: 12 3579264 8@0= 12 3579276 8@;0=48O 16 3579288 8@;0=4A:89 14 3579304 8A840 18 3579318 8A:065=85 4 3579336 8A:065=89 4 3579340 8A:065=L5 4 3579344 8A:0BL 86 3579348 8A:0BL2?5@54 18 3579434 8A:0BL2?>4:0B0;>30E 26 3579452 8A:0BL?>AB@>:0< 12 3579478 8A:0BLAO 83 3579490 8A:;NG05<K5 4 3579573 8A:;NG05<K9 10 3579577 8A:;NG05<KE 6 3579587 8A:;NG05B 8 3579593 8A:;NG05BAO 8 3579601 8A:;NG0BL 300 3579609 8A:;NG0BLAO 28 3579909 8A:;NG0NBAO 20 3579937 8A:;NG0NI53> 40 3579957 8A:;NG0NI89 103 3579997 8A:;NG0NI89:0=>=8G5A:89xml 9 3580100 8A:;NG0NI89:0=>=8G5A:89xmlA:><<5=B0@8O<8 9 3580109 8A:;NG0NI8E 7 3580118 8A:;NG0O 226 3580125 8A:;NG0OA2>9AB20 8 3580351 8A:;NG5=85 5273 3580359 8A:;NG5=852K720==>5872AB@>5==>3>O7K:0 18 3585632 8A:;NG5=85< 322 3585650 8A:;NG5=88 9 3585972 8A:;NG5=89 569 3585981 8A:;NG5=8N 28 3586550 8A:;NG5=8O 619 3586578 8A:;NG5=8O3@C???>4AB0=>2:8 16 3587197 8A:;NG5=8O3@C???>4AB0=>2:8xs 20 3587213 8A:;NG5=8OE 5 3587233 8A:;NG5==K5?>;CG0B5;8 5 3587238 8A:;NG5==K9 53 3587243 8A:;NG5=K 53 3587296 8A:;NG5=L5 569 3587349 8A:;NG82 135 3587918 8A:;NG8B5;L=0O 151 3588053 8A:;NG8B5;L=> 19 3588204 8A:;NG8B5;L=>3> 4 3588223 8A:;NG8B5;L=>5 5 3588227 8A:;NG8B5;L=>9 24 3588232 8A:;NG8B5;L=CN 39 3588256 8A:;NG8B5;L=K9 259 3588295 8A:;NG8B5;L=KE 13 3588554 8A:;NG8BL 208 3588567 8A:;NG8BL40==K5 42 3588775 8A:;NG8BL8704<8=8AB@0B>@>201>=5=B0 10 3588817 8A:;NG8BL<5B040==K5 19 3588827 8A:;NG8BL>1J5:BK 46 3588846 8A:;NG8BL@5:2878BK 9 3588892 8A:><0O 84 3588901 8A:><>3> 175 3588985 8A:><>5 400 3589160 8A:><>57=0G5=85 6 3589560 8A:><>9 49 3589566 8A:><><C 33 3589615 8A:><CN 60 3589648 8A:><K5 19 3589708 8A:><K9 837 3589727 8A:><K9:>4 3 3590564 8A:><K< 6 3590567 8A:><KE 13 3590573 8A;0=48O 12 3590586 8A;0=4A:89 14 3590598 8A?0=8O 20 3590612 8A?0=A:89 56 3590632 8A?;L7>20=> 24 3590688 8A?>;=0NI55 4 3590712 8A?>;=5=0 4 3590716 8A?>;=5=85 1307 3590720 8A?>;=5=88 34 3592027 8A?>;=5=8O 1180 3592061 8A?>;=5==K9 4 3593241 8A?>;=8B5;59 4 3593245 8A?>;=8B5;L 48 3593249 8A?>;=8B5;N 14 3593297 8A?>;=8B5;O 14 3593311 8A?>;=O5<0O 6 3593325 8A?>;=O5<>3> 26 3593331 8A?>;=O5<>< 10 3593357 8A?>;=O5<CN 7 3593367 8A?>;=O5<K5 24 3593374 8A?>;=O5<K9 125 3593398 8A?>;=O5<KE 40 3593523 8A?>;=O5B 10 3593563 8A?>;=O5BAO 37 3593573 8A?>;=OBL 39 3593610 8A?>;=OBLAO 89 3593649 8A?>;=ONBAO 3 3593738 8A?>;=ONI5<C 3 3593741 8A?>;=ONI85AO 5 3593744 8A?>;=ONI89 3 3593749 8A?>;=ONI89AO 5 3593752 8A?>;L7>202H89AO 13 3593757 8A?>;L7>202HCNAO 5 3593770 8A?>;L7>20;0AL 5 3593775 8A?>;L7>20;8 5 3593780 8A?>;L7>20;8AL 25 3593785 8A?>;L7>20;> 12 3593810 8A?>;L7>20;AO 10 3593822 8A?>;L7>20= 551 3593832 8A?>;L7>20=0 342 3594383 8A?>;L7>20=85 119993 3594725 8A?>;L7>20=85byteordermark 30 3714718 8A?>;L7>20=8503@530B0@538AB@0=0:>?;5=8O 19 3714748 8A?>;L7>20=850B@81CB0 9 3714767 8A?>;L7>20=850B@81CB0xs 871 3714776 8A?>;L7>20=850B@81CB>2 31 3715647 8A?>;L7>20=850CB5=B8D8:0F888=B5@=5B?>GBK?>B>:5=C 74 3715678 8A?>;L7>20=85107K?;0=0284>2@0AG5B0 35 3715752 8A?>;L7>20=851KAB@>3>2K1>@0 67 3715787 8A?>;L7>20=8528B>30E 9 3715854 8A?>;L7>20=852K2>40 84 3715863 8A?>;L7>20=852K@02=820=8O 4 3715947 8A?>;L7>20=852KG8A;8B5;L=KE@5AC@A>2 17 3715951 8A?>;L7>20=853@C??8M;5<5=B>2 258 3715968 8A?>;L7>20=8540==KE35>?>78F8>=8@>20=8O2:;NG5=> 10 3716226 8A?>;L7>20=854;O3@C??8M;5<5=B>2 45 3716236 8A?>;L7>20=854>?>;=8B5;L=KE8=45:A>2 6 3716281 8A?>;L7>20=854>ABC?=> 21 3716287 8A?>;L7>20=858=B5@0:B82=>3>@568<0 38 3716308 8A?>;L7>20=858=B5@0:B82=>3>@568<0:@8?B>3@0D88 29 3716346 8A?>;L7>20=858AB>@8840==KE 86 3716375 8A?>;L7>20=85:0=0;>20C48>70?8A8 31 3716461 8A?>;L7>20=85:>?89107K40==KE 51 3716492 8A?>;L7>20=85< 517 3716543 8A?>;L7>20=85<5B040==KE 9 3717060 8A?>;L7>20=85<5B040==KE?>;=>B5:AB>2>3>?>8A:0 19 3717069 8A?>;L7>20=85=58725AB=> 9 3717088 8A?>;L7>20=85=5G8A;>2KE7=0G5=89 32 3717097 8A?>;L7>20=85=5G8A;>2KE7=0G5=894803@0<<K 47 3717129 8A?>;L7>20=85>1I53>@5:2878B0 34 3717176 8A?>;L7>20=85?0@0<5B@0:><?>=>2:840==KE 24 3717210 8A?>;L7>20=85?5@8>40459AB28O 9 3717234 8A?>;L7>20=85?>4G8=5=8O 42 3717243 8A?>;L7>20=85?>;59 15 3717285 8A?>;L7>20=85?>;=>B5:AB>2>3>?>8A:0 98 3717300 8A?>;L7>20=85?>;>AK?@>:@CB:8 46 3717398 8A?>;L7>20=85?>;OM;5<5=B0A>AB020:>?88107K40==KE 57 3717444 8A?>;L7>20=85?@>G8E?>;59 22 3717501 8A?>;L7>20=85@01>G5940BK 20 3717523 8A?>;L7>20=85@0745;5=8O40==KE 9 3717543 8A?>;L7>20=85@0745;O5<KE40==KE 424 3717552 8A?>;L7>20=85@0745;O5<KE40==KE>1I53>@5:2878B0 29 3717976 8A?>;L7>20=85@0AH8D@>2:8 18 3718005 8A?>;L7>20=85@0AH8D@>2:8B01;8G=>3>4>:C<5=B0 25 3718023 8A?>;L7>20=85@568<0<5=N 25 3718048 8A?>;L7>20=85@568<0?@>2545=8O 29 3718073 8A?>;L7>20=85@5:2878B0 39 3718102 8A?>;L7>20=85@>C<8=30 24 3718141 8A?>;L7>20=85A>1KB8O 13 3718165 8A?>;L7>20=85A>1KB8O6C@=0;0@538AB@0F88 37 3718178 8A?>;L7>20=85A@570 25 3718215 8A?>;L7>20=85AB@>:=5>3@0=8G5==>94;8=K 22 3718240 8A?>;L7>20=85B01;8G=KEG0AB59 22 3718262 8A?>;L7>20=85B5:AB0 4 3718284 8A?>;L7>20=85B5:CI59AB@>:8 71 3718288 8A?>;L7>20=85B5:CI59AB@>:8B01;8FK 29 3718359 8A?>;L7>20=85CA;>2=>3>>D>@<;5=8O:><?>=>2:840==KE 65 3718388 8A?>;L7>20=85D>@<0B0 4 3718453 8A?>;L7>20=85E@0=5=8O2E@0=8;8I542>8G=KE40==KE 51 3718457 8A?>;L7>20=85E@0=8;8I042>8G=KE40==KE 9 3718508 8A?>;L7>20=85E@0=8;8I7=0G5=8O 22 3718517 8A?>;L7>20=85F25B0B5:AB0 4 3718539 8A?>;L7>20=85F25B0D>=0 4 3718543 8A?>;L7>20=85G8A;>2KE7=0G5=89 4 3718547 8A?>;L7>20=85H8@8=K 12 3718551 8A?>;L7>20=85H8@8=KA60B8OB01;8G=>3>4>:C<5=B0 35 3718563 8A?>;L7>20=85H@8DB0 4 3718598 8A?>;L7>20=88 729 3718602 8A?>;L7>20=89 13 3719331 8A?>;L7>20=8N 57 3719344 8A?>;L7>20=8O 2199 3719401 8A?>;L7>20==>3> 36 3721600 8A?>;L7>20==K5 14 3721636 8A?>;L7>20==K9 1636 3721650 8A?>;L7>20==KE 8 3723286 8A?>;L7>20=> 424 3723294 8A?>;L7>20=K 306 3723718 8A?>;L7>20=L5 13 3724024 8A?>;L7>20B5=8O 5 3724037 8A?>;L7>20BL 5850 3724042 8A?>;L7>20BLbom 13 3729892 8A?>;L7>20BLssl 54 3729905 8A?>;L7>20BLsslimap 9 3729959 8A?>;L7>20BLsslpop3 9 3729968 8A?>;L7>20BLsslsmtp 9 3729977 8A?>;L7>20BLssl?@8>B?@02:5:>40?>4B25@645=8O0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 3729986 8A?>;L7>20BL02B><0B8G5A:8 26 3730022 8A?>;L7>20BL0CB5=B8D8:0F8N>A 74 3730048 8A?>;L7>20BL157@0ABO3820=8O 9 3730122 8A?>;L7>20BL23@C??8@>2:5 11 3730131 8A?>;L7>20BL2703>;>2:5 11 3730142 8A?>;L7>20BL2703>;>2:5>1I53>8B>30 11 3730153 8A?>;L7>20BL2703>;>2:5?>;59 11 3730164 8A?>;L7>20BL2703>;>2:5?>;59@5AC@A>2 11 3730175 8A?>;L7>20BL2703>;>2:5?>;59@5AC@A>2>1I53>8B>30 11 3730186 8A?>;L7>20BL285@0@E8G5A:>93@C??8@>2:5 11 3730197 8A?>;L7>20BL2>1I5<8B>35 11 3730208 8A?>;L7>20BL2>B1>@5 11 3730219 8A?>;L7>20BL2?0@0<5B@0E 11 3730230 8A?>;L7>20BL2A5340 9 3730241 8A?>;L7>20BL2AB@>5==K940B00:A5;5@0B>@ 9 3730250 8A?>;L7>20BL3@C??8@>2:870?@>A05A;82>7<>6=> 10 3730259 8A?>;L7>20BL42>9=K5:02KG:8 19 3730269 8A?>;L7>20BL4;O?>4?8A8 9 3730288 8A?>;L7>20BL4;OH8D@>20=8O 9 3730297 8A?>;L7>20BL4>?>;=8B5;L=> 9 3730306 8A?>;L7>20BL5A;82>7<>6=> 9 3730315 8A?>;L7>20BL6C@=0;K 6 3730324 8A?>;L7>20BL7040==K9A?8A>:?@>25@:8@0A:@KB8O?0@>;O 46 3730330 8A?>;L7>20BL7=0G5=85 9 3730376 8A?>;L7>20BL7=0G5=85A>3@0=8G5=85< 9 3730385 8A?>;L7>20BL83=>@8@C5<K5?@>15;L=K5A8<2>;K 15 3730394 8A?>;L7>20BL878AB>G=8:040==KE 28 3730409 8A?>;L7>20BL:0:>1ICNA5@8N@07<5@0?C7K@L:024803@0<<5 4 3730437 8A?>;L7>20BL:0@BC 27 3730441 8A?>;L7>20BL:;NG 12 3730468 8A?>;L7>20BL:>=B5:AB=>5<5=N 11 3730480 8A?>;L7>20BL<0:5B 4 3730491 8A?>;L7>20BL=0AB@>9:8?@8=B5@0 9 3730495 8A?>;L7>20BL=0AB@>9:8B5:CI53>A50=A0 45 3730504 8A?>;L7>20BL>1KG=K5D>@<K2C?@02;O5<><?@8;>65=88 9 3730549 8A?>;L7>20BL>4=C:><0=4C 9 3730558 8A?>;L7>20BL>A=>2=>5459AB285 20 3730567 8A?>;L7>20BL>A=>2=K5@>;84;O2A5E?>;L7>20B5;59 117 3730587 8A?>;L7>20BL?@58<CI5AB25==>:>?88 13 3730704 8A?>;L7>20BL?@8=5>1E>48<>AB8 13 3730717 8A?>;L7>20BL?@>:A8>A 22 3730730 8A?>;L7>20BL?@><56CB>G=K9A5@28A 11 3730752 8A?>;L7>20BL@568<?@>2545=8O 31 3730763 8A?>;L7>20BL@5:2878BK 22 3730794 8A?>;L7>20BLA5@28A?@>25@:8@0A:@KB8O?0@>;O 45 3730816 8A?>;L7>20BLA5B:C 9 3730861 8A?>;L7>20BLA;54CNICN?@8>H81:5 13 3730870 8A?>;L7>20BLA?8A>: 9 3730883 8A?>;L7>20BLA?@54C?@5645=8O<8 27 3730892 8A?>;L7>20BLAB0=40@B=K5:><0=4K 189 3730919 8A?>;L7>20BLAB0=40@B=K9A?8A>:?@>25@:8@0A:@KB8O?0@>;O 45 3731108 8A?>;L7>20BLAO 11748 3731153 8A?>;L7>20BLB5:AB 13 3742901 8A?>;L7>20BLB5:CICN40BC 9 3742914 8A?>;L7>20BLB>;L:>4>?>;=8B5;L=K53@0<<0B8:8 9 3742923 8A?>;L7>20BLB>;L:>:>?88 17 3742932 8A?>;L7>20BLC?@02;O5<K5D>@<K2>1KG=><?@8;>65=88 9 3742949 8A?>;L7>20BLD>@<0BAM:A?>=5=B>9 5 3742958 8A?>;L7>2?0=8O 10 3742963 8A?>;L7C5<0O 161 3742973 8A?>;L7C5<0O:>?8O107K40==KE 43 3743134 8A?>;L7C5<0O>AL7=0G5=89 9 3743177 8A?>;L7C5<0O>AL7=0G5=8924803@0<<5 10 3743186 8A?>;L7C5<0O>AL7=0G5=894803@0<<K 34 3743196 8A?>;L7C5<0OB01;8F0 27 3743230 8A?>;L7C5<0ODC=:F8>=0;L=>ABL<>18;L=>3>?@8;>65=8O 13 3743257 8A?>;L7C5<>3> 228 3743270 8A?>;L7C5<>5 150 3743498 8A?>;L7C5<>53> 112 3743648 8A?>;L7C5<>57=0G5=85B>G:818@652>94803@0<<K 40 3743760 8A?>;L7C5<>58<OD09;0 80 3743800 8A?>;L7C5<>9 186 3743880 8A?>;L7C5<>< 28 3744066 8A?>;L7C5<CN 213 3744094 8A?>;L7C5<K5 321 3744307 8A?>;L7C5<K5:>?88107K40==KE 66 3744628 8A?>;L7C5<K5?>;O 9 3744694 8A?>;L7C5<K9 1970 3744703 8A?>;L7C5<K9A5@25@ 32 3746673 8A?>;L7C5<K9A5@25@D>@<K 9 3746705 8A?>;L7C5<K9A>AB0240==KE 11 3746714 8A?>;L7C5<K9A>AB028=45:A>2 11 3746725 8A?>;L7C5<K< 50 3746736 8A?>;L7C5<K<8 4 3746786 8A?>;L7C5<KE 276 3746790 8A?>;L7C5B 201 3747066 8A?>;L7C5B5 8 3747267 8A?>;L7C5BA5BL?5@540G840==KE 9 3747275 8A?>;L7C5BA>B>2CNA5BL 9 3747284 8A?>;L7C5BA?CB=8:8 9 3747293 8A?>;L7C5BAO 8891 3747302 8A?>;L7C5BAO2@0A?@545;5==>98=D>@<0F8>==>91075 126 3756193 8A?>;L7C5BAO4@C3>9:>?859 9 3756319 8A?>;L7C5BAO8=D>@<0F8>==>9107>9 9 3756328 8A?>;L7C5BAOMB>9:>?859 9 3756337 8A?>;L7C9B5 4 3756346 8A?>;L7CN 6 3756350 8A?>;L7CNB 23 3756356 8A?>;L7CNBAO 1005 3756379 8A?>;L7CNBAOAB0=40@B=K5=0AB@>9:8 20 3757384 8A?>;L7CNI53> 12 3757404 8A?>;L7CNI59 4 3757416 8A?>;L7CNI85 22 3757420 8A?>;L7CNI89 96 3757442 8A?>;L7CNI89AO 62 3757538 8A?>;L7CNI8< 6 3757600 8A?>;L7CNI8<8 15 3757606 8A?>;L7CNI8E 9 3757621 8A?>;L7CNI8EAO 50 3757630 8A?>;L7CNICN 6 3757680 8A?>;L7CO 213 3757686 8A?@028BL 4 3757899 8A?@02;5=85 108 3757903 8A?@02;5=88 6 3758011 8A?@02;5=89 5 3758017 8A?@02;5=8O 12 3758022 8A?@02;5=8O<8 5 3758034 8A?@02;5==>9 4 3758039 8A?@02;5==K9 4 3758043 8A?@02;5=L5 5 3758047 8AA;54>20=85 4 3758052 8AA;54>20=8O 4 3758056 8AA;54C5<>3> 4 3758060 8AA;54C5<K9 4 3758064 8AB5: 4 3758068 8AB5:;> 6 3758072 8AB5:H89 17 3758078 8AB5:H8< 17 3758095 8AB5G5=85 247 3758112 8AB5G5=88 169 3758359 8AB5G5=8N 9 3758528 8AB5G5=8O 52 3758537 8AB5GL 14 3758589 8AB8=0 13327 3758603 8AB8==K9 5 3771930 8AB8==K< 5 3771935 8AB>@859 26 3771940 8AB>@88 808 3771966 8AB>@89 6 3772774 8AB>@8N 51 3772780 8AB>@8O 957 3772831 8AB>@8O2K1>@0 7 3773788 8AB>@8O2K1>@0?@822>45 215 3773795 8AB>@8O3;>10;L=>3>?>8A:0 5 3774010 8AB>@8O40==KE 220 3774015 8AB>@8O>B1>@>2 12 3774235 8AB>@8O?>8A:0B01;8FK 13 3774247 8AB>@8O@01>BK?>;L7>20B5;59 6 3774260 8AB>@8O@01>BK?>;L7>20B5;O 22 3774266 8AB>@8OA>>1I5=89 12 3774288 8AB>G5=88 5 3774300 8AB>G=8: 3919 3774305 8AB>G=8:0 2714 3778224 8AB>G=8:0< 10 3780938 8AB>G=8:0<8 58 3780948 8AB>G=8:0E 6 3781006 8AB>G=8:2K1>@0 5 3781012 8AB>G=8:40==KE 214 3781017 8AB>G=8:40==KExml 10 3781231 8AB>G=8:40==KE<0:5B0:><?>=>2:840==KE 64 3781241 8AB>G=8:40==KEA2>4=>9B01;8FK:><?>=>2:840==KE 35 3781305 8AB>G=8:40==KEA2O759 37 3781340 8AB>G=8:40==KEAE5<K:><?>=>2:840==KE 72 3781377 8AB>G=8:40==KEC7;>2 25 3781449 8AB>G=8:459AB289 16 3781474 8AB>G=8:4>ABC?=KE=0AB@>5: 48 3781490 8AB>G=8:4>ABC?=KE=0AB@>5::><?>=>2:840==KE 61 3781538 8AB>G=8:5 143 3781599 8AB>G=8:7=0G5=89>A8B>G5: 32 3781742 8AB>G=8:7=0G5=89>A8B>G5:4803@0<<K 47 3781774 8AB>G=8:7=0G5=8O@07<5@0?C7K@L:0 32 3781821 8AB>G=8:7=0G5=8O@07<5@0?C7K@L:04803@0<<K 47 3781853 8AB>G=8:8 71 3781900 8AB>G=8:840==KE 31 3781971 8AB>G=8:840==KE<0:5B0:><?>=>2:840==KE 75 3782002 8AB>G=8:840==KEAE5<K:><?>=>2:840==KE 82 3782077 8AB>G=8:8=D>@<0F88 6 3782159 8AB>G=8:8AE5<K70?@>A0 59 3782165 8AB>G=8::;NG0 5 3782224 8AB>G=8::><0=4?;0=8@>2I8:0 60 3782229 8AB>G=8::><0=4?>;O22>40 19 3782289 8AB>G=8::><0=4?>;O?;0=8@>2I8:0 53 3782308 8AB>G=8::><0=4A8AB5<K2708<>459AB28O 39 3782361 8AB>G=8:>2 206 3782400 8AB>G=8:>< 277 3782606 8AB>G=8:@0AH8@5=89:>=D83C@0F88 26 3782883 8AB>G=8:AE5<K70?@>A0 51 3782909 8AB>G=8:C 97 3782960 8AB>G=8:CG5B=>970?8A8 26 3783057 8ABQ: 4 3783083 8AE>48B 24 3783087 8AE>48BL 67 3783111 8AE>4=0O 376 3783178 8AE>4=0O>1;0ABL 12 3783554 8AE>4=0OAB@>:0 29 3783566 8AE>4=>3> 192 3783595 8AE>4=>5 130 3783787 8AE>4=>58<O 23 3783917 8AE>4=>58<O157@0AH8@5=8O 23 3783940 8AE>4=>5>?8A0=85B8?>2 5 3783963 8AE>4=>5?>;=>58<O 23 3783968 8AE>4=>5@0AH8@5=85 23 3783991 8AE>4=>5A>>1I5=85 9 3784014 8AE>4=>9 173 3784023 8AE>4=>< 29 3784196 8AE>4=CN 14 3784225 8AE>4=K5 149 3784239 8AE>4=K540==K5 189 3784388 8AE>4=K5:>=D83C@0F88 9 3784577 8AE>4=K9 1210 3784586 8AE>4=K9:;NG70?8A8 15 3785796 8AE>4=K9=><5@AB@>:8 9 3785811 8AE>4=K9?>B>: 10 3785820 8AE>4=K9?CBL 23 3785830 8AE>4=K9B5:AB 16 3785853 8AE>4=K9D09; 4 3785869 8AE>4=K< 38 3785873 8AE>4=K<8 5 3785911 8AE>4=KE 103 3785916 8AE>4O 28 3786019 8AE>4OI0O 11 3786047 8AE>4OI53> 8 3786058 8AE>4OI55 10 3786066 8AE>4OI85 5 3786076 8AE>4OI89 44 3786081 8AE>4OI8E 5 3786125 8AE>4OICN 5 3786130 8AG5705B 6 3786135 8AG570BL 16 3786141 8AG570NB 10 3786157 8AG5@?0= 7 3786167 8AG5@?0==K9 7 3786174 8AG5@?K20BL 3 3786181 8AG5@?K20NI59 5 3786184 8AG5@?K20NI89 12 3786189 8AG5@?K20NI8< 4 3786201 8AG8A;5=85 29 3786205 8AG8A;5=8O 29 3786234 8B0;8O 12 3786263 8B0;LO=A:89 20 3786275 8B5@0B>@ 108 3786295 8B5@0B>@0 41 3786403 8B5@0B>@5 4 3786444 8B5@0B>@C7;>2dom 59 3786448 8B5@0F88 18 3786507 8B5@0F89 5 3786525 8B5@0F8O 29 3786530 8B5@0F8OE 4 3786559 8B5@8@C5<>3> 4 3786563 8B5@8@C5<K9 4 3786567 8B>3 1298 3786571 8B>30 74 3787869 8B>30<8 10 3787943 8B>30E 48 3787953 8B>35 10 3788001 8B>38 429 3788011 8B>38<564CAG5B0<8 6 3788440 8B>38?>AG5B0< 6 3788446 8B>38?>AG5B0<AAC1:>=B> 6 3788452 8B>38A=87C 28 3788458 8B>38A?@020 22 3788486 8B>38A@57?5@2KE 6 3788508 8B>38A@57?>A;54=8E 6 3788514 8B>3> 44 3788520 8B>3>2 6 3788564 8B>3>2 630 3788570 8B>3>20O 12 3789200 8B>3>2>3> 4 3789212 8B>3>2>5 27 3789216 8B>3>2>9 4 3789243 8B>3>2CN 5 3789247 8B>3>2K5 19 3789252 8B>3>2K9 188 3789271 8B>3>2K< 7 3789459 8B>3>2KE 119 3789466 8B>3?>3@C??8@>2:5 16 3789585 8B>3?>85@0@E88 16 3789601 8B>3?>@5AC@A0<45B0;L=KE70?8A59 6 3789617 8B>3?>@5AC@A0<703>;>2:03@C??8@>2:8 6 3789623 8B>3?>@5AC@A0<703>;>2:085@0@E8G5A:>93@C??8@>2:8 6 3789629 8B>3?>@5AC@A0<?>420;03@C??8@>2:8 6 3789635 8B>3?>@5AC@A0<?>420;085@0@E8G5A:>93@C??8@>2:8 6 3789641 8B>3C 9 3789647 8E 1567 3789656 8I5B 16 3791223 8I5BAO 50 3791239 8ICBAO 9 3791289 8O 13 3791298 9 42 3791311 95<5= 12 3791353 : 16351 3791365 :0 5 3807716 :02KG5: 9 3807721 :02KG:0 119 3807730 :02KG:0<8 21 3807849 :02KG:0E 44 3807870 :02KG:8 80 3807914 :04@ 52 3807994 :04@0 21 3808046 :04@0<8 8 3808067 :04@8 8 3808075 :04@>2 13 3808083 :04@>2CN 5 3808096 :04@>2K5?@8:07K 5 3808101 :04@>2K9 5 3808106 :04@>< 5 3808111 :04@C 4 3808116 :04@K 20 3808120 :0640O 141 3808140 :064>3> 3258 3808281 :064>5 103 3811539 :064>9 296 3811642 :064>< 594 3811938 :064><C 67 3812532 :064CN 63 3812599 :064CN=545;N 9 3812662 :064K9 4714 3812671 :064K93>4 9 3817385 :064K945=L 9 3817394 :064K9<5AOF 9 3817403 :070EA:89 42 3817412 :070EA:>3> 18 3817454 :070EAB0= 24 3817472 :0: 7446 3817496 :0:0BL 58 3824942 :0:0O 58 3825000 :0:1C;52> 9 3825058 :0:85 171 3825067 :0:8< 204 3825238 :0:8<8 18 3825442 :0:8E 73 3825460 :0:=>;L 13 3825533 :0:>3> 203 3825546 :0:>5 50 3825749 :0:>9 1109 3825799 :0:>< 62 3826908 :0:><C 58 3826970 :0:?@>25@OBL 5 3827028 :0:AAK;:0=0D09; 21 3827033 :0:CN 18 3827054 :0:D09; 52 3827072 :0:G8A;> 9 3827124 :0;5=40@ 471 3827133 :0;5=40@5 100 3827604 :0;5=40@59 46 3827704 :0;5=40@8 31 3827750 :0;5=40@=CN 5 3827781 :0;5=40@=K9 15 3827786 :0;5=40@L 668 3827801 :0;5=40@N 4 3828469 :0;5=40@O 461 3828473 :0;5=40@O< 4 3828934 :0;5=40@O<8 8 3828938 :0;L:C;OB>@ 59 3828946 :0;L:C;OB>@0 10 3829005 :0<5=L 10 3829015 :0<5@0 106 3829025 :0<5@>9 11 3829131 :0<5@C 13 3829142 :0<5@K 72 3829155 :0=040 16 3829227 :0=0; 154 3829243 :0=0;0 82 3829397 :0=0;0< 8 3829479 :0=0;5 4 3829487 :0=0;>2 16 3829491 :0=0;>< 4 3829507 :0=0;A5@28A08=B53@0F88 293 3829511 :0=0;A5@28A08=B53@0F88<5=5465@ 29 3829804 :0=0;C 14 3829833 :0=0;K 15 3829847 :0=4840B 4 3829862 :0=4840B>2 4 3829866 :0=4840BC@0 5 3829870 :0=4840BC@K 5 3829875 :0==040 14 3829880 :0=>=878@>20BL 14 3829894 :0=>=878@>20BL2?>B>: 10 3829908 :0=>=878@>20BL2AB@>:C 10 3829918 :0=>=878@>20BL2D09; 10 3829928 :0=>=8G5A:0O 12 3829938 :0=>=8G5A:0O70?8ALxml 11 3829950 :0=>=8G5A:89 90 3829961 :0=>=8G5A:89dom 20 3830051 :0=>=8G5A:89xml 9 3830071 :0=>=8G5A:89xml1 27 3830080 :0=>=8G5A:89xmlA:><<5=B0@8O<8 9 3830107 :0=>=8G5A:>3> 14 3830116 :0=>=8G5A:>< 32 3830130 :0=>=8G5A:><C 62 3830162 :0=F5;O@A:89 4 3830224 :0=F5;O@A:>9 4 3830228 :0@5B:0 31 3830232 :0@5B:8 31 3830263 :0@8=:0 5 3830294 :0@8=:C 5 3830299 :0@:0A=0O?>25@E=>ABL 13 3830304 :0@B0 82 3830317 :0@B0<0@H@CB0 27 3830399 :0@B5 29 3830426 :0@B8=0 218 3830455 :0@B8=:0 4551 3830673 :0@B8=:01 50 3835224 :0@B8=:02 5 3835274 :0@B8=:0703>;>2:0 34 3835279 :0@B8=:07=0G5=89 9 3835313 :0@B8=:08B5:AB 18 3835322 :0@B8=:0:=>?:82K1>@0 51 3835340 :0@B8=:0<8 16 3835391 :0@B8=:0<=>65AB25==KE7=0G5=89 14 3835407 :0@B8=:0>A=>2=>3>@0745;0 9 3835421 :0@B8=:0?>420;0 20 3835430 :0@B8=:0A25@EC8B5:AB 9 3835450 :0@B8=:0A;5208B5:AB 9 3835459 :0@B8=:0AB@>: 9 3835468 :0@B8=:0D>@<0B8@>20==>3>4>:C<5=B0 106 3835477 :0@B8=:0H0?:8 29 3835583 :0@B8=:5 23 3835612 :0@B8=:8 1448 3835635 :0@B8=:8AB@>: 96 3837083 :0@B8=:>9 20 3837179 :0@B8=:C 375 3837199 :0@B8=>: 273 3837574 :0@B>9 10 3837847 :0@B>B5:0 6 3837857 :0@B>B5:8 6 3837863 :0@B>G:0 10 3837869 :0@B>G:8 6 3837879 :0@BC 10 3837885 :0@BK 44 3837895 :0A0 77 3837939 :0A05BAO 6 3838016 :0A0BLAO 11 3838022 :0A0NBAO 5 3838033 :0A:04=K5 4 3838038 :0A:04=K9 4 3838042 :0AA0 13 3838046 :0AA>2K9G5: 4 3838059 :0B0;0=A:89 14 3838063 :0B0;>3 947 3838077 :0B0;>30 321 3839024 :0B0;>30< 81 3839345 :0B0;>30<8 4 3839426 :0B0;>30E 12 3839430 :0B0;>3181;8>B5:8<>18;L=>3>CAB@>9AB20 21 3839442 :0B0;>3181;8>B5:8<>18;L=>3>CAB@>9AB200A8=E 16 3839463 :0B0;>32@5<5==KED09;>2 34 3839479 :0B0;>32@5<5==KED09;>20A8=E 16 3839513 :0B0;>340==KE?>;L7>20B5;O 5 3839529 :0B0;>340==KEA5@28A0 11 3839534 :0B0;>340==KEA5@28A04;O?5@5=>A0 35 3839545 :0B0;>34>:C<5=B>2 22 3839580 :0B0;>34>:C<5=B>20A8=E 22 3839602 :0B0;>35 77 3839624 :0B0;>38 39 3839701 :0B0;>3<>45;59@0A?>7=020=8O@5G8 11 3839740 :0B0;>3=048A:5 5 3839751 :0B0;>3>2 153 3839756 :0B0;>3>< 4 3839909 :0B0;>3?@>3@0<<K 24 3839913 :0B0;>3C 130 3839937 :0B0@ 12 3840067 :0B53>@859 6 3840079 :0B53>@88 151 3840085 :0B53>@89 9 3840236 :0B53>@8N 36 3840245 :0B53>@8O 241 3840281 :0B53>@8O3@C??K:><0=4 29 3840522 :0B53>@8O8A?>;L7>20=8O0B@81CB0xs 25 3840551 :0B53>@8O< 4 3840576 :0B53>@8O>3@0=8G5=8O845=B8G=>AB8xs 25 3840580 :0B53>@8O>3@0=8G5=8O?@>AB@0=AB28<5= 15 3840605 :0B53>@8O>3@0=8G5=8O?@>AB@0=AB28<5=xs 25 3840620 :0B53>@8O>H81:8 176 3840645 :0B53>@8O>H81:84;O?>;L7>20B5;O 10 3840821 :0B53>@8OA>45@68<>3> 5 3840831 :0B53>@8OA>45@68<>3>html 88 3840836 :0D5;L 14 3840924 :0G0AB25 5 3840938 :0G5AB20 36 3840943 :0G5AB25 5933 3840979 :0G5AB2> 6041 3846912 :0G5AB2>15;>3> 9 3852953 :0G5AB2>2845>70?8A8 24 3852962 :0G5AB2>3@0=8FK 9 3852986 :1 24 3852995 :109B 10 3853019 :204@0B 59 3853029 :204@0B0 23 3853088 :204@0B=0O 4 3853111 :204@0B=89 5 3853115 :204@0B=>3> 5 3853120 :204@0B=>9 40 3853125 :204@0B=K5 22 3853165 :204@0B=K9 88 3853187 :204@0B=KE 7 3853275 :204@0BK 5 3853282 :20;8D8:0B>@ 77 3853287 :20;8D8:0B>@>2 30 3853364 :20;8D8:0B>@K 40 3853394 :20;8D8:0B>@K40BK 74 3853434 :20;8D8:0B>@K42>8G=KE40==KE 49 3853508 :20;8D8:0B>@KAB@>:8 89 3853557 :20;8D8:0B>@KG8A;0 97 3853646 :20;8D8:0F88 12 3853743 :20;8D8:0F8O 12 3853755 :20;8D8F8@>20==0O 10 3853767 :20;8D8F8@>20==0OD>@<00B@81CB0 9 3853777 :20;8D8F8@>20==0OD>@<0M;5<5=B0 9 3853786 :20;8D8F8@>20==>3> 7 3853795 :20;8D8F8@>20==>5 51 3853802 :20;8D8F8@>20==>58<O 28 3853853 :20;8D8F8@>20==K9 80 3853881 :20;8D8F8@>20=K 5 3853961 :20;8D8F8@>20BL 12 3853966 :20;8D8F8@C5<>5 8 3853978 :20;8D8F8@C5<K9 8 3853986 :20@B0; 411 3853994 :20@B0;0 148 3854405 :20@B0;0< 35 3854553 :20@B0;5 4 3854588 :20@B0;>< 4 3854592 :20@B0;>B=0G0;0?5@8>40 9 3854596 :20@B0;>B=0G0;0?5@8>40445 9 3854605 :20@B0;A=0G0;03>40 9 3854614 :20@B0;L=>9 4 3854623 :20@B0;L=K9 4 3854627 :20@B8@0 10 3854631 :28B0=F88 64 3854641 :28B0=F89 25 3854705 :28B0=F8N 12 3854730 :28B0=F8O 108 3854742 :28B0=F8O2AB@>5==>9?>:C?:8 46 3854850 :2AB@ 6 3854896 :2G8A;0 6 3854902 :4 14 3854908 :5=8O 14 3854922 :5H0 5 3854936 :5H59 5 3854941 :5H8@C5BAO 105 3854946 :8;>109B 20 3855051 :8;>109B0E 20 3855071 :8;>18B 4 3855091 :8;>18B0E 4 3855095 :8;>3@0<< 9 3855099 :8;>3@0<<0 6 3855108 :8=>20@L 12 3855114 :8>A: 27 3855126 :8>A:0 4 3855153 :8?@ 12 3855157 :8@3878O 12 3855169 :8@387A:89 14 3855181 :8@8;;8F0 36 3855195 :8@8;;8FK 6 3855231 :8@?8G=K9 12 3855237 :8B 8 3855249 :8B09 30 3855257 :8B09A:89 54 3855287 :8B09A:>3> 14 3855341 :;0280BC@0 136 3855355 :;0280BC@5 9 3855491 :;0280BC@K 111 3855500 :;028H 581 3855611 :;028H0 581 3856192 :;028H04>ABC?0 27 3856773 :;028H0<8 6 3856800 :;028H5 11 3856806 :;028H59 30 3856817 :;028H8 253 3856847 :;028HC 39 3857100 :;0AA 282 3857139 :;0AA0 140 3857421 :;0AA8: 10 3857561 :;0AA8:0 10 3857571 :;0AA8:02 10 3857581 :;0AA8:03 10 3857591 :;0AA8D8:0F88 23 3857601 :;0AA8D8:0F8O 27 3857624 :;0AA8D8:0F8O>1J5:B00=0;87040==KE 29 3857651 :;0AA8G5A:89 19 3857680 :;0AA8G5A:8E 4 3857699 :;0AA8G5A:>9 6 3857703 :;0AA8G5A:CN 6 3857709 :;0AA>2 56 3857715 :;0AAK 14 3857771 :;0AB5@ 1828 3857785 :;0AB5@0 1113 3859613 :;0AB5@0<8 15 3860726 :;0AB5@0=0;87040==KE 28 3860741 :;0AB5@0E 5 3860769 :;0AB5@5 163 3860774 :;0AB5@870F88 20 3860937 :;0AB5@870F8N 4 3860957 :;0AB5@870F8O 25 3860961 :;0AB5@=>3> 19 3860986 :;0AB5@=K9 32 3861005 :;0AB5@>2 80 3861037 :;0AB5@>< 54 3861117 :;0AB5@C 14 3861171 :;0AB5@K 25 3861185 :;85=B 118293 3861210 :;85=B0 774 3979503 :;85=B0< 10 3980277 :;85=B0<8 37 3980287 :;85=B0E 125 3980324 :;85=B5 8189 3980449 :;85=B>1KG=>5?@8;>65=85 9 3988638 :;85=B>2 163 3988647 :;85=B>< 106 3988810 :;85=BA8A?>;L7>20=85<02B>=><=>3>A5@25@0 10 3988916 :;85=BA8AB5<K0=0;8B8:8 6 3988926 :;85=BA:0O 38 3988932 :;85=BA:85 14 3988970 :;85=BA:89 3081 3988984 :;85=BA:8< 54 3992065 :;85=BA:8<8 19 3992119 :;85=BA:8E 72 3992138 :;85=BA:>3> 2718 3992210 :;85=BA:>5 87 3994928 :;85=BA:>5?@8;>65=85 81 3995015 :;85=BA:>9 46 3995096 :;85=BA:>< 55 3995142 :;85=BA:><C 10 3995197 :;85=BA:CN 11 3995207 :;85=BC 8 3995218 :;85=BC?@02;O5<>5?@8;>65=85 9 3995226 :;85=BK 37 3995235 :;8: 15 3995272 :;8:0 5 3995287 :;8:5 5 3995292 :;8:>< 10 3995297 :;>=8@>20=85 264 3995307 :;>=8@>20=8O 160 3995571 :;>=8@>20BL 328 3995731 :;>=8@>20BL:><?>=5=BC 384 3996059 :;>=8@>20BLAO 160 3996443 :;>=8@>20BLC75; 422 3996603 :;>=8@C5B 328 3997025 :;>=8@CNBAO 160 3997353 :;NG 4805 3997513 :;NGxbase 15 4002318 :;NG0 869 4002333 :;NG0< 44 4003202 :;NG0<8 50 4003246 :;NG20@80=B0 18 4003296 :;NG40==KE 19 4003314 :;NG5 23 4003333 :;NG520O 4 4003356 :;NG52>3> 121 4003360 :;NG52>5 212 4003481 :;NG52>9 811 4003693 :;NG52><C 93 4004504 :;NG52K5 41 4004597 :;NG52K5?>;O 9 4004638 :;NG52K< 82 4004647 :;NG52K<8 48 4004729 :;NG52KE 219 4004777 :;NG59 376 4004996 :;NG5< 113 4005372 :;NG70?8A8 31 4005485 :;NG8 250 4005516 :;NG82B01;8F540==KE 9 4005766 :;NG87=0G5=85 86 4005775 :;NG8A>?>AB02;5=8O?>;L7>20B5;O 57 4005861 :;NG:0;5=40@O 5 4005918 :;NG:>=B0:B0 6 4005923 :;NG=07=0G5=8O8A?>;L7>20=8O 44 4005929 :;NG=0AB@>5: 116 4005973 :;NG=0AB@>9:8 6 4006089 :;NG>1J5:B0 167 4006095 :;NG>< 710 4006262 :;NG?0@0<5B@>2?5G0B8 22 4006972 :;NG?>;L7>20B5;LA:8E=0AB@>5: 27 4006994 :;NG?>C<>;G0=8N 10 4007021 :;NG?@8;>65=8O 7 4007031 :;NG?@>25@:8 5 4007038 :;NGA>?>AB02;5=8O 22 4007043 :;NGA>?>AB02;5=8O?>;L7>20B5;O 11 4007065 :;NGA>E@0=5=8O?>;>65=8O>:=0 53 4007076 :;NGA>E@0=5=8OF25B>2 35 4007129 :;NGAB@>:8 13 4007164 :;NGAB@>:848=0<8G5A:>3>A?8A:0 36 4007177 :;NGB5:CI53>20@80=B0 21 4007213 :;NGB5:CI8E=0AB@>5: 22 4007234 :;NGB5:CI8E=0AB@>5:40==KE 9 4007256 :;NGB5:CI8E?>;L7>20B5;LA:8E=0AB@>5: 39 4007265 :;NGB@51>20=8O=07=0G5=8O 9 4007304 :;NGC 602 4007313 :;NGC=8:0;L=>AB8 634 4007915 :=830 9 4008549 :=830?@>406 6 4008558 :=835 5 4008564 :=838 4 4008569 :=>?:0 2376 4008573 :=>?:01 26 4010949 :=>?:02 10 4010975 :=>?:02K1>@0 37 4010985 :=>?:02K?040NI53>A?8A:0 9 4011022 :=>?:0459AB28O 5 4011031 :=>?:070:070BL 8 4011036 :=>?:0:><0=4=>9?0=5;8 186 4011044 :=>?:0<8 25 4011230 :=>?:0=060B85 6 4011255 :=>?:0>B:@KB8O 35 4011261 :=>?:0>G8AB:8 31 4011296 :=>?:0?0=5;8:=>?>:A>>1I5=8OA8AB5<K2708<>459AB28O 110 4011327 :=>?:0?>4A25G5==0O 11 4011437 :=>?:0?>C<>;G0=8N 68 4011448 :=>?:0@53C;8@>20=8O 31 4011516 :=>?:0A>740=8O 21 4011547 :=>?:0A?8A:02K1>@0 20 4011568 :=>?:0AD>@<8@>20BL 7 4011588 :=>?:0B09<0CB0 21 4011595 :=>?:0C@>2=8 6 4011616 :=>?:0D>@<K 294 4011622 :=>?:0E 10 4011916 :=>?:5 184 4011926 :=>?:8 1240 4012110 :=>?:8:><0=4=>9?0=5;8 102 4013350 :=>?:>9 150 4013452 :=>?:C 288 4013602 :=>?>: 445 4013890 :> 77 4014335 :>21>9:0 58 4014412 :>340 1448 4014470 :>3> 9 4015918 :>4 2167 4015927 :>40 2101 4018094 :>40:B820F88 14 4020195 :>40<8 12 4020209 :>42>72@0B0 17 4020221 :>42>72@0B0480;>30 104 4020238 :>44>?>;=5=8O 7 4020342 :>44>?>;=5=8O8<5=8?>;L7>20B5;O 42 4020349 :>44>ABC?0 10 4020391 :>45 58 4020401 :>470:@KB8O 9 4020459 :>48@>20=85 89 4020468 :>48@>20=85< 10 4020557 :>48@>20=88 16 4020567 :>48@>20=8O 63 4020583 :>48@>20==K9 13 4020646 :>48@>20=K 13 4020659 :>48@>20BL 45 4020672 :>48@>20BLAB@>:C 26 4020717 :>48@>20BLAO 43 4020743 :>48@>2:0 1030 4020786 :>48@>2:0url 25 4021816 :>48@>2:0xbase 19 4021841 :>48@>2:0xml 45 4021860 :>48@>2:08<5=D09;>2 11 4021905 :>48@>2:08<5=D09;>22zipD09;5 29 4021916 :>48@>2:08<5=D09;>22D09;50@E820 43 4021945 :>48@>2:08AB>G=8:0 54 4021988 :>48@>2:0>A4>?>;=8B5;L=>utf8 19 4022042 :>48@>2:0AB@>:8 12 4022061 :>48@>2:0B5:AB0 443 4022073 :>48@>2:0E 24 4022516 :>48@>2:5 134 4022540 :>48@>2:8 388 4022674 :>48@>2:>9 20 4023062 :>48@>2:C 153 4023082 :>48@>2>: 316 4023235 :>48@C5< 12 4023551 :>48@C5<0O 5 4023563 :>48@C5<K9 17 4023568 :>48@C5B 5 4023585 :>48@C5BAO 24 4023590 :>48@CNBAO 25 4023614 :>4;>:0;870F88 60 4023639 :>4;>:0;870F888=D>@<0F8>==>9107K 11 4023699 :>4>2 148 4023710 :>4>2CN 32 4023858 :>4>2K9 32 4023890 :>4>< 51 4023922 :>4>B?@028B5;O 23 4023973 :>4>H81:8 21 4023996 :>4?5@2>3>A8<2>;0D0<8;88 5 4024017 :>4?>;CG0B5;O 20 4024022 :>4@07@5H5=8O 45 4024042 :>4@07@5H5=8O=0G0;0A50=A>2 52 4024087 :>4@538>=0 5 4024139 :>4@57C;LB0B0 9 4024144 :>4@>48B5;O 5 4024153 :>4A8<2>;0 18 4024158 :>4A>AB>O=8O 35 4024176 :>4B>20@0 10 4024211 :>4C 91 4024221 :>4K 169 4024312 :>4K4>?>;=5=8O8<5=8?>;L7>20B5;O 45 4024481 :>4K87<5@5=8903@530B>2@538AB@>2=0:>?;5=8O 6 4024526 :>4O7K:0 166 4024532 :>4O7K:08=B5@D59A0 9 4024698 :>4O7K:0<0:5B0 32 4024707 :>60=> 5 4024739 :>60=>:>@8G=52K9 11 4024744 :>: 20 4024755 :>:0 20 4024775 :>; 41 4024795 :>;5A0 5 4024836 :>;5A> 5 4024841 :>;8G 6 4024846 :>;8G5AB20 395 4024852 :>;8G5AB25 43 4025247 :>;8G5AB25==>3> 6 4025290 :>;8G5AB25==>5 28 4025296 :>;8G5AB25==K9 31 4025324 :>;8G5AB25==KE 11 4025355 :>;8G5AB2> 6549 4025366 :>;8G5AB2>1 8 4031915 :>;8G5AB2>0:B82=KEA50=A>2 22 4031923 :>;8G5AB2>0B@81CB>2 45 4031945 :>;8G5AB2>25@E=8EC@>2=593>@87>=B0;L=>9H:0;K 9 4031990 :>;8G5AB2>2K7>2>2 22 4031999 :>;8G5AB2>2K7>2>22A53> 11 4032021 :>;8G5AB2>2K7>2>2705<8= 11 4032032 :>;8G5AB2>454C?;8F8@>20==KEM;5<5=B>2 9 4032043 :>;8G5AB2>4B 7 4032052 :>;8G5AB2>7040=89 5 4032059 :>;8G5AB2>7040=89>1=>2;5=8O 10 4032064 :>;8G5AB2>7040=89?5@5AG5B08B>3>2 42 4032074 :>;8G5AB2>70?8A59 94 4032116 :>;8G5AB2>7=0G5=89 19 4032210 :>;8G5AB2>7=0G5=893>@87>=B0;L=>9H:0;K 11 4032229 :>;8G5AB2>7=0G5=89?>A;587<5=5=8O 36 4032240 :>;8G5AB2>87<5=5==KEAB@>: 5 4032276 :>;8G5AB2>87<5@5=89 5 4032281 :>;8G5AB2>8=45:A>2 4 4032286 :>;8G5AB2>8=D>@<0F8>==KE107=0?@>F5AA 11 4032290 :>;8G5AB2>8B5@0F89 17 4032301 :>;8G5AB2>:04@>2 10 4032318 :>;8G5AB2>:;0AA>2 9 4032328 :>;8G5AB2>:;0AB5@>2 4 4032337 :>;8G5AB2>:>;>=>: 40 4032341 :>;8G5AB2>:>=5G=K9>AB0B>: 9 4032381 :>;8G5AB2>:B 7 4032390 :>;8G5AB2>;8ABL52 9 4032397 :>;8G5AB2>< 68 4032406 :>;8G5AB2><830=89 5 4032474 :>;8G5AB2>>1>@>B 5 4032479 :>;8G5AB2>>1J5:B>2 45 4032484 :>;8G5AB2>>AB0B>: 7 4032529 :>;8G5AB2>>B:@KBKEC@>2=59 20 4032536 :>;8G5AB2>?>2B>@>2 9 4032556 :>;8G5AB2>?>2B>@>2?@8020@89=><7025@H5=88 18 4032565 :>;8G5AB2>?>:C?>: 7 4032583 :>;8G5AB2>?>;CG05<KE70?8A59 9 4032590 :>;8G5AB2>?>A;54>20B5;L=>AB59 9 4032599 :>;8G5AB2>?@8E>4 3 4032608 :>;8G5AB2>@0AE>4 4 4032611 :>;8G5AB2>A50=A>2 22 4032615 :>;8G5AB2>A5@89 28 4032637 :>;8G5AB2>A;CG052 45 4032665 :>;8G5AB2>A>548=5=89=0?@>F5AA 11 4032710 :>;8G5AB2>AB@0=8F 23 4032721 :>;8G5AB2>AB@>: 23 4032744 :>;8G5AB2>B01;8F4;O=0G0;L=>3>>1=>2;5=8O 9 4032767 :>;8G5AB2>B>G5: 17 4032776 :>;8G5AB2>B@0=70:F894;OB5:CI53>>1=>2;5=8O 9 4032793 :>;8G5AB2>C40;5==KEM;5<5=B>2 9 4032802 :>;8G5AB2>C7;>2 9 4032811 :>;8G5AB2>C=8:0;L=KE 9 4032820 :>;8G5AB2>C@>2=59 40 4032829 :>;8G5AB2>C@>2=593@C??8@>2>::>;>=>: 13 4032869 :>;8G5AB2>C@>2=593@C??8@>2>:AB@>: 20 4032882 :>;8G5AB2>E@0=8<KEM;5<5=B>2 9 4032902 :>;8G5AB2>M:75<?;O@>2 29 4032911 :>;8G5AB2>M;5<5=B>2 41 4032940 :>;8G5AB2>M;5<5=B>21 6 4032981 :>;8G5AB2>M;5<5=B>2H:0;K 9 4032987 :>;8G5AB2C 52 4032996 :>;;5:F859 105 4033048 :>;;5:F88 8780 4033153 :>;;5:F89 54 4041933 :>;;5:F8N 2428 4041987 :>;;5:F8O 11837 4044415 :>;;5:F8O0B@81CB>2dom 102 4056252 :>;;5:F8O0B@81CB>2html 182 4056354 :>;;5:F8O20@80=B>2?>;L7>20B5;LA:>3>?>;O2K1>@:><?>=>2:840==KE 69 4056536 :>;;5:F8O2;>65=89pdf 92 4056605 :>;;5:F8O2;>65=89A8AB5<K2708<>459AB28O 54 4056697 :>;;5:F8O2AB@>5==KEB01;8F 70 4056751 :>;;5:F8O2K1@0==KE?>;59:><?>=>2:840==KE 64 4056821 :>;;5:F8O2K45;5==KE40B 47 4056885 :>;;5:F8O42865=89 47 4056932 :>;;5:F8O459AB289A>>1I5=8OA8AB5<K2708<>459AB28O 54 4056979 :>;;5:F8O459AB289M;5<5=B0?;0=8@>2I8:0 54 4057033 :>;;5:F8O459AB289M;5<5=B0@57C;LB0B03;>10;L=>3>?>8A:0 54 4057087 :>;;5:F8O4>ABC?=KE>1J5:B>2=0AB@>9:8:><?>=>2:840==KE 41 4057141 :>;;5:F8O4>ABC?=KE?0@0<5B@>2:><?>=>2:840==KE 44 4057182 :>;;5:F8O4>ABC?=KE?>;59:><?>=>2:840==KE 45 4057226 :>;;5:F8O70<5I0NI8EM;5<5=B>2?;0=8@>2I8:0 54 4057271 :>;;5:F8O7=0G5=89xdto 23 4057325 :>;;5:F8O7=0G5=89?0@0<5B@>2:><?>=>2:840==KE 145 4057348 :>;;5:F8O7=0G5=89A2>9AB20>1J5:B0<5B040==KE 124 4057493 :>;;5:F8O845=B8D8:0B>@>2?>;L7>20B5;59A8AB5<K2708<>459AB28O 56 4057617 :>;;5:F8O845=B8D8:0B>@>2?@8;>65=89A8AB5<K2708<>459AB28O 44 4057673 :>;;5:F8O87<5@5=89?;0=8@>2I8:0 58 4057717 :>;;5:F8O8<5=>20==KE:><?>=5=Bxs 53 4057775 :>;;5:F8O8=45:A>2xbase 54 4057828 :>;;5:F8O8=B5@20;>2D>=0?;0=8@>2I8:0 54 4057882 :>;;5:F8O8=D>@<0F88>70?8A825@A888AB>@8840==KE 70 4057936 :>;;5:F8O:>;>=>:45@5207=0G5=89 82 4058006 :>;;5:F8O:>;>=>:@57C;LB0B070?@>A0 34 4058088 :>;;5:F8O:>;>=>:B01;8FK7=0G5=89 82 4058122 :>;;5:F8O< 6 4058204 :>;;5:F8O<5B>:8=B5@20;0D>=0?;0=8@>2I8:0 54 4058210 :>;;5:F8O<8 3 4058264 :>;;5:F8O=>B0F89dom 41 4058267 :>;;5:F8O>1;0AB59B01;8G=>3>4>:C<5=B0 41 4058308 :>;;5:F8O>1J5:B>2<5B040==KE 696 4058349 :>;;5:F8O>D>@<;5=8940B 28 4059045 :>;;5:F8O>D>@<;O5<KE?>;59:><?>=>2:840==KE 80 4059073 :>;;5:F8O?0:5B>2xdto 35 4059153 :>;;5:F8O?>;59xbase 57 4059188 :>;;5:F8O?>;593@C??8@>2:8:><?>=>2:840==KE 59 4059245 :>;;5:F8O?>;59A2>4=>94803@0<<K 86 4059304 :>;;5:F8O?>;59A2>4=>9B01;8FK 107 4059390 :>;;5:F8O?>;L7>20B5;LA:8E?>;59:><?>=>2:840==KE 59 4059497 :>;;5:F8O@8AC=:>2B01;8G=>3>4>:C<5=B0 68 4059556 :>;;5:F8OA2>9AB2xdto 27 4059624 :>;;5:F8OAB@0=8Fpdf 24 4059651 :>;;5:F8OAB@>:45@5207=0G5=89 121 4059675 :>;;5:F8OACI=>AB59dom 41 4059796 :>;;5:F8OB5:CI8E?5@8>4>2>B>1@065=8O?;0=8@>2I8:0 54 4059837 :>;;5:F8OB8?>27=0G5=89xdto 23 4059891 :>;;5:F8OD0A5B>2xdto 41 4059914 :>;;5:F8OE 5 4059955 :>;;5:F8OM;5<5=B>2html 60 4059960 :>;;5:F8OM;5<5=B>287<5@5=8O?;0=8@>2I8:0 58 4060020 :>;;5:F8OM;5<5=B>2>B1>@0:><?>=>2:840==KE 64 4060078 :>;;5:F8OM;5<5=B>2?;0=8@>2I8:0 59 4060142 :>;;5:F8OM;5<5=B>2?>;L7>20B5;LA:8E=0AB@>5::><?>=>2:840==KE 65 4060201 :>;;5:F8OM;5<5=B>2?>@O4:0:><?>=>2:840==KE 59 4060266 :>;;5:F8OM;5<5=B>2AB@C:BC@K4803@0<<K:><?>=>2:840==KE 162 4060325 :>;;5:F8OM;5<5=B>2AB@C:BC@K=0AB@>5::><?>=>2:840==KE 93 4060487 :>;;5:F8OM;5<5=B>2AB@C:BC@KB01;8FK:><?>=>2:840==KE 167 4060580 :>;;5:F8OM;5<5=B>2C?@02;5=8O8=B5@D59A0<8 62 4060747 :>;;5:F8OM;5<5=B>2CA;>2=>3>>D>@<;5=8O:><?>=>2:840==KE 69 4060809 :>;;5:F8OM;5<5=B>2D>@<0B8@>20==>3>4>:C<5=B0 58 4060878 :>;;5F8O 4 4060936 :>;>=:0 5173 4060940 :>;>=:01 123 4066113 :>;>=:02 117 4066236 :>;>=:0n 14 4066353 :>;>=:00=0;87040==KE 57 4066367 :>;>=:028442865=8O 11 4066424 :>;>=:02;>65==0OB01;8F0AE5<K70?@>A0 44 4066435 :>;>=:02;>65==>9B01;8FK 6 4066479 :>;>=:02@5<5==>9B01;8FK70?@>A0 27 4066485 :>;>=:040==KE4803@0<<K30=B0 56 4066512 :>;>=:045@5207=0G5=89 90 4066568 :>;>=:08;82K@065=85 25 4066658 :>;>=:08AB>G=8:040==KE 33 4066683 :>;>=:0:>MDD8F85=B>22A2O7OE 21 4066716 :>;>=:0:>MDD8F85=B>22C7;0E 13 4066737 :>;>=:0< 110 4066750 :>;>=:0<8 179 4066860 :>;>=:0<>45;8?@>3=>70 77 4067039 :>;>=:0>?8A0=8O8AB>G=8:040==KE 68 4067116 :>;>=:0?5@5<5==K52A2O7OE 25 4067184 :>;>=:0@57C;LB0B070?@>A0 35 4067209 :>;>=:0@57C;LB0B0<>45;8?@>3=>70 47 4067244 :>;>=:0A?8A:0 43 4067291 :>;>=:0AE5<K70?@>A0 81 4067334 :>;>=:0B01;8FK7=0G5=89 85 4067415 :>;>=:0B01;8G=>3>?>;O 496 4067500 :>;>=:0C@02=5=8O2A2O7OE 25 4067996 :>;>=:0C@02=5=8O2C7;0E 17 4068021 :>;>=:0E 218 4068038 :>;>=:5 672 4068256 :>;>=:8 2894 4068928 :>;>=:80=0;87040==KE 66 4071822 :>;>=:82@5<5==>9B01;8FK70?@>A0 27 4071888 :>;>=:83@C??8@>2>: 36 4071915 :>;>=:840==KE 9 4071951 :>;>=:840==KE4803@0<<K30=B0 59 4071960 :>;>=:8<>45;8?@>3=>70 55 4072019 :>;>=:8>?8A0=8O8AB>G=8:040==KE 43 4072074 :>;>=:8@57C;LB0B0 43 4072117 :>;>=:8@57C;LB0B0<>45;8?@>3=>70 84 4072160 :>;>=:8A>AB020 41 4072244 :>;>=:8A?8A:0 128 4072285 :>;>=:8AC<<8@>20=8O 36 4072413 :>;>=:8AE5<K70?@>A0 53 4072449 :>;>=:8B01;8G=>3>?>;O 72 4072502 :>;>=:>9 100 4072574 :>;>=:C 377 4072674 :>;>=>: 5087 4073051 :>;>=B8BC; 89 4078138 :>;>=B8BC;0 55 4078227 :>;>=B8BC;0< 5 4078282 :>;>=B8BC;5 4 4078287 :>;>=B8BC;>2 12 4078291 :>;>=B8BC;B01;8G=>3>4>:C<5=B0 79 4078303 :>;C<189 12 4078382 :>;C<18O 12 4078394 :>;LF520O 18 4078406 :>;LF520O>1J5<=0O 13 4078424 :>;LF52>9 70 4078437 :><04=>9 4 4078507 :><0=4 491 4078511 :><0=40 2406 4079002 :><0=40:><0=4=>3>8=B5@D59A0 46 4081408 :><0=40< 8 4081454 :><0=40<5=NDC=:F89 12 4081462 :><0=40<8 58 4081474 :><0=40?>C<>;G0=8N 59 4081532 :><0=40A8AB5<K 24 4081591 :><0=40D>@<K 75 4081615 :><0=40E 4 4081690 :><0=45 15 4081694 :><0=48@>2:0 4 4081709 :><0=48@>2:8 4 4081713 :><0=4=0O 79 4081717 :><0=4=0O?0=5;L 211 4081796 :><0=4=0O?0=5;L1 22 4082007 :><0=4=0O?0=5;L2K?>;=8BL 5 4082029 :><0=4=0O?0=5;L:>=AB@C:B>@70?@>A>2 5 4082034 :><0=4=0O?0=5;L>B1>@ 5 4082039 :><0=4=0O?0=5;L@538AB@0 6 4082044 :><0=4=0O?0=5;L@540:B>@0>BG5B0:>=AB@C:B>@>?8A0=8O>BG5B0 5 4082050 :><0=4=0O?0=5;LD>@<K 9 4082055 :><0=4=0O?0=5;LD>@<K206=>5 9 4082064 :><0=4=0O?0=5;LD>@<KA>740BL=0>A=>20=88 9 4082073 :><0=4=89 190 4082082 :><0=4=>3> 185 4082272 :><0=4=>9 772 4082457 :><0=4=>< 16 4083229 :><0=4=><C 5 4083245 :><0=4=CN 71 4083250 :><0=4=K9 1128 4083321 :><0=4=K98=B5@D59A 18 4084449 :><0=4=K98=B5@D59A>A=>2=>3>@0745;0 9 4084467 :><0=4=KE 14 4084476 :><0=4>9 89 4084490 :><0=4C 130 4084579 :><0=4K 1053 4084709 :><0=4KD>@<K 35 4085762 :><109= 42 4085797 :><18=0F859 22 4085839 :><18=0F88 154 4085861 :><18=0F89 47 4086015 :><18=0F8O 212 4086062 :><18=0F8O<8 16 4086274 :><18=8@>20BL 5 4086290 :><18=8@>20BLAO 25 4086295 :><18=8@C5BAO 15 4086320 :><<5=B0@852 46 4086335 :><<5=B0@85< 12 4086381 :><<5=B0@88 208 4086393 :><<5=B0@89 2102 4086601 :><<5=B0@89dom 927 4088703 :><<5=B0@89html 1434 4089630 :><<5=B0@8925@A88 64 4091064 :><<5=B0@8N 7 4091128 :><<5=B0@8O 217 4091135 :><<5=B8@CNI59 4 4091352 :><<5=B8@CNI89 4 4091356 :><<C=8:0F88 6 4091360 :><<C=8:0F8O 6 4091366 :><<CB8@C5<>3> 4 4091372 :><<CB8@C5<K9 13 4091376 :><<CB8@C5<K< 12 4091389 :><=0B 3 4091401 :><=0B0 8 4091404 :><=0BK 4 4091412 :><?o=>2I8: 14 4091416 :><?0:B=> 4 4091430 :><?0:B=>5 14 4091434 :><?0:B=>< 8 4091448 :><?0:B=K9 44 4091456 :><?0=5;L 6 4091500 :><?8;8@C5<>3> 10 4091506 :><?8;8@C5<K9 10 4091516 :><?8;OF88 257 4091526 :><?8;OF8O 259 4091783 :><?;5:B 40 4092042 :><?;5:B0 40 4092082 :><?>=5=B 3261 4092122 :><?>=5=B0 3131 4095383 :><?>=5=B0< 5 4098514 :><?>=5=B0<8 75 4098519 :><?>=5=B5 27 4098594 :><?>=5=B>2 277 4098621 :><?>=5=B>9 8 4098898 :><?>=5=B>< 160 4098906 :><?>=5=BC 203 4099066 :><?>=5=BK 877 4099269 :><?>=5=BKA8;L=>9A2O7=>AB8 9 4100146 :><?>=5=BKA8;L=>9A2O7=>AB8157B@51>20=8OA2O782=CB@8:><?>=5=B 13 4100155 :><?>=5=BKA;01>9A2O7=>AB8 13 4100168 :><?>=>20BLAO 8 4100181 :><?>=>2:0 2197 4100189 :><?>=>2:040==KE 16 4102386 :><?>=>2:5 51 4102402 :><?>=>2:8 2119 4102453 :><?>=>2:C 35 4104572 :><?>=>2I8: 140 4104607 :><?>=>2I8:0 64 4104747 :><?>=>2I8:5 9 4104811 :><?>=>2I8:<0:5B0:><?>=>2:840==KE 46 4104820 :><?>=>2I8:=0AB@>5: 38 4104866 :><?>=>2I8:=0AB@>5::><?>=>2:840==KE 120 4104904 :><?>=>2I8:=0AB@>5:A8AB5<K:><?>=>2:840==KE 5 4105024 :><?>=>2I8:>< 8 4105029 :><?>=>2I8:C 18 4105037 :><?>=C5<K5 5 4105055 :><?>=C5<K9 5 4105060 :><?>=C5BAO 8 4105065 :><?LNB5@ 452 4105073 :><?LNB5@0 339 4105525 :><?LNB5@0E 4 4105864 :><?LNB5@5 71 4105868 :><?LNB5@>2 4 4105939 :><?LNB5@>< 4 4105943 :><?LNB5@C 4 4105947 :><?LNB5@K 5 4105951 :>=25@B 6 4105956 :>=25@B0F88 70 4105962 :>=25@B0F8O 70 4106032 :>=25@B8@>20BL 8 4106102 :>=25@B8@>20BLAO 52 4106110 :>=25@B8@C5<K9 8 4106162 :>=25@B8@C5<K9@0745;8B5;LAB@>: 117 4106170 :>=25@B8@CNBAO 44 4106287 :>=25@BK 6 4106331 :>=3@0=8F0 5 4106337 :>=40B0 19 4106342 :>=5F 2386 4106361 :>=5F20@80=B 23 4108747 :>=5F25@E 18 4108770 :>=5F2AB02:8 14 4108788 :>=5F3>40 18 4108802 :>=5F45:04K 6 4108820 :>=5F4=O 23 4108826 :>=5F5A;8 1577 4108849 :>=5F8=B5@20;0 24 4110426 :>=5F:20@B0;0 18 4110450 :>=5F:>;>=:8 44 4110468 :>=5F:>=5F 9 4110512 :>=5F;52> 18 4110521 :>=5F<0AA820 13 4110539 :>=5F<0AHB01=>3>480?07>=0 9 4110552 :>=5F<5AOF0 34 4110561 :>=5F<8=CBK 18 4110595 :>=5F=0G0;> 9 4110613 :>=5F=545;8 18 4110622 :>=5F>1;0AB8 15 4110640 :>=5F>1;0AB8>B>1@065=8O 13 4110655 :>=5F>1J5:B0 13 4110668 :>=5F?5@8>40 98 4110681 :>=5F?5@8>404>?>;=5=8O 9 4110779 :>=5F?5@8>40>B>1@065=8O 29 4110788 :>=5F?>;=>3>8=B5@20;0 18 4110817 :>=5F?>;C3>48O 6 4110835 :>=5F?>?KB:8 302 4110841 :>=5F?@>F54C@K 509 4111143 :>=5FAB>@>=0 23 4111652 :>=5FAB@0=8FK 11 4111675 :>=5FAB@>:8 44 4111686 :>=5FACI=>AB8 21 4111730 :>=5FC40;5=8O 14 4111751 :>=5FDC=:F88 56 4111765 :>=5FF8:;0 1550 4111821 :>=5FG0A0 18 4113371 :>=5FM;5<5=B 18 4113389 :>=5FM;5<5=B0 45 4113407 :>=5G=0O 35 4113452 :>=5G=0O?>78F8O 22 4113487 :>=5G=89 5 4113509 :>=5G=>3> 5 4113514 :>=5G=>5 23 4113519 :>=5G=>9 4 4113542 :>=5G=>< 6 4113546 :>=5G=CN 12 4113552 :>=5G=K5 11 4113564 :>=5G=K9 466 4113575 :>=5G=K9>AB0B>: 43 4114041 :>=5G=K9>AB0B>:4B 40 4114084 :>=5G=K9>AB0B>::B 40 4114124 :>=5G=K9@0725@=CBK9>AB0B>:4B 22 4114164 :>=5G=K9@0725@=CBK9>AB0B>::B 22 4114186 :>=5G=K9C3>; 32 4114208 :>=5G=K9C3>;87<5@8B5;L=>94803@0<<K 13 4114240 :>=5G=K< 15 4114253 :>=5G=KE 10 4114268 :>=8G5A:0O?@>5:F8O@02=KE?;>I0459;0<15@B0 9 4114278 :>=:0=8 14 4114287 :>=:0B5=0F859 9 4114301 :>=:0B5=0F88 16 4114310 :>=:0B5=0F8O 25 4114326 :>=:@5B=0O 4 4114351 :>=:@5B=0O40B0 19 4114355 :>=:@5B=89 752 4114374 :>=:@5B=>3> 733 4115126 :>=:@5B=>5 80 4115859 :>=:@5B=>9 85 4115939 :>=:@5B=>< 205 4116024 :>=:@5B=><C 27 4116229 :>=:@5B=CN 21 4116256 :>=:@5B=K5 28 4116277 :>=:@5B=K9 1279 4116305 :>=:@5B=K< 51 4117584 :>=:@5B=K<8 12 4117635 :>=:@5B=KE 24 4117647 :>=:C@5=B 63 4117671 :>=:C@5=B0 9 4117734 :>=:C@5=B0< 7 4117743 :>=:C@5=B>2 12 4117750 :>=:C@5=BC 9 4117762 :>=:C@5=BK 26 4117771 :>=:C@5=F88 41 4117797 :>=:C@5=F8O 41 4117838 :>=:C@8@>20BL 4 4117879 :>=:C@8@CNI5<C 8 4117883 :>=:C@8@CNI89 12 4117891 :>==5:B>@ 12 4117903 :>==5:B>@0 6 4117915 :>=>AB0B>: 5 4117921 :>=?5@8>40 17 4117926 :>=A8AB5=B=0 89 4117943 :>=A8AB5=B=89 89 4118032 :>=A>;8 28 4118121 :>=A>;L 33 4118149 :>=AB0=B 200 4118182 :>=AB0=B0 1173 4118382 :>=AB0=B0:;NG7=0G5=8O 89 4119555 :>=AB0=B0< 15 4119644 :>=AB0=B0<5=5465@ 64 4119659 :>=AB0=B0<5=5465@7=0G5=8O 156 4119723 :>=AB0=B0<8 20 4119879 :>=AB0=B0E 8 4119899 :>=AB0=B5 5 4119907 :>=AB0=B>9 4 4119912 :>=AB0=BC 18 4119916 :>=AB0=BK 565 4119934 :>=AB0=BK<5=5465@ 46 4120499 :>=AB0=BK=01>@ 76 4120545 :>=AB@C8@>20BL 214 4120621 :>=AB@C8@C5<0O 4 4120835 :>=AB@C8@C5<>3> 4 4120839 :>=AB@C8@C5<K9 12 4120843 :>=AB@C8@C5B 210 4120855 :>=AB@C:B>@ 2032 4121065 :>=AB@C:B>@0 183 4123097 :>=AB@C:B>@0E 9 4123280 :>=AB@C:B>@5 96 4123289 :>=AB@C:B>@70?@>A0 62 4123385 :>=AB@C:B>@70?@>A02;>65==K970?@>A 12 4123447 :>=AB@C:B>@70?@>A02@5<5==0OB01;8F0 12 4123459 :>=AB@C:B>@70?@>A03@C??02@5<5==KEB01;8F 12 4123471 :>=AB@C:B>@70?@>A070<5=8BLB01;8FC 12 4123483 :>=AB@C:B>@70?@>A0>?8A0=852@5<5==>9B01;8FK 12 4123495 :>=AB@C:B>@70?@>A0>B>1@060BLB01;8FK87<5=5=89 12 4123507 :>=AB@C:B>@70?@>A0?0@0<5B@KB01;8FK 12 4123519 :>=AB@C:B>@70?@>A0A>740BL2;>65==K970?@>A 12 4123531 :>=AB@C:B>@70?@>A0A>740BL70?@>AC=8GB>65=8O2@5<5==>9B01;8FK 12 4123543 :>=AB@C:B>@70?@>A0A>740BL>?8A0=852@5<5==>9B01;8FK 12 4123555 :>=AB@C:B>@<0:5B0>D>@<;5=8O:><?>=>2:840==KE 38 4123567 :>=AB@C:B>@=0AB@>5::><?>=>2:840==KE 54 4123605 :>=AB@C:B>@>2 9 4123659 :>=AB@C:B>@>< 12 4123668 :>=AB@C:B>@AE5<K:><?>=>2:840==KE 40 4123680 :>=AB@C:B>@C 10 4123720 :>=AB@C:B>@D>@<0B=>9AB@>:8 39 4123730 :>=AB@C:B>@K 1510 4123769 :>=AB@C:F859 22 4125279 :>=AB@C:F88 72 4125301 :>=AB@C:F89 14 4125373 :>=AB@C:F8N 14 4125387 :>=AB@C:F8O 346 4125401 :>=AB@C:F8O< 5 4125747 :>=AB@C:F8O<8 12 4125752 :>=AB@C:F8OE 20 4125764 :>=AC;LB0F8O 4 4125784 :>=AC;LB0F8O<8 4 4125788 :>=B0:B 202 4125792 :>=B0:B0 89 4125994 :>=B0:B0<8 4 4126083 :>=B0:B0E 24 4126087 :>=B0:B5 4 4126111 :>=B0:B=>5;8F> 5 4126115 :>=B0:B=>9 4 4126120 :>=B0:B=CN 4 4126124 :>=B0:B=K9 8 4126128 :>=B0:B>2 42 4126136 :>=B0:BC 4 4126178 :>=B0:BK 28 4126182 :>=B59=5@ 559 4126210 :>=B59=5@0 70 4126769 :>=B59=5@5 32 4126839 :>=B59=5@:;NG59:@8?B>3@0D88 79 4126871 :>=B59=5@>2 4 4126950 :>=B59=5@>< 24 4126954 :>=B59=5@?>4?8A59 20 4126978 :>=B59=5@?>4?8A59:@8?B>3@0D88 27 4126998 :>=B59=5@C 23 4127025 :>=B59=5@K 12 4127048 :>=B5:A=>< 4 4127060 :>=B5:AB 5637 4127064 :>=B5:AB0 694 4132701 :>=B5:AB5 76 4133395 :>=B5:AB=>3> 81 4133471 :>=B5:AB=>5 124 4133552 :>=B5:AB=>5<5=N 81 4133676 :>=B5:AB=>5>1AC645=85 17 4133757 :>=B5:AB=>9 8 4133774 :>=B5:AB=>< 219 4133782 :>=B5:AB=><C 4 4134001 :>=B5:AB=K5 5 4134005 :>=B5:AB=K9 432 4134010 :>=B5:AB=KE 11 4134442 :>=B5:AB>1AC645=8O 27 4134453 :>=B5:AB>1AC645=8OA8AB5<K2708<>459AB28O 24 4134480 :>=B5:AB>2 5 4134504 :>=B5:AB>< 3 4134509 :>=B5:AB?@>AB@0=AB28<5= 63 4134512 :>=B5:AB?@>AB@0=AB28<5=xml 70 4134575 :>=B5:ABC 174 4134645 :>=B5=B 13 4134819 :>=B5=B0 5 4134832 :>=B5=B4;O?@>4068 9 4134837 :>=B@035=B 282 4134846 :>=B@035=B0 11 4135128 :>=B@035=B0< 5 4135139 :>=B@035=B0<8 10 4135144 :>=B@035=B>2 30 4135154 :>=B@035=B>< 6 4135184 :>=B@035=BK 142 4135190 :>=B@0AB=>ABL 4 4135332 :>=B@0AB=>ABLB5:AB0 9 4135336 :>=B@0AB=K 6 4135345 :>=B@0AB=K9 12 4135351 :>=B@>;5 8 4135363 :>=B@>;5< 6 4135371 :>=B@>;8@>20BL 15 4135377 :>=B@>;8@>20BLAO 14 4135392 :>=B@>;8@C5B 5 4135406 :>=B@>;8@C5BAO 8 4135411 :>=B@>;8@CNBAO 6 4135419 :>=B@>;;5@ 15 4135425 :>=B@>;;5@>< 10 4135440 :>=B@>;L 118 4135450 :>=B@>;L4>:C<5=B0 6 4135568 :>=B@>;L=0O 22 4135574 :>=B@>;L=0OB>G:08B>3>2AE5<K70?@>A0 68 4135596 :>=B@>;L=89 8 4135664 :>=B@>;L=>3> 8 4135672 :>=B@>;L=>5G8A;> 6 4135680 :>=B@>;L=>9 69 4135686 :>=B@>;L=CN 24 4135755 :>=B@>;L=K5 14 4135779 :>=B@>;L=K5AC<<K3@0<<0B8:@0A?>7=020=8O@5G8 6 4135793 :>=B@>;L=K5B>G:88B>3>2 13 4135799 :>=B@>;L=K5B>G:88B>3>2AE5<K70?@>A0 59 4135812 :>=B@>;L=K9 132 4135871 :>=B@>;L=K< 16 4136003 :>=B@>;L=KE 32 4136019 :>=B@>;LC=8:0;L=>AB8 63 4136051 :>=B@>;O 51 4136114 :>=BC@ 27 4136165 :>=BC@0 8 4136192 :>=BC@>2 4 4136200 :>=BC@?>;83>=0;L=>3>>1J5:B035>3@0D8G5A:>9AE5<K 56 4136204 :>=BC@K 14 4136260 :>=BC@K?>;83>=0;L=>3>>1J5:B035>3@0D8G5A:>9AE5<K 41 4136274 :>=D3C@0F88 272 4136315 :>=D5@5=F8O 4 4136587 :>=D83C@0B>@ 3245 4136591 :>=D83C@0B>@0 361 4139836 :>=D83C@0B>@5 2852 4140197 :>=D83C@0B>@>< 3 4143049 :>=D83C@0F859 9 4143052 :>=D83C@0F88 6500 4143061 :>=D83C@0F89 142 4149561 :>=D83C@0F8>==>3> 8 4149703 :>=D83C@0F8>==>< 12 4149711 :>=D83C@0F8>==K9 14 4149723 :>=D83C@0F8N 31 4149737 :>=D83C@0F8O 6736 4149768 :>=D83C@0F8Odom 43 4156504 :>=D83C@0F8O107K40==KE87<5=5=048=0<8G5A:8 12 4156547 :>=D83C@0F8O4>:C<5=B0dom 33 4156559 :>=D83C@0F8O70?8A8dom 33 4156592 :>=D83C@0F8O87<5=5=0 27 4156625 :>=D83C@0F8O<8 5 4156652 :>=D83C@0F8O?>AB@>8B5;Odom 33 4156657 :>=D83C@0F8OE 70 4156690 :>=D83C@8@>20=85 741 4156760 :>=D83C@8@>20=88 340 4157501 :>=D83C@8@>20=8O 401 4157841 :>=D8C3@0F88 4 4158242 :>=D;8:B 5 4158246 :>=D;8:B>20BL 6 4158251 :>=F0 844 4158257 :>=F0E 4 4159101 :>=F5 64 4159105 :>=F5?F859 3 4159169 :>=F5?F8O 3 4159172 :>=F>< 16 4159175 :>=FC 304 4159191 :>=FK 5 4159495 :>=JN=:F8O 6 4159500 :>>@48=0B 78 4159506 :>>@48=0B0 266 4159584 :>>@48=0B0< 49 4159850 :>>@48=0B0<8 5 4159899 :>>@48=0B=>5 8 4159904 :>>@48=0B=>9 4 4159912 :>>@48=0B=K9 24 4159916 :>>@48=0B=KE 12 4159940 :>>@48=0BC 42 4159952 :>>@48=0BK 80 4159994 :>>@48=8@>20==>3> 4 4160074 :>>@48=8@>20==K9 4 4160078 :>>@K5 4 4160082 :>?55: 15 4160086 :>?59:0 23 4160101 :>?59:8 9 4160124 :>?859 115 4160133 :>?88 743 4160248 :>?88107K40==KE 15 4160991 :>?89 141 4161006 :>?8@>20=85 1357 4161147 :>?8@>20=858?5@5<5I5=85 9 4162504 :>?8@>20=85< 368 4162513 :>?8@>20=88 78 4162881 :>?8@>20=8O 589 4162959 :>?8@>20BL 524 4163548 :>?8@>20BL2 72 4164072 :>?8@>20BL20A8=E 72 4164144 :>?8@>20BL21CD5@>1<5=0 9 4164216 :>?8@>20BL2;>65=85 9 4164225 :>?8@>20BL2;>65=8O 7 4164234 :>?8@>20BL40==K5D>@<K 11 4164241 :>?8@>20BL=02830F8>==CNAAK;:C 32 4164252 :>?8@>20BLA>>1I5=85 9 4164284 :>?8@>20BLAO 91 4164293 :>?8@>20BLD09; 28 4164384 :>?8@>20BLD09;0A8=E 22 4164412 :>?8@C5<>9 5 4164434 :>?8@C5<K5 6 4164439 :>?8@C5<K9 55 4164445 :>?8@C5B 450 4164500 :>?8@C5BAO 14 4164950 :>?8@CNBAO 77 4164964 :>?8N 441 4165041 :>?8O 1360 4165482 :>?8O1 10 4166842 :>?8O107K40==KE 7 4166852 :>?8O< 21 4166859 :>?8O<8 4 4166880 :>?8OA?8A:0 5 4166884 :>?8OE 4 4166889 :>?L5 141 4166893 :>@ 33 4167034 :>@0;;>2K9 27 4167067 :>@59A:89 14 4167094 :>@5=L 63 4167108 :>@5O 12 4167171 :>@78=0 4 4167183 :>@78=K 4 4167187 :>@8G=52K9 42 4167191 :>@= 5 4167233 :>@=5 5 4167238 :>@=52 233 4167243 :>@=52>3> 248 4167476 :>@=52>9 478 4167724 :>@=52>9url 9 4168202 :>@=52>9:>=B59=5@ 352 4168211 :>@=52>9B8? 22 4168563 :>@=52>< 7 4168585 :>@=52K5 4 4168592 :>@=52K5A2>9AB20 13 4168596 :>@=52K5A5@B8D8:0BK 14 4168609 :>@=52K5C7;K 18 4168623 :>@=52K< 13 4168641 :>@=52KE 13 4168654 :>@=5< 4 4168667 :>@=5B 8 4168671 :>@=O 25 4168679 :>@>1>@>B 11 4168704 :>@>1>@>B4B 11 4168715 :>@>1>@>B:B 11 4168726 :>@>;52A:8 5 4168737 :>@>;52A:83>;C1>9 11 4168742 :>@>B:85 6 4168753 :>@>B:89 32 4168759 :>@>B:>5 22 4168791 :>@>B:CN 4 4168813 :>@? 10 4168817 :>@?>@0B82=0O 8 4168827 :>@?>@0B82=K9 8 4168835 :>@?CA 11 4168843 :>@@5:B8@>20=85 4 4168854 :>@@5:B8@>20=8O 4 4168858 :>@@5:B8@>2:0 5 4168862 :>@@5:B=> 23 4168867 :>@@5:B=>3> 5 4168890 :>@@5:B=>5 35 4168895 :>@@5:B=>9 19 4168930 :>@@5:B=>AB8 5 4168949 :>@@5:B=>ABL 67 4168954 :>@@5:B=K 5 4169021 :>@@5:B=K9 132 4169026 :>@@5:B=K< 26 4169158 :>@@5:B=KE 15 4169184 :>@@5A?>=45=F859 6 4169199 :>@@5A?>=45=F88 46 4169205 :>@@5A?>=45=F8N 56 4169251 :>@@5A?>=45=F8O 109 4169307 :>@@5A?>=48@>20BL 10 4169416 :>@@5A?>=48@CNI53> 15 4169426 :>@@5A?>=48@CNI55 15 4169441 :>@@5A?>=48@CNI89 10 4169456 :>@@5A?>=48@CNI8E 11 4169466 :>@AC1:>=B> 40 4169477 :>@AC1:>=B>1 6 4169517 :>@AC1:>=B>2 6 4169523 :>@AG5B 39 4169529 :>@AG5B0 12 4169568 :>A0O 14 4169580 :>A89 14 4169594 :>A8=CA 11 4169608 :>A8=CA0 5 4169619 :>A>9 24 4169624 :>AB0 12 4169648 :>ABL 5 4169660 :>ABO 5 4169665 :>AK5 10 4169670 :>B 6 4169680 :>B>@0O 2809 4169686 :>B>@>3> 5886 4172495 :>B>@>5 3287 4178381 :>B>@>9 3244 4181668 :>B>@>< 1638 4184912 :>B>@><C 1866 4186550 :>B>@CN 987 4188416 :>B>@K5 3345 4189403 :>B>@K9 26692 4192748 :>B>@K< 2163 4219440 :>B>@K<8 495 4221603 :>B>@KE 3001 4222098 :>B>K@5 5 4225099 :>BK 6 4225104 :>MDD8F85=B 58 4225110 :>MDD8F85=B0<8 4 4225168 :>MDD8F85=B>2 12 4225172 :? 50 4225184 :@09 324 4225234 :@0902B> 13 4225558 :@092=CB@8 13 4225571 :@09=5 30 4225584 :@09=55 10 4225614 :@09=89 10 4225624 :@0= 55 4225634 :@0A8= 5 4225689 :@0A8=0 5 4225694 :@0A=0O 10 4225699 :@0A=89 18 4225709 :@0A=> 10 4225727 :@0A=>3> 8 4225737 :@0A=>9 17 4225745 :@0A=>D8>;5B>2K9 11 4225762 :@0A=CN 4 4225773 :@0A=K9 185 4225777 :@0A=K9F25B 4 4225962 :@0A=K< 17 4225966 :@0A=KE 8 4225983 :@0B5= 4 4225991 :@0B:0O 4 4225995 :@0B:0O8=D>@<0F8O 13 4225999 :@0B:89 100 4226012 :@0B:89703>;>2>: 5 4226112 :@0B:8< 9 4226117 :@0B:8E 10 4226126 :@0B:>2@5<5==0O 5 4226136 :@0B:>2@5<5==> 4 4226141 :@0B:>2@5<5==K9 9 4226145 :@0B:>3> 5 4226154 :@0B:>5 28 4226159 :@0B:>5?@54AB02;5=85 11 4226187 :@0B:>5?@54AB02;5=85>H81:8 51 4226198 :@0B:>9 21 4226249 :@0B:CN 4 4226270 :@0B=5 4 4226274 :@0B=89 4 4226278 :@0B=> 4 4226282 :@0B=>3> 4 4226286 :@0B=>5 11 4226290 :@0B=>AB8 8 4226301 :@0B=>ABL 43 4226309 :@0B=>ABL8=B5@20;0M:2820;5=B=>AB82@5<5=8 4 4226352 :@0B=>ABL<0:A8<0;L=>3>8=B5@20;0 4 4226356 :@0B=>ABL<8=8<0;L=>3>8=B5@20;0 4 4226360 :@0B=>ABL?5@8>48G5A:>3>20@80=B0 32 4226364 :@0B=>ABLN 9 4226396 :@0B=K9 16 4226405 :@0B=KE 7 4226421 :@0N 71 4226428 :@0O 53 4226499 :@0O< 4 4226552 :@0OB8 267 4226556 :@548B 109 4226823 :@548B0 61 4226932 :@548B>289 45 4226993 :@548B>2>3> 40 4227038 :@548B>2>5 5 4227078 :@548B>2><C 5 4227083 :@548B>2K9 151 4227088 :@548B>2K< 4 4227239 :@548B>2KE 10 4227243 :@548B>< 4 4227253 :@548BC 5 4227257 :@548BC5<K9 4 4227262 :@548BC5<KE 4 4227266 :@5< 5 4227270 :@5<>2K9 12 4227275 :@5AB 10 4227287 :@5AB8: 11 4227297 :@5AB8:>< 6 4227308 :@820O 36 4227314 :@8289 8 4227350 :@82>9 36 4227358 :@82KE 4 4227394 :@8?B>3@0D859 144 4227398 :@8?B>3@0D88 429 4227542 :@8?B>3@0D8G5A:85 8 4227971 :@8?B>3@0D8G5A:89 59 4227979 :@8?B>3@0D8G5A:>3> 46 4228038 :@8?B>3@0D8G5A:><C 5 4228084 :@8?B>3@0D8O 535 4228089 :@8?B>70I8B0 5 4228624 :@8?B>70I8BK 5 4228629 :@8?B>?@> 34 4228634 :@8?B>?@>20945@>< 13 4228668 :@8B5@852 60 4228681 :@8B5@85< 26 4228741 :@8B5@88 21 4228767 :@8B5@88>B1>@0 30 4228788 :@8B5@88>B1>@0<5=5465@ 24 4228818 :@8B5@89 234 4228842 :@8B5@89>B1>@0 325 4229076 :@8B5@89>B1>@0<5=5465@ 36 4229401 :@8B5@89>B1>@0A?8A>: 18 4229437 :@8B5@8N 19 4229455 :@8B5@8O 104 4229474 :@8B5@8O< 14 4229578 :@8B5@8O<8 20 4229592 :@8B8G5A:0O 4 4229612 :@8B8G5A:89 58 4229616 :@8B8G5A:89>1J5<?0<OB8?@>F5AA>2 11 4229674 :@8B8G5A:>3> 25 4229685 :@8B8G5A:>5 10 4229710 :@8B8G=0O 10 4229720 :@8B8G=89 10 4229730 :@8B8G=>AB8 6 4229740 :@8B8G=>ABL 6 4229746 :@8B8G=K9 10 4229752 :@><5 1042 4229762 :@C3 104 4230804 :@C30 37 4230908 :@C3;0O 4 4230945 :@C3;89 4 4230949 :@C3;K5 41 4230953 :@C3;K9 63 4230994 :@C3;KE 14 4231057 :@C3>20O 36 4231071 :@C3>20O>1J5<=0O 13 4231107 :@C3>20OA@07<5@>< 9 4231120 :@C3>2>9 140 4231129 :@C3>2KE 49 4231269 :@C652> 5 4231318 :@C?=K5 5 4231323 :@C?=K9 51 4231328 :@C?=K9H@8DBB5:AB0 11 4231379 :@C?=KE 4 4231390 :@C?A 44 4231394 :A 20 4231438 :A@54=8E 9 4231458 :B 99 4231467 :B> 21 4231566 :C1 915 4231587 :C10 553 4232502 :C1>2 33 4233055 :C1C 5 4233088 :C1K 25 4233093 :C259B 12 4233118 :C40 59 4233130 :C40:>?8@>20BL 5 4233189 :C< 18 4233194 :C?0B 5 4233212 :C?8; 4 4233217 :C?8;> 4 4233221 :C?8B8 4 4233225 :C?8BL 5 4233229 :C?;5==K9 4 4233234 :C?;5==K< 4 4233238 :C?>@>A 7 4233242 :C?>@>A0 6 4233249 :C@A 121 4233255 :C@A20; 6 4233376 :C@A5 5 4233382 :C@A82 4 4233387 :C@A82=K9 4 4233391 :C@A82=K< 4 4233395 :C@A82>< 4 4233399 :C@A>@ 434 4233403 :C@A>@0 359 4233837 :C@A>@>< 25 4234196 :C@AK 19 4234221 :C@AK20;NB 123 4234240 :CA 75 4234363 :CE>==0O 15 4234438 :CE>==K9 47 4234453 :G 33 4234500 :MH 61 4234533 :MH0 38 4234594 :MH59 4 4234632 :MH8@>20=85 36 4234636 :MH8@>20BLAO 165 4234672 :MH8@C5BAO 145 4234837 :MH8@CNBAO 34 4234982 ; 36 4235016 ;07C@=K9 12 4235052 ;0= 9 4235064 ;0=4H0DB 18 4235073 ;0=4H0DB=0O 8 4235091 ;0=4H0DB=K9 8 4235099 ;0=H0DB=0O 8 4235107 ;0@30 27 4235115 ;0AB 27 4235142 ;0B 11 4235169 ;0B0 11 4235180 ;0B28O 12 4235191 ;0B8 8 4235203 ;0B8=8F0 30 4235211 ;0B8=A:85 12 4235241 ;0B8=A:89 92 4235253 ;0B8=A:8E 12 4235345 ;0B8=A:>3> 64 4235357 ;0B8=A:>5 4 4235421 ;0BKHA:89 38 4235425 ;0BKHA:>3> 14 4235463 ;52 57 4235477 ;520 350 4235534 ;520O 22 4235884 ;520O:>;>=:0 9 4235906 ;525BL 264 4235915 ;52> 538 4236179 ;52>25@E 40 4236717 ;52>3> 40 4236757 ;52>5 69 4236797 ;52>52=5H=55 9 4236866 ;52>57=0G5=85 25 4236875 ;52>9 309 4236900 ;52>< 16 4237209 ;52><C 33 4237225 ;52>=87 36 4237258 ;52>F5=B@ 9 4237294 ;52CN 10 4237303 ;52K9 1011 4237313 ;52K9>G5=LC7:89 9 4238324 ;52K9>G5=LH8@>:89 9 4238333 ;52K9C7:89 9 4238342 ;52K9H8@>:89 9 4238351 ;535=40 351 4238360 ;535=45 72 4238711 ;535=4>9 4 4238783 ;535=4C 24 4238787 ;535=4K 243 4238811 ;53:89 7 4239054 ;53:8< 3 4239061 ;53:> 4 4239064 ;53:>5 3 4239068 ;54 10 4239071 ;560BL 43 4239081 ;568B 43 4239124 ;59 8 4239167 ;5:A8G5A:89 96 4239175 ;5:A8G5A:>3> 4 4239271 ;5:A8G5A:>5 93 4239275 ;5:A8G5A:>57=0G5=85 174 4239368 ;5:A8G5A:>57=0G5=85>3@0=8G5=8O?@>AB@0=AB28<5= 11 4239542 ;5:A8G5A:><C 5 4239553 ;5=B 4 4239558 ;5=B0 13 4239562 ;5=B>9 8 4239575 ;5=B>G=>9 4 4239583 ;5=B>G=K9 4 4239587 ;5?5AB:>2>9 20 4239591 ;5?5AB:>2K9 20 4239611 ;5A 5 4239631 ;5A0 5 4239636 ;5AA 18 4239641 ;5B 79 4239659 ;5B1 6 4239738 ;5B2 6 4239744 ;5B0 54 4239750 ;5B=53> 16 4239804 ;5B=89 16 4239820 ;5B> 89 4239836 ;5B>< 25 4239925 ;5O 8 4239950 ;8 2914 4239958 ;81> 1377 4242872 ;820= 12 4244249 ;820=K 12 4244261 ;828O 12 4244273 ;848@CNI53> 44 4244285 ;848@CNI85 29 4244329 ;848@CNI89 99 4244358 ;848@CNI8< 48 4244457 ;848@CNI8E 14 4244505 ;8: 59 4244519 ;8;8O 52 4244578 ;8;>2K9 5 4244630 ;8<0 11 4244635 ;8<8B 33 4244646 ;8<8B0 13 4244679 ;8<8B>2 8 4244692 ;8<8B?0<OB8 15 4244700 ;8<>==> 5 4244715 ;8<>==>75;5=K9 11 4244720 ;8<>==K9 17 4244731 ;8=59:0 26 4244748 ;8=59:5 8 4244774 ;8=59:8 17 4244782 ;8=59=0O 4 4244799 ;8=59=>3> 48 4244803 ;8=59=>9 4 4244851 ;8=59=>< 4 4244855 ;8=59=CN 6 4244859 ;8=59=K5 4 4244865 ;8=59=K9 128 4244869 ;8=59=KE 28 4244997 ;8=859 78 4245025 ;8=88 550 4245103 ;8=8845;5=89 11 4245653 ;8=88A2O759 18 4245664 ;8=88A>548=5=8O7=0G5=89?>A5@8O< 32 4245682 ;8=88B@5=40 9 4245714 ;8=88B@5=4024803@0<<5 5 4245723 ;8=88B@5=404803@0<<K 44 4245728 ;8=88H:0; 45 4245772 ;8=88H:0;K 27 4245817 ;8=89 235 4245844 ;8=8N 37 4246079 ;8=8O 1312 4246116 ;8=8O24803@0<<5 10 4247428 ;8=8O< 12 4247438 ;8=8O<8 55 4247450 ;8=8OA5B:8 9 4247505 ;8=8OB@5=404803@0<<K 90 4247514 ;8=8OE 4 4247604 ;8=8OH:0;K 9 4247608 ;8=: 25 4247617 ;8=CB8 149 4247642 ;8=L 149 4247791 ;8AB 1742 4247940 ;8AB0 28 4249682 ;8AB5 5 4249710 ;8ABL52 4 4249715 ;8ABLO<8 4 4249719 ;8B20 12 4249723 ;8B2> 12 4249735 ;8B5@0; 121 4249747 ;8B5@0;0 15 4249868 ;8B5@0;0<8 5 4249883 ;8B5@0;0E 4 4249888 ;8B5@0;5 7 4249892 ;8B5@0;>2 5 4249899 ;8B5@0;>< 10 4249904 ;8B5@0;K 30 4249914 ;8B>2A:89 38 4249944 ;8B>2A:>3> 14 4249982 ;8EB5=HB59= 12 4249996 ;8F0 51 4250008 ;8F5=788 339 4250059 ;8F5=7888 4 4250398 ;8F5=789 99 4250402 ;8F5=78>==>3> 4 4250501 ;8F5=78>==>AB8 5 4250505 ;8F5=78>==K9 4 4250510 ;8F5=78@>20=85 126 4250514 ;8F5=78@>20=8O 126 4250640 ;8F5=78N 63 4250766 ;8F5=78O 524 4250829 ;8F5=78OE 10 4251353 ;8F> 59 4251363 ;8G=>5 4 4251422 ;8G=>9 4 4251426 ;8G=>AB=K9 7 4251430 ;8G=K540==K5 9 4251437 ;8G=K9 4 4251446 ;8H5=> 6 4251450 ;8H=89 24 4251456 ;8H=8E 24 4251480 ;8HL 20 4251504 ;>3 34 4251524 ;>30@8D< 32 4251558 ;>30@8D<0 20 4251590 ;>30@8D<8G5A:0O 4 4251610 ;>30@8D<8G5A:89 10 4251614 ;>38: 14 4251624 ;>38:0 14 4251638 ;>38:8 4 4251652 ;>38:C 10 4251656 ;>38= 54 4251666 ;>38=smtp 4 4251720 ;>38=0 5 4251724 ;>38=C 4 4251729 ;>38=K 8 4251733 ;>38@>20=8N 5 4251741 ;>38G5A:0O 15 4251746 ;>38G5A:8 44 4251761 ;>38G5A:85 109 4251805 ;>38G5A:89 599 4251914 ;>38G5A:89url 7 4252513 ;>38G5A:8< 15 4252520 ;>38G5A:8<8 11 4252535 ;>38G5A:8E 276 4252546 ;>38G5A:>3> 108 4252822 ;>38G5A:>5 90 4252930 ;>38G5A:>9 32 4253020 ;>38G5A:>< 5 4253052 ;>38G5A:><C 8 4253057 ;>38G5A:CN 7 4253065 ;>3>B8? 22 4253072 ;>3>B8?0 12 4253094 ;>6L 8468 4253106 ;>: 6 4261574 ;>:0;870F859 5 4261580 ;>:0;870F88 133 4261585 ;>:0;870F8O 144 4261718 ;>:0;87>20==>5 54 4261862 ;>:0;87>20==><C 5 4261916 ;>:0;87>20==K5 6 4261921 ;>:0;87>20==K9 73 4261927 ;>:0;87>20==KE 8 4262000 ;>:0;87C5<0O 6 4262008 ;>:0;87C5<K9 6 4262014 ;>:0;L=0O 35 4262020 ;>:0;L=0O40B0 14 4262055 ;>:0;L=0O40B0>B?@02;5=8O 5 4262069 ;>:0;L=0O40B0A>A<5I5=85< 14 4262074 ;>:0;L=0OA5BL 9 4262088 ;>:0;L=89 460 4262097 ;>:0;L=> 34 4262557 ;>:0;L=>3> 399 4262591 ;>:0;L=>5 433 4262990 ;>:0;L=>58<O 809 4263423 ;>:0;L=>58<O0B@81CB0 60 4264232 ;>:0;L=>9 129 4264292 ;>:0;L=>< 5 4264421 ;>:0;L=><C 79 4264426 ;>:0;L=CN 60 4264505 ;>:0;L=K5 44 4264565 ;>:0;L=K5C254><;5=8O 9 4264609 ;>:0;L=K9 1279 4264618 ;>:0;L=K9:;NG:0;5=40@O 47 4265897 ;>:0;L=K9:;NG:>=B0:B0 29 4265944 ;>:0;L=K9:;NGA>1KB8O:0;5=40@O 29 4265973 ;>:0;L=K< 70 4266002 ;>:0;L=K<8 64 4266072 ;>:0;L=KE 38 4266136 ;><0=>9 4 4266174 ;><0=K9 4 4266178 ;>=3 16 4266182 ;>A>AL 22 4266198 ;>A>ALA25B;K9 11 4266220 ;>A>ALB5<=K9 11 4266231 ;C609:0 5 4266242 ;C=0 364 4266247 ;C? 23 4266611 ;C?0 23 4266634 ;CGH5 8 4266657 ;CGH55 4 4266665 ;CGH89 12 4266669 ;KAK9 340 4266681 ;L=O=>9 12 4267021 ;N10 542 4267033 ;N10O 94 4267575 ;N10OG0ABL 9 4267669 ;N189 471 4267678 ;N1>3> 370 4268149 ;N1>5 140 4268519 ;N1>9 1466 4268659 ;N1>9=5C?>@O4>G5==K9C75; 9 4270125 ;N1>< 120 4270134 ;N1><C 41 4270254 ;N1><K< 6 4270295 ;N1C20B8 42 4270301 ;N1CN 42 4270343 ;N1K5 162 4270385 ;N1K< 51 4270547 ;N1K<8 8 4270598 ;N1KE 60 4270606 ;N:A5<1C@3 16 4270666 < 40 4270682 <03 74 4270722 <0311 15 4270796 <03078= 58 4270811 <03078=0 23 4270869 <03078=5 24 4270892 <03078=>< 20 4270916 <03078=C 9 4270936 <035=B0 12 4270945 <09:@>A>DB 8 4270957 <0:0> 14 4270965 <0:54>=89 12 4270979 <0:54>=8O 12 4270991 <0:54>=A:89 14 4271003 <0:5B 2181 4271017 <0:5B0 812 4273198 <0:5B0< 15 4274010 <0:5B0<8 62 4274025 <0:5B0E 29 4274087 <0:5B3@C??8@>2:8 26 4274116 <0:5B3@C??8@>2:84803@0<<K<0:5B0:><?>=>2:840==KE 51 4274142 <0:5B3@C??8@>2:84803@0<<K>1;0AB8:><?>=>2:840==KE 30 4274193 <0:5B3@C??8@>2:8AE5<K:><?>=>2:840==KE 67 4274223 <0:5B3@C??8@>2:8B01;8FK<0:5B0:><?>=>2:840==KE 70 4274290 <0:5B45B0;L=KE70?8A59 9 4274360 <0:5B4803@0<<K>1;0AB8:><?>=>2:840==KE 20 4274369 <0:5B4>:C<5=B0>1;0AB8:><?>=>2:840==KE 14 4274389 <0:5B5 65 4274403 <0:5B703>;>2:0:>;;5:F887=0G5=89>1;0AB8:><?>=>2:840==KE 25 4274468 <0:5B703>;>2:0>BG5B0 9 4274493 <0:5B85@0@E88 9 4274502 <0:5B8B>3>2:>;>=>: 11 4274511 <0:5B8B>3>2@5AC@A>2 11 4274522 <0:5B8B>3>2AB@>: 11 4274533 <0:5B:>;;5:F887=0G5=89>1;0AB8:><?>=>2:840==KE 20 4274544 <0:5B:><?>=>2:840==KE 122 4274564 <0:5B>1;0AB8:><?>=>2:840==KE 70 4274686 <0:5B>1;0AB8<0:5B0:><?>=>2:840==KE 49 4274756 <0:5B>1@01>B:8 5 4274805 <0:5B>1I8E8B>3>2 20 4274810 <0:5B>2 117 4274830 <0:5B>< 178 4274947 <0:5B>BG5B0 10 4275125 <0:5B>D>@<;5=8O 67 4275135 <0:5B>D>@<;5=8O:><?>=>2:840==KE 145 4275202 <0:5B?>420;0 59 4275347 <0:5B?>420;085@0@E88 9 4275406 <0:5B?>420;0>BG5B0 9 4275415 <0:5B?>420;0B01;8FK 9 4275424 <0:5B?>;598B>30AE5<K:><?>=>2:840==KE 79 4275433 <0:5B?>;OAE5<K:><?>=>2:840==KE 47 4275512 <0:5B@55AB@0 5 4275559 <0:5B@5AC@A04803@0<<K>1;0AB8:><?>=>2:840==KE 24 4275564 <0:5B@5AC@A>2 44 4275588 <0:5BA>AB020?>:070B5;59 7 4275632 <0:5BAB@C:BC@K:>=D83C@0F8 6 4275639 <0:5BB5;04803@0<<K<0:5B0:><?>=>2:840==KE 57 4275645 <0:5BB5;0B01;8FK<0:5B0:><?>=>2:840==KE 57 4275702 <0:5BC 28 4275759 <0:5BH0?:8 61 4275787 <0:5BH0?:8B01;8FK 9 4275848 <0:5BK 354 4275857 <0:5BK3@C??8@>2>: 19 4276211 <0:5BK3@C??8@>2>:AE5<K:><?>=>2:840==KE 81 4276230 <0:5BK703>;>2:>23@C??8@>2>: 19 4276311 <0:5BK?>420;>2C@>2=59 9 4276330 <0:5BK?>;59 15 4276339 <0:5BK?>;598B>30 15 4276354 <0:5BK?>;598B>30AE5<K:><?>=>2:840==KE 67 4276369 <0:5BK?>;59AE5<K:><?>=>2:840==KE 65 4276436 <0:5BKB5;04803@0<<K<0:5B0:><?>=>2:840==KE 69 4276501 <0:5BKB5;0B01;8FK<0:5B0:><?>=>2:840==KE 69 4276570 <0:5BKC@>2=59 9 4276639 <0:@>A 14 4276648 <0:@>A>2 11 4276662 <0:@>AK 11 4276673 <0:A 21 4276684 <0:A0 21 4276705 <0:A2:;NG0NI55 9 4276726 <0:A40B0 11 4276735 <0:A4;8=0 9 4276746 <0:A8<0;L=0O 358 4276755 <0:A8<0;L=0O2;>65==>ABL 7 4277113 <0:A8<0;L=0O2KA>B0 210 4277120 <0:A8<0;L=0O2KA>B02AB@>:0EB01;8FK 13 4277330 <0:A8<0;L=0O3;C18=0 4 4277343 <0:A8<0;L=0O4;8=0 9 4277347 <0:A8<0;L=0OH8@8=0 223 4277356 <0:A8<0;L=89 228 4277579 <0:A8<0;L=> 101 4277807 <0:A8<0;L=>2:;NG0NI89D0A5B 9 4277908 <0:A8<0;L=>2E>48B 11 4277917 <0:A8<0;L=>3> 213 4277928 <0:A8<0;L=>5 368 4278141 <0:A8<0;L=>57=0G5=85 119 4278509 <0:A8<0;L=>5:>;8G5AB2> 19 4278628 <0:A8<0;L=>5:>;8G5AB2>=5CA?5H=KE?>?KB>: 45 4278647 <0:A8<0;L=>5:>;8G5AB2>=5CA?5H=KE?>?KB>:?@>25@:8:>40?>4B25@645=8O 54 4278692 <0:A8<0;L=>5:>;8G5AB2>=5CA?5H=KE?>?KB>:?@>25@:8:>40?>4B25@645=8O0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 4278746 <0:A8<0;L=>5:>;8G5AB2>?>;L7>20B5;59 25 4278782 <0:A8<0;L=>5:>;8G5AB2>?>;L7>20B5;59?@>3@0<<=>9;8F5=788 11 4278807 <0:A8<0;L=>5:>;8G5AB2>F25B>23@0485=B=>9?0;8B@K 9 4278818 <0:A8<0;L=>5:>;8G5AB>2@O4>2?>4?8A59 9 4278827 <0:A8<0;L=>8A:;NG0NI89D0A5B 9 4278836 <0:A8<0;L=>9 206 4278845 <0:A8<0;L=>< 4 4279051 <0:A8<0;L=><C 15 4279055 <0:A8<0;L=CN 239 4279070 <0:A8<0;L=K5 12 4279309 <0:A8<0;L=K58=B5@20;K 9 4279321 <0:A8<0;L=K9 1485 4279330 <0:A8<0;L=K98=B5@20; 4 4280815 <0:A8<0;L=K9>B=>A8B5;L=K9@07<5@ 13 4280819 <0:A8<0;L=K9?5@8>4 12 4280832 <0:A8<0;L=K9?5@8>4?@52KH5=8O?0<OB8 11 4280844 <0:A8<0;L=K9@07<5@ 19 4280855 <0:A8<0;L=K9@07<5@?C7K@L:0 32 4280874 <0:A8<0;L=K9A428370?CA:0@53;0<5=B=KE7040=891570:B82=KE?>;L7>20B5;59 47 4280906 <0:A8<0;L=K9A@>:459AB28O?0@>;59 63 4280953 <0:A8<0;L=K9A@>:459AB28O?0@>;59?>;L7>20B5;59 36 4281016 <0:A8<0;L=K< 21 4281052 <0:A8<878@>20==>5 9 4281073 <0:A8<878@>20==>< 4 4281082 <0:A8<878@>20==K9 10 4281086 <0:A8<C< 90 4281096 <0:A8<C<0 4 4281186 <0:A8<C<A5@89 53 4281190 <0:A8<C<A5@89:>;8G5AB2> 22 4281243 <0:A8<C<A5@89?@>F5=B 21 4281265 <0:A8A:;NG0NI55 9 4281286 <0:A:>;8G5AB2>AC1:>=B> 9 4281295 <0:AAB>8<>ABL 6 4281304 <0:AF5=0 8 4281310 <0; 22 4281318 <0;0 5 4281340 <0;0978O 12 4281345 <0;09A:89 16 4281357 <0;0O;0< 14 4281373 <0;5=L:85 10 4281387 <0;5=L:89 664 4281397 <0;5=L:89:204@0B 9 4282061 <0;5=L:89:@C3 9 4282070 <0;5=L:89B@5C3>;L=8: 9 4282079 <0;5=L:8< 4 4282088 <0;5=L:>3> 12 4282092 <0;89 5 4282104 <0;8=>2K9 12 4282109 <0;> 4 4282121 <0;>5 9 4282125 <0;K 8 4282134 <0;K9 631 4282142 <0;K< 5 4282773 <0;LB0 16 4282778 <0;LB89A:89 14 4282794 <0=8?C;8@>20=85 4 4282808 <0=8?C;8@>20=8O 4 4282812 <0=8?C;8@>20BL 27 4282816 <0=8?C;8@CNB 3 4282843 <0=8D5AB 26 4282846 <0=8D5AB0 5 4282872 <0=8D5AB5 21 4282877 <0=E5BB5= 4 4282898 <0?0 73 4282902 <0@0B89A:89 14 4282975 <0@30@8B0 10 4282989 <0@: 9 4282999 <0@:0 5 4283008 <0@:5@ 436 4283013 <0@:5@0 141 4283449 <0@:5@0<8 8 4283590 <0@:5@24803@0<<5 10 4283598 <0@:5@5 5 4283608 <0@:5@=0945= 9 4283613 <0@:5@>2 76 4283622 <0@:5@>< 15 4283698 <0@:5@C 5 4283713 <0@:5@K 63 4283718 <0@:5B8=3 5 4283781 <0@:5B8=3F5= 36 4283786 <0@:89 5 4283822 <0@:8@>20==K9 9 4283827 <0@:8@>20==K9A?8A>: 9 4283836 <0@:8@>20==KE 5 4283845 <0@:8@>20BL 4 4283850 <0@:8@>2:0 4 4283854 <0@:8@>2:8 4 4283858 <0@:> 5 4283862 <0@>::> 12 4283867 <0@B 4 4283879 <0@B0 4 4283883 <0@H0;;>2K 12 4283887 <0@H@CB 371 4283899 <0@H@CB0 356 4284270 <0@H@CB>2 12 4284626 <0@H@CB>< 5 4284638 <0@H@CBC 15 4284643 <0A:0 471 4284658 <0A:0xs 877 4285129 <0A:00B@81CB>2 16 4286006 <0A:0:>40 9 4286022 <0A:0<8 5 4286031 <0A:0=0;>3>20OAB02:0 7 4286036 <0A:0>48=>G=0O?@>4060 6 4286043 <0A:0?>4AG5B:>;8G5AB20 6 4286049 <0A:0@07@5H8BL?@>406C 7 4286055 <0A:0HBCG=K9B>20@ 7 4286062 <0A:5 108 4286069 <0A:8 82 4286177 <0A:>9 26 4286259 <0A:C 85 4286285 <0A>: 30 4286370 <0AA 27 4286400 <0AA0 27 4286427 <0AA82 5273 4286454 <0AA821 31 4291727 <0AA822 29 4291758 <0AA823 5 4291787 <0AA820 897 4291792 <0AA820<8 23 4292689 <0AA8242>8G=KE40==KE 6 4292712 <0AA825 274 4292718 <0AA82703>;>2:>2A>>1I5=898;8845=B8D8:0B>@>2 7 4292992 <0AA827040G 7 4292999 <0AA8270B@0B 10 4293006 <0AA827=0G5=89 11 4293016 <0AA82845=B8D8:0B>@>2 5 4293027 <0AA82845=B8D8:0B>@>2A>>1I5=89 10 4293032 <0AA828<5= 10 4293042 <0AA828<5=:>;>=>: 6 4293052 <0AA828<5=<5B040==KE 27 4293058 <0AA82:;NG59 5 4293085 <0AA82:>=AB0=B 9 4293090 <0AA82:C@A>2 10 4293099 <0AA82=><5=:;0BC@K 5 4293109 <0AA82=C6=KEB8?>2 10 4293114 <0AA82>1;0AB59 5 4293124 <0AA82>1J5:B>2 4 4293129 <0AA82>2 41 4293133 <0AA82>< 96 4293174 <0AA82>B1>@ 7 4293270 <0AA82A>>1I5=89 5 4293277 <0AA82AAK;>: 12 4293282 <0AA82AB@>: 5 4293294 <0AA82B8?>2 43 4293299 <0AA82C 27 4293342 <0AA82C40;O5<KE40==KE 10 4293369 <0AA82D09;>2 6 4293379 <0AA82K 15 4293385 <0AA82K845=B8G=K 6 4293400 <0AA82M;5<5=B>2 26 4293406 <0AA>2K9 25 4293432 <0AA>2KE 25 4293457 <0AAA5@284 7 4293482 <0AAA>>1 7 4293489 <0AAG 6 4293496 <0AB5@ 9 4293502 <0AHB01 195 4293511 <0AHB010 62 4293706 <0AHB015 8 4293768 <0AHB018@>20=85 79 4293776 <0AHB018@>20=85< 4 4293855 <0AHB018@>20=88 8 4293859 <0AHB018@>20=8O 53 4293867 <0AHB018@>20BL 40 4293920 <0AHB018@C5<>< 8 4293960 <0AHB018@C5<K9 8 4293968 <0AHB018@CO 4 4293976 <0AHB01=0O;8=59:0 10 4293980 <0AHB01=89 4 4293990 <0AHB01=>3> 4 4293994 <0AHB01=>9 12 4293998 <0AHB01=K9 16 4294010 <0AHB01>< 4 4294026 <0AHB01?5G0B8 11 4294030 <0AHB01C 12 4294041 <0B5<0B8G5A:0O 5 4294053 <0B5<0B8G5A:85 11 4294058 <0B5<0B8G5A:89 21 4294069 <0B5<0B8G5A:>5 5 4294090 <0B5<0B8G5A:>9 4 4294095 <0B5@80; 85 4294099 <0B5@80;0 3 4294184 <0B5@80;>2 5 4294187 <0B5@80;>< 4 4294192 <0B5@80;K 68 4294196 <0B8 9 4294264 <0B@8F0 14 4294273 <0B@8FK 14 4294287 <0BL 10 4294301 <0E 20 4294311 <0F0 482 4294331 <0H8=0 5 4294813 <0H8=5 5 4294818 <1 28 4294823 <109B 12 4294851 <3=>25==> 4 4294863 <3=>25==K9 31 4294867 <3=>25==KE 27 4294898 <45=L=545;O<5AOF 5 4294925 <515;L 47 4294930 <530109B 6 4294977 <530109BC 5 4294983 <5480 4 4294988 <548070?8ALndef 25 4294992 <5480=0 13 4295017 <548C< 18 4295030 <54;5==> 9 4295048 <54;5==>5 8 4295057 <54;5==K9 14 4295065 <54=>3> 6 4295079 <54=K9 7 4295085 <54L 10 4295092 <564C 647 4295102 <564C7=0G5=8O<8 26 4295749 <564C=0@>4=K9 4 4295775 <564CAB@>G=K9 5 4295779 <564CAB@>G=K98=B5@20; 11 4295784 <56:;0AB5@=K5@0AAB>O=8O 9 4295795 <56?@>F5AA=>9 6 4295804 <56?@>F5AA=K9 6 4295810 <56AB@>G=K9 5 4295816 <5:A8:0 12 4295821 <5; 12 4295833 <5;:89 9 4295845 <5;:89H@8DBB5:AB0 11 4295854 <5;:8< 4 4295865 <5;:>5 4 4295869 <5<> 4 4295873 <5<>?>;5 4 4295877 <5= 9 4295881 <5=0 9 4295890 <5=5465@ 1334 4295899 <5=5465@websocket:;85=B>2 30 4297233 <5=5465@websocket:;85=BA>548=5=89 25 4297263 <5=5465@0 430 4297288 <5=5465@035=B0:;85=BA:>3>?@8;>65=8O 61 4297718 <5=5465@0< 5 4297779 <5=5465@0<8 5 4297784 <5=5465@0E 10 4297789 <5=5465@157>?0A=>3>E@0=8;8I0 60 4297799 <5=5465@187=5A?@>F5AA0 7 4297859 <5=5465@1;>:8@>2:80CB5=B8D8:0F88?>;L7>20B5;598=D>@<0F8>==>9107K 25 4297866 <5=5465@2=5H=53>E@0=8;8I042>8G=KE40==KE 86 4297891 <5=5465@2=5H=8EE@0=8;8I42>8G=KE40==KE 32 4297977 <5=5465@2@5<5==KEB01;8F 48 4298009 <5=5465@2AB@>5==KE?>:C?>: 105 4298057 <5=5465@3;>10;L=>3>?>8A:0 50 4298162 <5=5465@4>?>;=8B5;L=>9?@>25@:8?>;L7>20B5;O 32 4298212 <5=5465@4>?>;=8B5;L=KE=0AB@>5:0CB5=B8D8:0F88 67 4298244 <5=5465@4>AB02;O5<KEC254><;5=89 45 4298311 <5=5465@5 38 4298356 <5=5465@8AB>@8840==KE 136 4298394 <5=5465@8AB>@88@01>BK?>;L7>20B5;O 30 4298530 <5=5465@:0;5=40@59 118 4298560 <5=5465@:>=B0:B>2 72 4298678 <5=5465@:>?88107K40==KE 134 4298750 <5=5465@:>?89107K40==KE 61 4298884 <5=5465@:@8?B>3@0D88 550 4298945 <5=5465@<5B>:ndef 53 4299495 <5=5465@>1<5=040==K<8A>A=>2=K<A5@25@>< 15 4299548 <5=5465@>1@01>B:8>H81>: 95 4299563 <5=5465@>1@01>B:8AB@>:8xml 16 4299658 <5=5465@>2 70 4299674 <5=5465@>:=02=5H=53>A09B0 39 4299744 <5=5465@>< 38 4299783 <5=5465@>B>1@065=8O@5:;0<K 124 4299821 <5=5465@>B?@02:84>AB02;O5<KEC254><;5=89 25 4299945 <5=5465@>D>@<;5=8O>BG5B>2 30 4299970 <5=5465@?0=5;87040G>A 30 4300000 <5=5465@?;0=0>1<5=0 7 4300030 <5=5465@?>;8B8:?0@>;59?>;L7>20B5;59 30 4300037 <5=5465@?>;=>B5:AB>2>3>?>8A:0 113 4300067 <5=5465@?>;CG5=8O;8F5=789 130 4300180 <5=5465@?>;L7>20B5;598=D>@<0F8>==>9107K 109 4300310 <5=5465@?@>25@:82AB@>5==KE?>:C?>: 25 4300419 <5=5465@?@>3@5AA82=>3>251?@8;>65=8O 40 4300444 <5=5465@@01>BKA@5GLN 155 4300484 <5=5465@@0AH8@5=89:>=D83C@0F88 57 4300639 <5=5465@@538AB@0 7 4300696 <5=5465@@53;0<5=B=KE7040=89 36 4300703 <5=5465@A8AB5<K0=0;8B8:8 30 4300739 <5=5465@A8AB5<K2708<>459AB28O 579 4300769 <5=5465@A?8A:0?@>25@:8@0A:@KB8O?0@>;O 44 4301348 <5=5465@A?@02>G=8:0 6 4301392 <5=5465@A@54AB2?5@540G840==KE=0CAB@>9AB25 15 4301398 <5=5465@A@54AB2CAB@>9AB20 24 4301413 <5=5465@AB0B8AB8:88A?>;L7>20=8O?@8;>65=8O 69 4301437 <5=5465@B01;8G=>3>?@>AB@0=AB20107K40==KE 90 4301506 <5=5465@B01;8G=KE?@>AB@0=AB2107K40==KE 61 4301596 <5=5465@C 233 4301657 <5=5465@C254><;5=89:;85=B0 25 4301890 <5=5465@D09;>2KE?>B>:>2 141 4301915 <5=5465@D>=>2KE7040=89 47 4302056 <5=5465@E@0=8;8I042>8G=KE40==KE 110 4302103 <5=5465@H01;>=>2=0AB@>5:2B>@>3>D0:B>@00CB5=B8D8:0F88 25 4302213 <5=5465@K 239 4302238 <5=55 60 4302477 <5=LH5 608 4302537 <5=LH55 14 4303145 <5=LH58;8@02=> 34 4303159 <5=LH59 16 4303193 <5=LH5< 4 4303209 <5=LH89 693 4303213 <5=LH8< 26 4303906 <5=LH>9 645 4303932 <5=LHCN 17 4304577 <5=N 550 4304594 <5=NDC=:F89 9 4305144 <5=O5B 241 4305153 <5=O5BAO 109 4305394 <5=O;AO 6 4305503 <5=OBL 366 4305509 <5=OBLAO 182 4305875 <5=ONBAO 24 4306057 <5=ONI89 5 4306081 <5=ONI8E 5 4306086 <5@ 55 4306091 <5@0 55 4306146 <5@0@0AAB>O=8O 4 4306201 <5@5 55 4306205 <5@=CN 5 4306260 <5@=K9 9 4306265 <5@O 55 4306274 <5A 6 4306329 <5A0 6 4306335 <5A?>;>65=8O 4 4306341 <5AA5=4565@>< 4 4306345 <5AA5=465@ 40 4306349 <5AA5=465@0<8 32 4306389 <5AA5=465@>< 8 4306421 <5AB0 321 4306429 <5AB0<8 16 4306750 <5AB0E 15 4306766 <5AB5 54 4306781 <5AB8 12 4306835 <5AB=>3> 6 4306847 <5AB=>5 42 4306853 <5AB=>52@5<O 17 4306895 <5AB=K9 48 4306912 <5AB> 499 4306960 <5AB>< 8 4307459 <5AB>?>;>65=85 230 4307467 <5AB>?>;>65=85wsdl 5 4307697 <5AB>?>;>65=88 5 4307702 <5AB>?>;>65=8N 15 4307707 <5AB>?>;>65=8O 67 4307722 <5AB>@0A?>;>65=85 19 4307789 <5AB>@0A?>;>65=8O 5 4307808 <5AB>E@0=5=8O 5 4307813 <5ABC 7 4307818 <5AOF 859 4307825 <5AOF0 345 4308684 <5AOF0< 59 4309029 <5AOF0E 12 4309088 <5AOF5 36 4309100 <5AOF52 50 4309136 <5AOF521 6 4309186 <5AOF522 6 4309192 <5AOF5< 12 4309198 <5AOF>B=0G0;0?5@8>40 9 4309210 <5AOF>B=0G0;0?5@8>40445 9 4309219 <5AOFA=0G0;03>40 9 4309228 <5AOFA=0G0;0:20@B0;0 9 4309237 <5AOFK 51 4309246 <5AOG=>9 4 4309297 <5AOG=CN 11 4309301 <5AOG=K9 15 4309312 <5B0 8 4309327 <5B040==>3> 1252 4309335 <5B040==><C 11 4310587 <5B040==K5 6386 4310598 <5B040==K525@A88 5 4316984 <5B040==K58AB>@8840==KE 6 4316989 <5B040==K5@538AB@0 5 4316995 <5B040==K5A?@02>G=8:0 24 4317000 <5B040==K< 277 4317024 <5B040==K<8 14 4317301 <5B040==KE 4787 4317315 <5B08=D>@<0F88 4 4322102 <5B08=D>@<0F8O 4 4322106 <5B0B8? 6 4322110 <5B0D09; 23 4322116 <5B:0 574 4322139 <5B:0ndef 45 4322713 <5B:02@5<5=8 15 4322758 <5B:02@5<5=840==KE?@>25@:8?>4?8A8 17 4322773 <5B:02@5<5=8:@8?B>3@0D88 39 4322790 <5B:02@5<5=8?>4?8A8 23 4322829 <5B:08=B5@20;0D>=0?;0=8@>2I8:0 66 4322852 <5B:0< 4 4322918 <5B:0<8 4 4322922 <5B:0M;5<5=B0H:0;K2@5<5=8 45 4322926 <5B:5 59 4322971 <5B:8 246 4323030 <5B:8ndef 9 4323276 <5B:89 470 4323285 <5B:8M;5<5=B0H:0;K2@5<5=8 35 4323755 <5B:>9 10 4323790 <5B:C 119 4323800 <5B>4 21460 4323919 <5B>4http70?@>A0=00CB5=B8D8:0F8N 13 4345379 <5B>4http70?@>A0=0?@>25@:C@57C;LB0B00CB5=B8D8:0F88 14 4345392 <5B>4httpA5@28A0 19 4345406 <5B>40 20716 4345425 <5B>40< 276 4366141 <5B>40<8 240 4366417 <5B>40E 56 4366657 <5B>45 166 4366713 <5B>48:0 4 4366879 <5B>48:C 4 4366883 <5B>48G5A:0O 113535 4366887 <5B>48G5A:89 113535 4480422 <5B>4:;0AB5@870F88 30 4593957 <5B>4=0A;54>20=8O 15 4593987 <5B>4=0A;54>20=8Oxs 20 4594002 <5B>4>2 466 4594022 <5B>4>< 793 4594488 <5B>4A60B8O 48 4595281 <5B>4A60B8Ozip 37 4595329 <5B>4A60B8OD09;00@E820 46 4595366 <5B>4A>E@0=5=8O?CB59 13 4595412 <5B>4C 314 4595425 <5B>4H8D@>20=8O 48 4595739 <5B>4H8D@>20=8Ozip 42 4595787 <5B>4H8D@>20=8OD09;00@E820 51 4595829 <5B>4K 4736 4595880 <5B>: 150 4600616 <5B@ 32 4600766 <5B@0E 32 4600798 <5B@8:03>@>40 9 4600830 <5B@8:04><8=8@>20=8O 9 4600839 <5E0=87< 748 4600848 <5E0=87<0 70 4601596 <5E0=87<0<8 5 4601666 <5E0=87<0E 56 4601671 <5E0=87<5 112 4601727 <5E0=87<>2 22 4601839 <5E0=87<>< 45 4601861 <5E0=87<C 12 4601906 <5E0=87<K 280 4601918 <5E0=8: 10 4602198 <5E0=8:0 10 4602208 <5E0=8:8 10 4602218 <8 10 4602228 <8305B 8 4602238 <830=85 4 4602246 <830=89 4 4602250 <830=L5 4 4602254 <830BL 8 4602258 <84 10 4602266 <8:@>D>= 34 4602276 <8:@>D>=0 9 4602310 <8:@>D>=>< 10 4602319 <8;8A5:C=40E 5 4602329 <8;;5@ 4 4602334 <8;;5@0 4 4602338 <8;;8<5B@ 152 4602342 <8;;8<5B@0E 152 4602494 <8;;8A5:C=4 25 4602646 <8;;8A5:C=40 230 4602671 <8;;8A5:C=40E 200 4602901 <8;;8A5:C=4K 5 4603101 <8< 128 4603106 <8= 46 4603234 <8=0 55 4603280 <8=2:;NG0NI55 9 4603335 <8=40;L=K9 5 4603344 <8=40B0 11 4603349 <8=4;8=0 9 4603360 <8=8<0;L=0O 73 4603369 <8=8<0;L=0O2KA>B0 16 4603442 <8=8<0;L=0O2KA>B0AB@>:8 13 4603458 <8=8<0;L=0O4;8=0 4 4603471 <8=8<0;L=0O4;8=0?0@>;59 57 4603475 <8=8<0;L=0O4;8=0?0@>;59?>;L7>20B5;59 36 4603532 <8=8<0;L=0O4>AB>25@=>ABL 4 4603568 <8=8<0;L=0O7=0G8<>ABL 4 4603572 <8=8<0;L=0OH8@8=0 43 4603576 <8=8<0;L=0OH8@8=07=0G5=8O3>@87>=B0;L=>9H:0;K 13 4603619 <8=8<0;L=0OH8@8=0:>;>=:8 13 4603632 <8=8<0;L=0OH8@8=0M;5<5=B0 13 4603645 <8=8<0;L=> 17 4603658 <8=8<0;L=>2:;NG0NI89D0A5B 9 4603675 <8=8<0;L=>2E>48B 11 4603684 <8=8<0;L=>3> 127 4603695 <8=8<0;L=>5 163 4603822 <8=8<0;L=>57=0G5=85 119 4603985 <8=8<0;L=>5:>;8G5AB2>A;CG052 4 4604104 <8=8<0;L=>5@0AAB>O=85 5 4604108 <8=8<0;L=>8A:;NG0NI89D0A5B 9 4604113 <8=8<0;L=>9 61 4604122 <8=8<0;L=><C 9 4604183 <8=8<0;L=CN 51 4604192 <8=8<0;L=K5 14 4604243 <8=8<0;L=K58=B5@20;K 9 4604257 <8=8<0;L=K9 606 4604266 <8=8<0;L=K98=B5@20; 4 4604872 <8=8<0;L=K9?5@8>4 12 4604876 <8=8<0;L=K9?5@8>42@5<5=8 5 4604888 <8=8<0;L=K9?5@8>470?CA:0@53;0<5=B=KE7040=891570:B82=KE?>;L7>20B5;59 47 4604893 <8=8<0;L=K9?@>F5=BA;CG052 8 4604940 <8=8<0;L=K9@07<5@70?8AK205<KE40==KE 21 4604948 <8=8<0;L=K9@07<5@?C7K@L:0 32 4604969 <8=8<0;L=K9A@>:459AB28O?0@>;59 63 4605001 <8=8<0;L=K9A@>:459AB28O?0@>;59?>;L7>20B5;59 36 4605064 <8=8<0;L=K9MDD5:B 7 4605100 <8=8<0;L=K< 18 4605107 <8=8<878@>20==>5 9 4605125 <8=8<878@>20==>< 4 4605134 <8=8<878@>20==K9 10 4605138 <8=8<878@>20BL 11 4605148 <8=8<878@C5B 5 4605159 <8=8<C< 173 4605164 <8=8<C<10 4 4605337 <8=8<C<0 47 4605341 <8=8A:;NG0NI55 9 4605388 <8=>20BL 12 4605397 <8=?5@8>42@5<5=8 4 4605409 <8=@0AAB>O=85 4 4605413 <8=CA 69 4605417 <8=CB 231 4605486 <8=CB0 573 4605717 <8=CB0< 35 4606290 <8=CB0>B=0G0;0?5@8>40 9 4606325 <8=CBC 62 4606334 <8=CBK 121 4606396 <8=CBL 231 4606517 <8=CO 12 4606748 <8@ 9 4606760 <;04H0O 5 4606769 <;04H5 14 4606774 <;04H53> 9 4606788 <;04H55 4 4606797 <;04H5<C 19 4606801 <;04H89 61 4606820 <;04H8E 10 4606881 << 74 4606891 <<5AOF3>4 6 4606965 <<< 6 4606971 <<<< 8 4606977 <=46@ 30 4606985 <=545;O<5AOF3>4 5 4607015 <=5=85 6 4607020 <=5=88 6 4607026 <=>385 11 4607032 <=>389 30 4607043 <=>38E 19 4607073 <=>3> 70 4607092 <=>3>:04@>20O 7 4607162 <=>3>:04@>2K9 12 4607169 <=>3>:04@>2KE 5 4607181 <=>3>:@0B=>< 35 4607186 <=>3>:@0B=K9 41 4607221 <=>3>:@0B=KE 6 4607262 <=>3><5@=>3> 5 4607268 <=>3><5@=K9 19 4607273 <=>3><5@=K< 5 4607292 <=>3><5@=KE 9 4607297 <=>3>>1@0785 5 4607306 <=>3>>1@0785< 5 4607311 <=>3>?>78F8>==>3> 4 4607316 <=>3>?>78F8>==K9 4 4607320 <=>3>?>;L7>20B5;LA:89 6 4607324 <=>3>?>B>:>2>9 5 4607330 <=>3>?>B>:>2K9 5 4607335 <=>3>AB@0=8G=0O 5 4607340 <=>3>AB@0=8G=K9 9 4607345 <=>3>AB@0=8G=KE 4 4607354 <=>3>AB@>G=0O 5 4607358 <=>3>AB@>G=>3> 44 4607363 <=>3>AB@>G=>5 4 4607407 <=>3>AB@>G=>9 21 4607411 <=>3>AB@>G=>< 5 4607432 <=>3>AB@>G=>ABL 58 4607437 <=>3>AB@>G=K5 6 4607495 <=>3>AB@>G=K9 127 4607501 <=>3>AB@>G=K9?>8A: 25 4607628 <=>3>AB@>G=K9@568< 126 4607653 <=>3>AB@>G=K< 4 4607779 <=>3>AB@>G=KE 13 4607783 <=>3>B>G5G=>3> 12 4607796 <=>3>B>G5G=K9 16 4607808 <=>3>B>G5G=K9>1J5:B35>3@0D8G5A:>9AE5<K 169 4607824 <=>3>B>G85 8 4607993 <=>3>B>G85< 8 4608001 <=>3>C@>2=52K9 100 4608009 <=>3>C@>2=52KE 100 4608109 <=>3>F25B=0O 8 4608209 <=>3>F25B=K9 8 4608217 <=>3>G8A;5==K9 5 4608225 <=>3>G8A;5==K< 5 4608230 <=>3>O7K:>2>9 14 4608235 <=>3>O7K:>2K9 14 4608249 <=>3>O7K:>2K< 14 4608263 <=>65AB2 5 4608277 <=>65AB20 22 4608282 <=>65AB25 5 4608304 <=>65AB25==>3> 92 4608309 <=>65AB25==>5 28 4608401 <=>65AB25==>57=0G5=85 9 4608429 <=>65AB25==>9 9 4608438 <=>65AB25==>< 19 4608447 <=>65AB25==><C 9 4608466 <=>65AB25==>AB8 4 4608475 <=>65AB25==>ABL 4 4608479 <=>65AB25==CN 5 4608483 <=>65AB25==K5 8 4608488 <=>65AB25==K9 330 4608496 <=>65AB25==K92K1>@ 77 4608826 <=>65AB25==KE 119 4608903 <=>65AB2> 46 4609022 <=>65AB2>< 5 4609068 <=>68B5;L 5 4609073 <>18;L=0O 11 4609078 <>18;L=>3> 329 4609089 <>18;L=>5 44972 4609418 <>18;L=>5?@8;>65=85:;85=B 65 4654390 <>18;L=>5?@8;>65=85A5@25@ 56 4654455 <>18;L=>9 488 4654511 <>18;L=>< 276 4654999 <>18;L=K5 18 4655275 <>18;L=K9 61324 4655293 <>18;L=K902B>=><=K9A5@25@ 56 4716617 <>18;L=K9:;85=B 72 4716673 <>18;L=K< 57 4716745 <>18;L=KE 59 4716802 <>3 5 4716861 <>3B8 4 4716866 <>3CB 2446 4716870 <>40 52 4719316 <>40;L=0O 5 4719368 <>40;L=89 5 4719373 <>40;L=> 26 4719378 <>40;L=>3> 5 4719404 <>40;L=>5 20 4719409 <>40;L=>9 5 4719429 <>40;L=>< 53 4719434 <>40;L=>AB8 12 4719487 <>40;L=>ABL 12 4719499 <>40;L=K5 29 4719511 <>40;L=K9 145 4719540 <>40;L=K9@568< 20 4719685 <>40;L=KE 31 4719705 <>45;59 48 4719736 <>45;8 582 4719784 <>45;8@0A?>7=020=8O@5G8 6 4720366 <>45;8@>20=85 24 4720372 <>45;8@>20=8O 24 4720396 <>45;8@>20BL 4 4720420 <>45;8@C5B 4 4720424 <>45;L 801 4720428 <>45;L?@>3=>70 9 4721229 <>45;L?@>3=>7045@52>@5H5=89 55 4721238 <>45;L?@>3=>70:;0AB5@870F8O 55 4721293 <>45;L?@>3=>70?>8A:00AA>F80F89 4 4721348 <>45;L?@>3=>70?>8A:0AA>F80F89 55 4721352 <>45;L?@>3=>70?>8A:?>A;54>20B5;L=>AB59 55 4721407 <>45;LA>45@68<>3> 15 4721462 <>45;LA>45@68<>3>xs 20 4721477 <>45;LN 4 4721497 <>45;O<8 24 4721501 <>45@= 11 4721525 <>48D8:0B>@ 10 4721536 <>48D8:0F88 69 4721546 <>48D8:0F8O 87 4721615 <>48D8F8@>20= 169 4721702 <>48D8F8@>20==>5 5 4721871 <>48D8F8@>20==>AB8 51 4721876 <>48D8F8@>20==>ABL 257 4721927 <>48D8F8@>20==K5 5 4722184 <>48D8F8@>20==K9 197 4722189 <>48D8F8@>20=> 5 4722386 <>48D8F8@>20=K 17 4722391 <>48D8F8@>20BL 42 4722408 <>48D8F8@>20BLAO 4 4722450 <>48D8F8@C5B 10 4722454 <>48D8F8@CNI85 4 4722464 <>48D8F8@CNI89 4 4722468 <>4C;0 908 4722472 <>4C;5 530 4723380 <>4C;59 538 4723910 <>4C;5< 9 4724448 <>4C;8 68 4724457 <>4C;L 2436 4724525 <>4C;L2=5H=53>A>548=5=8O 9 4726961 <>4C;L:><0=4K 18 4726970 <>4C;L<5=5465@0 198 4726988 <>4C;L<5=5465@07=0G5=8O 9 4727186 <>4C;L=01>@070?8A59 72 4727195 <>4C;L>1@01>B:8>H81:8 70 4727267 <>4C;L>1J5:B0 128 4727337 <>4C;L>1KG=>3>?@8;>65=8O 9 4727465 <>4C;LA50=A0 29 4727474 <>4C;LC?@02;O5<>3>?@8;>65=8O 9 4727503 <>4C;LDC=:F882>AAB0=>2;5=8O 18 4727512 <>4C;LDC=:F88?@5>1@07>20=8O 9 4727530 <>4C;N 32 4727539 <>4C;O 907 4727571 <>4C;O< 10 4728478 <>4C;OE 54 4728488 <>5A>1KB85 6 4728542 <>65< 14 4728548 <>65B 11431 4728562 <>65B5 4 4739993 <>6=> 2624 4739997 <>6=>:C?8BL 5 4742621 <>6=><5=OBL 6 4742626 <>8 19 4742632 <>8:;85=BK 5 4742651 <>9 23 4742656 <>94>4K@ 58 4742679 <>9>B45; 4 4742737 <>9A?@02>G=8: 8 4742741 <>;>:> 5 4742749 <><5=B 1540 4742754 <><5=B1 14 4744294 <><5=B2 15 4744308 <><5=B0 301 4744323 <><5=B2@5<5=8 504 4744624 <><5=B2@5<5=8ACB>G=5=85<?5@8>40 86 4745128 <><5=B>< 10 4745214 <><5=BB5:CI85A:;04A:85>AB0B:8 5 4745224 <><5=BC 136 4745229 <><5=BK 23 4745365 <>=0:> 12 4745388 <>=5B0 4 4745400 <>=5BK 4 4745404 <>=8:5@0 10 4745408 <>=8B>@ 6 4745418 <>=8B>@8=3 30 4745424 <>=8B>@8=30 30 4745454 <>=> 17 4745484 <>=>?>;L=0O 10 4745501 <>=>?>;L=89 234 4745511 <>=>?>;L=> 5 4745745 <>=>?>;L=>3> 234 4745750 <>=>?>;L=>5 10 4745984 <>=>?>;L=>< 47 4745994 <>=>?>;L=CN 11 4746041 <>=>?>;L=K5 5 4746052 <>=>?>;L=K9 348 4746057 <>=>?>;L=K9@568< 81 4746405 <>=>D>=8G5A:0O 4 4746486 <>=>D>=8G5A:89 4 4746490 <>=>E@><=0O 4 4746494 <>=>E@><=>< 5 4746498 <>=>E@><=>AB8 5 4746503 <>=>E@><=>ABL 6 4746508 <>=>E@><=K9 10 4746514 <>=>E@><=K< 5 4746524 <>=>H8@8==K9 10 4746529 <>@ 23 4746539 <>@5 27 4746562 <>@8BL 4 4746589 <>@:>28 4 4746593 <>@:>2L 5 4746597 <>@A:>9 20 4746602 <>@D>;>388 14 4746622 <>@D>;>38O 14 4746636 <>@O 4 4746650 <>A3>@B>@3 8 4746654 <>A:20 6 4746662 <>GL 13310 4746668 <>O 4 4759978 <>O3@C??0A>1KB89 5 4759982 <>O:0@B8=:0 28 4759987 <>O?@>F54C@0 5 4760015 <>O?@>F54C@02<>4C;5D>@<K 10 4760020 <>OD01@8:0 6 4760030 <>ODC=:F8O 5 4760036 <A 29 4760041 <C6A:>3> 6 4760070 <C6A:>9 27 4760076 <C7K:0 4 4760103 <C7K:8 4 4760107 <C;LB8<5480 75 4760111 <C;LB8<5489=>5 5 4760186 <C;LB8<5489=K9 5 4760191 <CB015;L=>3> 5 4760196 <CB015;L=K9 6 4760201 <CB015;L=K<8 5 4760207 <F 5 4760212 <K 169 4760217 <KBL 4 4760386 <KH8 288 4760390 <KH89 85 4760678 <KH:0 8 4760763 <KH:8 4 4760771 <KH:>9 4 4760775 <KHL 373 4760779 <KHLN 85 4761152 <O3:0O 9 4761237 <O3:0O040?B82=0O 13 4761246 <O3:89 18 4761259 <O3:8<8 4 4761277 <O3:>9 4 4761281 <O3:><C 4 4761285 <OA>@C1:0 12 4761289 <OB=K9 5 4761301 <OB=K9:@5< 11 4761306 <V9 4 4761317 = 64 4761321 =0 20065 4761385 =018@05<K9 5 4781450 =018@0BL 5 4781455 =01;N405<K9 6 4781460 =01;N405<K<8 6 4781466 =01;N405BAO 8 4781472 =01;N40;0AL 5 4781480 =01;N40BLAO 17 4781485 =01;N45=85 12 4781502 =01;N45=8O 12 4781514 =01>@ 6271 4781526 =01>@0 2015 4787797 =01>@0< 60 4789812 =01>@0<8 22 4789872 =01>@0E 25 4789894 =01>@20@80=B>2 9 4789919 =01>@40==KE70?@>A<0:5B0:><?>=>2:840==KE 105 4789928 =01>@40==KE70?@>AAE5<K:><?>=>2:840==KE 87 4790033 =01>@40==KE85@0@E88 11 4790120 =01>@40==KE8AB>G=8: 20 4790131 =01>@40==KE>1J548=5=85<0:5B0:><?>=>2:840==KE 90 4790151 =01>@40==KE>1J548=5=85AE5<K:><?>=>2:840==KE 70 4790241 =01>@40==KE>1J5:B<0:5B0:><?>=>2:840==KE 94 4790311 =01>@40==KE>1J5:BAE5<K:><?>=>2:840==KE 75 4790405 =01>@40==KE?@85<=8: 20 4790480 =01>@40==KE?@>25@:885@0@E88 14 4790500 =01>@42865=89@538AB@0 7 4790514 =01>@5 395 4790521 =01>@70:07K?>AB02I8:0< 8 4790916 =01>@70?8A59 258 4790924 =01>@70?8A594;O?@>25@:8 9 4791182 =01>@:><18=0F89 7 4791191 =01>@:>=AB0=B 50 4791198 =01>@:C@A>2 88 4791248 =01>@=><5@0 9 4791336 =01>@>2 164 4791345 =01>@>< 364 4791509 =01>@?>;591 6 4791873 =01>@?>;592 12 4791879 =01>@?>;593@C??8@>2:81 6 4791891 =01>@?>;593@C??8@>2:82 6 4791897 =01>@?><5I05<KED09;>2 7 4791903 =01>@?@02 7 4791910 =01>@A8<2>;>2 27 4791917 =01>@AE5<xml 87 4791944 =01>@C 154 4792031 =01>@C7;>2 55 4792185 =01>@F5=:>=:C@5=B>2 5 4792240 =01>@K 188 4792245 =01>@K40==KE 58 4792433 =01>@K40==KE<0:5B0:><?>=>2:840==KE 70 4792491 =01>@K40==KEAE5<K:><?>=>2:840==KE 69 4792561 =01@0==K9 15 4792630 =01@0=K 10 4792645 =01@0BL 5 4792655 =01@0BL=><5@ 18 4792660 =01V@ 620 4792678 =020E> 5 4793298 =020E>15;K9 11 4793303 =02545=85 258 4793314 =02545=88 258 4793572 =02830F88 90 4793830 =02830F8>==0O 107 4793920 =02830F8>==0OAcK;:0 6 4794027 =02830F8>==0OAAK;:0 284 4794033 =02830F8>==0OAAK;:02>AAB0=>2;5=8O?0@>;O 45 4794317 =02830F8>==0OAAK;:070?CA:0 9 4794362 =02830F8>==0OAAK;:0?><>I8 54 4794371 =02830F8>==0OAAK;:0A8AB5<K0=0;8B8:8 5 4794425 =02830F8>==0OAAK;:0B5:CI59AB@0=8FK 9 4794430 =02830F8>==0OAAK;:0B>G:8?>4:;NG5=8O 9 4794439 =02830F8>==0OAAK;:0D>@<0B8@>20==>9AB@>:8 30 4794448 =02830F8>==>9 272 4794478 =02830F8>==CN 159 4794750 =02830F8>==K5AAK;:8<>18;L=>3>?@8;>65=8O 9 4794909 =02830F8>==K9 536 4794918 =02830F8>==KE 141 4795454 =02830F8N 8 4795595 =02830F8O 108 4795603 =02@5<O2K7>20 9 4795711 =02@5<OA50=A0 9 4795720 =03;O4=89 10 4795729 =03;O4=> 10 4795739 =03;O4=>3> 10 4795749 =03;O4=>AB8 4 4795759 =03;O4=>ABL 56 4795763 =03;O4=K9 32 4795819 =03;O4=K< 16 4795851 =03@C7:0 45 4795867 =03@C7:5 11 4795912 =03@C7:8 16 4795923 =03@C7:C 13 4795939 =04 327 4795952 =0456=>3> 5 4796279 =0456=K9 5 4796284 =04> 347 4796289 =04?8A 286 4796636 =04?8A59 10 4796922 =04?8A8 286 4796932 =04?8AL 491 4797218 =04?8AL1 6 4797709 =04?8AL:0@B8=:0 9 4797715 =04?8ALN 5 4797724 =04AB@>9:0 10 4797729 =04AB@>9:8 10 4797739 =0602 9 4797749 =060; 14 4797758 =060;8 7 4797772 =060;8B8 7 4797779 =060B 8 4797786 =060B0 104 4797794 =060B0O 4 4797898 =060B8 16 4797902 =060B85 1178 4797918 =060B85< 78 4799096 =060B85=0459AB285?;0=8@>2I8:0 22 4799174 =060B85=0=02830F8>==>9AAK;:5 28 4799196 =060B85=0?5@5=5A5==><703>;>2:5H:0;K2@5<5=8 23 4799224 =060B85=0M;5<5=B587<5@5=8O 23 4799247 =060B85=0M;5<5=B5H:0;K2@5<5=8 23 4799270 =060B88 641 4799293 =060B89 104 4799934 =060B8N 58 4800038 =060B8O 122 4800096 =060B>5 4 4800218 =060B>9 55 4800222 =060B>< 12 4800277 =060BK9 176 4800289 =060BL 100 4800465 =060BL=038?5@AAK;:C2html4>:C<5=B5 10 4800565 =060BL=038?5@AAK;:C2D>@<0B8@>20==>9AB@>:5 20 4800575 =060BL=038?5@AAK;:C2D>@<0B8@>20==><4>:C<5=B5 10 4800595 =060BL=0M;5<5=BA>AB>O=8O?@>A<>B@0 10 4800605 =06<8B5 11 4800615 =0704 108 4800626 =0720= 5 4800734 =0720=85 780 4800739 =0720=854=O=545;8 6 4801519 =0720=85< 262 4801525 =0720=85<5AB>?>;>65=8O 4 4801787 =0720=85<5AOF0 6 4801791 =0720=88 4 4801797 =0720=89 5 4801801 =0720=8N 6 4801806 =0720=8O 281 4801812 =0720=8O<8 4 4802093 =0720==K9 5 4802097 =0720=L5 5 4802102 =0720B8 5 4802107 =0720BL 5 4802112 =07=0G05<>3> 25 4802117 =07=0G05<K9 39 4802142 =07=0G05<K< 10 4802181 =07=0G05B 10 4802191 =07=0G05BAO 24 4802201 =07=0G0BL 66 4802225 =07=0G0BLAO 49 4802291 =07=0G0NBAO 5 4802340 =07=0G5= 158 4802345 =07=0G5=0 69 4802503 =07=0G5=85 641 4802572 =07=0G5=852K1>@0 25 4803213 =07=0G5=852K1>@0?>;L7>20B5;59A8AB5<K2708<>459AB28O 40 4803238 =07=0G5=85< 4 4803278 =07=0G5=85@0AH8@5=8O:>=D83C@0F88 44 4803282 =07=0G5=85B8?0 37 4803326 =07=0G5=85B8?0xml 62 4803363 =07=0G5=88 25 4803425 =07=0G5=89 6 4803450 =07=0G5=8O 325 4803456 =07=0G5=8O8A?>;L7>20=8O 18 4803781 =07=0G5==0O 4 4803799 =07=0G5==>3> 75 4803803 =07=0G5==>< 5 4803878 =07=0G5==K9 394 4803883 =07=0G5==KE 4 4804277 =07=0G5=> 70 4804281 =07=0G5=K 57 4804351 =07=0G5=L5 6 4804408 =07=0G8< 10 4804414 =07=0G8B8 171 4804424 =07=0G8BL 54 4804595 =07>25< 5 4804649 =07K205<0O 8 4804654 =07K205<K5 6 4804662 =07K205<K9 54 4804668 =07K205<KE 35 4804722 =07K205BAO 42 4804757 =07K20;8AL 6 4804799 =07K20BL 10 4804805 =07K20BLAO 63 4804815 =07K20NBAO 23 4804878 =081>;55 164 4804901 =081>;LH55 10 4805065 =081>;LH59 10 4805075 =081>;LH89 49 4805085 =081>;LH8< 5 4805134 =081>;LH8<8 5 4805139 =082KAH0O 10 4805144 =082KAH89 15 4805154 =08;CGH89 4 4805169 =08<5=55 38 4805173 =08<5=>20=85 1963 4805211 =08<5=>20=851 6 4807174 =08<5=>20=852;>65=8O 14 4807180 =08<5=>20=854;O?5G0B8 15 4807194 =08<5=>20=857040G8 11 4807209 =08<5=>20=85:>;>=:8 19 4807220 =08<5=>20=85< 65 4807239 =08<5=>20=85>1;0AB8 6 4807304 =08<5=>20=85?>;O 6 4807310 =08<5=>20=85?@020 6 4807316 =08<5=>20=85?@8;>65=8O 5 4807322 =08<5=>20=85@>48B5;O 4 4807327 =08<5=>20=85A>548=5=8O 5 4807331 =08<5=>20=85B01;8FK 4 4807336 =08<5=>20=85M;5<5=B0 6 4807340 =08<5=>20=88 30 4807346 =08<5=>20=89 34 4807376 =08<5=>20=8N 48 4807410 =08<5=>20=8O 426 4807458 =08<5=>20=8O< 4 4807884 =08<5=>20=8O<8 33 4807888 =08<5=>20=L5 34 4807921 =08<5=LH0O 10 4807955 =08<5=LH59 8 4807965 =08<5=LH89 23 4807973 =08<5=LH8< 5 4807996 =0945< 5 4808001 =0945= 1831 4808006 =0945=0 588 4809837 =0945==0O 55 4810425 =0945==0OAAK;:0 26 4810480 =0945==0OAB@>:0 29 4810506 =0945==>3> 57 4810535 =0945==>5 26 4810592 =0945==>57=0G5=85 32 4810618 =0945==>9 23 4810650 =0945==>< 5 4810673 =0945==><C 4 4810678 =0945==CN 27 4810682 =0945==K5 67 4810709 =0945==K540==K5 7 4810776 =0945==K5AB@>:8 16 4810783 =0945==K5D09;K 11 4810799 =0945==K9 3479 4810810 =0945==K9M;5<5=B 7 4814289 =0945==K< 5 4814296 =0945==K<8 5 4814301 =0945==KE 125 4814306 =0945=> 674 4814431 =0945=K 113 4815105 =0945B 27 4815218 =09B8 2463 4815245 =09B8uri?@>AB@0=AB208<5= 150 4817708 =09B8245@525 12 4817858 =09B825745 9 4817870 =09B82A>45@60=88 12 4817879 =09B82A?8A:5 12 4817891 =09B870?8A8 24 4817903 =09B87=0G5=85 15 4817927 =09B87=0G5=85?0@0<5B@0 196 4817942 =09B87=0G5=85?>845=B8D8:0B>@C 10 4818138 =09B88=B5@20;?>845=B8D8:0B>@C 10 4818148 =09B8:0;5=40@8 11 4818158 =09B8:;NG52>9:>=B59=5@ 10 4818169 =09B8:;NG52>9:>=B59=5@0A8=E 10 4818179 =09B8:=>?:C?>C<>;G0=8N 10 4818189 =09B8:>=B0:BK 12 4818199 =09B8=54>?CAB8<K5A8<2>;Kxml 21 4818211 =09B8>1J5:B 124 4818232 =09B8>1J5:BK 110 4818356 =09B8>:=>?>=02830F8>==>9AAK;:5 11 4818466 =09B8?0@0<5B@ 28 4818477 =09B8?0@0<5B@K 20 4818505 =09B8?>2K@065=8N 20 4818525 =09B8?>7=0G5=8N 43 4818545 =09B8?>845=B8D8:0B>@C 62 4818588 =09B8?>87<5=5==><CA>AB02C40==KE 12 4818650 =09B8?>87<5=5==><CA>AB02C8=45:A>2 12 4818662 =09B8?>8<5=8 71 4818674 =09B8?>8<5=8:>;>=:8 10 4818745 =09B8?>8A?>;L7C5<><CA>AB02C40==KE 12 4818755 =09B8?>8A?>;L7C5<><CA>AB02C8=45:A>2 12 4818767 =09B8?>:;NGC 37 4818779 =09B8?>:>4C 144 4818816 =09B8?>;5 22 4818960 =09B8?><5G5==K5=0C40;5=85 25 4818982 =09B8?>=08<5=>20=8N 133 4819007 =09B8?>=><5@C 88 4819140 =09B8?>>B?5G0B:C 18 4819228 =09B8?>>B?5G0B:C0A8=E 18 4819246 =09B8?>?>;=><C8<5=8 17 4819264 =09B8?>?>;N 34 4819281 =09B8?>?A524>=8<C 19 4819315 =09B8?>@0A?>;>65=8N 14 4819334 =09B8?>@5:2878BC 104 4819348 =09B8?>A5@89=><C=><5@C 18 4819452 =09B8?>A5@89=><C=><5@C0A8=E 18 4819470 =09B8?>AAK;:0< 13 4819488 =09B8?>AC1J5:BC 18 4819501 =09B8?>AC1J5:BC0A8=E 18 4819519 =09B8?>B8?C 18 4819537 =09B8?>C=8:0;L=><C845=B8D8:0B>@C 54 4819555 =09B8?>D8;LB@C 10 4819609 =09B8?@54>?@545;5==>5 18 4819619 =09B8?@54>?@545;5==K9 10 4819637 =09B8?@54K4CI89 12 4819647 =09B8?@5D8:A 170 4819659 =09B8A;54CNI89 26 4819829 =09B8A>1KB8O 10 4819855 =09B8AB@>:8 115 4819865 =09B8AL 13 4819980 =09B8B5:AB 27 4819993 =09B8D09;K 52 4820020 =09B8D09;K0A8=E 28 4820072 =0:0?;8205BAO 8 4820100 =0:0?;820BL 58 4820108 =0:0?;820BLAO 42 4820166 =0:0?;820NBAO 34 4820208 =0:;04=0O 246 4820242 =0:;04=>9 246 4820488 =0:;04=K9 246 4820734 =0:;04=KE 35 4820980 =0:;04K205<K5 5 4821015 =0:;04K205<K9 5 4821020 =0:;04K205B 35 4821025 =0:;04K205BAO 29 4821060 =0:;04K20BL 45 4821089 =0:;04K20BLAO 34 4821134 =0:;04K20NBAO 5 4821168 =0:;59:0 30 4821173 =0:;59:8 20 4821203 =0:;59:C 9 4821223 =0:;85=B5 163 4821232 =0:;85=B5=0A5@25@5 8 4821395 =0:;85=B5=0A5@25@5157:>=B5:AB0 7 4821403 =0:;>= 27 4821410 =0:;>=0 26 4821437 =0:;>==0O 34 4821463 =0:;>==>3> 12 4821497 =0:;>==K9 56 4821509 =0:;>==K<8 4 4821565 =0:>?8B5;5 4 4821569 =0:>?8B5;L 4 4821573 =0:>?;5=85 1430 4821577 =0:>?;5=85< 71 4823007 =0:>?;5=89 11 4823078 =0:>?;5=8O 1347 4823089 =0:>?;5==0O 5 4824436 =0:>?;5==0O>B=>A8B5;L=0OG0AB>B0 4 4824441 =0:>?;5==0OG0AB>B0 4 4824445 =0:>?;5==CN 4 4824449 =0:>?;5==K5 26 4824453 =0:>?;5==K9 52 4824479 =0:>?;5==KE 13 4824531 =0:>?;5=K 4 4824544 =0:>?;5=L5 11 4824548 =0;0305<>5 15 4824559 =0;0305<K9 20 4824574 =0;0305BAO 12 4824594 =0;030BL 5 4824606 =0;030BLAO 12 4824611 =0;52> 39 4824623 =0;8G85 1619 4824662 =0;8G852K1>@0CM;5<5=B0 12 4826281 =0;8G85< 5 4826293 =0;8G85>B1>@0CM;5<5=B0 12 4826298 =0;8G85?0@0<5B@>22K2>40CM;5<5=B0 12 4826310 =0;8G85?>@O4:0CM;5<5=B0 12 4826322 =0;8G85CA;>2=>3>>D>@<;5=8OCM;5<5=B0 12 4826334 =0;8G88 267 4826346 =0;8G8N 8 4826613 =0;8G8O 410 4826621 =0;8G=>ABL 5 4827031 =0;>3 5 4827036 =0;>3>2 5 4827041 =0;>3>20OAB02:0 7 4827046 =0;>65=0 6 4827053 =0;>65==K9 21 4827059 =0;>65=> 10 4827080 =0;>65=K 5 4827090 =0;>68B8 4 4827095 =0;>68BL 4 4827099 =0< 12 4827103 =0<8 9 4827115 =0<818O 16 4827124 =0<=>3> 4 4827140 =0=5A5=85 12 4827144 =0=5A5=8O 12 4827156 =0=>A8BAO 12 4827168 =0=>A8BLAO 12 4827180 =0>1>@>B 46 4827192 =0?5@5A5G5=88 9 4827238 =0?5G0B0= 5 4827247 =0?5G0B0==K9 10 4827252 =0?5G0B0BL 98 4827262 =0?8A0=85 58 4827360 =0?8A0=88 13 4827418 =0?8A0=8O 28 4827431 =0?8A0==K5 4 4827459 =0?8A0==K9 9 4827463 =0?8A0==KE 5 4827472 =0?8A0BL 16 4827477 =0?>;=5= 10 4827493 =0?>;=5=85 29 4827503 =0?>;=5=85< 4 4827532 =0?>;=5=8O 20 4827536 =0?>;=5==>5 5 4827556 =0?>;=5==K9 16 4827561 =0?>;=5=> 5 4827577 =0?>;=O5BAO 5 4827582 =0?>;=OBL 8 4827587 =0?>;=OBLAO 5 4827595 =0?>;>28=C 5 4827600 =0?><8=0=85 37 4827605 =0?><8=0=89 4 4827642 =0?><8=0=8O 35 4827646 =0?><8=0=L5 4 4827681 =0?><8=0BL 4 4827685 =0?@ 6 4827689 =0?@028B8 8 4827695 =0?@028BL 10 4827703 =0?@02;5= 4 4827713 =0?@02;5=85 428 4827717 =0?@02;5=85< 25 4828145 =0?@02;5=85?0@0<5B@0 13 4828170 =0?@02;5=85?5@540G8 42 4828183 =0?@02;5=85?5@5E>40 15 4828225 =0?@02;5=85?5@5E>40:AB@>:5 19 4828240 =0?@02;5=85?>8A:0 33 4828259 =0?@02;5=85?>@O4:0AE5<K70?@>A0 29 4828292 =0?@02;5=85A>>1I5=8O 9 4828321 =0?@02;5=85A>>1I5=8O:0=0;0A5@28A08=B53@0F88 19 4828330 =0?@02;5=85A>@B8@>2:8 68 4828349 =0?@02;5=85A>@B8@>2:8:><?>=>2:840==KE 25 4828417 =0?@02;5=85B5:AB0 27 4828442 =0?@02;5=88 68 4828469 =0?@02;5=89 4 4828537 =0?@02;5=8O 37 4828541 =0?@02;5==>AB8 4 4828578 =0?@02;5==>ABL 4 4828582 =0?@02;5==K9 10 4828586 =0?@02;5=> 4 4828596 =0?@02;5=K 15 4828600 =0?@02;5=L5 4 4828615 =0?@02;O5BAO 8 4828619 =0?@02;OBLAO 8 4828627 =0?@02> 73 4828635 =0?@8<5@ 3323 4828708 =0?@O<CN 36 4832031 =0@02=5 10 4832067 =0@0I5=85 7 4832077 =0@CH5=0 6 4832084 =0@CH5=85 19 4832090 =0@CH5=85?@024>ABC?0 13 4832109 =0@CH5=8O 9 4832122 =0@CH5==>3> 36 4832131 =0@CH5==K9 42 4832167 =0@O4 5 4832209 =0@O4C 5 4832214 =0A 12 4832219 =0A5;5==>3> 4 4832231 =0A5;5==K9 4 4832235 =0A5@25@ 4 4832239 =0A5@25@5 283 4832243 =0A5@25@5157:>=B5:AB0 12 4832526 =0A:>;L:> 4 4832538 =0A;0BL 22 4832542 =0A;54>20=85 60 4832564 =0A;54>20=8O 52 4832624 =0A;54>20BL 4 4832676 =0A;54CNB 4 4832680 =0A;54CNI59AB@>:5 9 4832684 =0AB>5: 10 4832693 =0AB>9:0 10 4832703 =0AB>;L:> 5 4832713 =0AB>OB5;L=> 10 4832718 =0AB>OB5;L=K9 10 4832728 =0AB>OI53> 5 4832738 =0AB>OI55 9 4832743 =0AB>OI59 6 4832752 =0AB>OI89 63 4832758 =0AB@08205<>3> 19 4832821 =0AB@08205<K5 4 4832840 =0AB@08205<K9 34 4832844 =0AB@08205<K< 5 4832878 =0AB@08205B 22 4832883 =0AB@08205BAO 79 4832905 =0AB@0820BL 30 4832984 =0AB@0820BLAO 83 4833014 =0AB@0820NBAO 4 4833097 =0AB@>5: 2553 4833101 =0AB@>5= 14 4835654 =0AB@>5==>3> 13 4835668 =0AB@>5==K5 34 4835681 =0AB@>5==K9 85 4835715 =0AB@>5==KE 5 4835800 =0AB@>5=> 15 4835805 =0AB@>5=K 8 4835820 =0AB@>8BL 78 4835828 =0AB@>8BL@0AH8D@>2:C 23 4835906 =0AB@>8BLA?8A>: 12 4835929 =0AB@>9:0 5762 4835941 =0AB@>9:00:B82=0 11 4841703 =0AB@>9:02B>@>3>D0:B>@00CB5=B8D8:0F88 19 4841714 =0AB@>9:02E>4=>9:>;>=:8<>45;8?@>3=>70 40 4841733 =0AB@>9:02E>4=KE:>;>=>: 43 4841773 =0AB@>9:02E>4=KE:>;>=>:<>45;8?@>3=>70 53 4841816 =0AB@>9:0:>;>=>: 86 4841869 =0AB@>9:0:>;>=>:0=0;87040==KE 52 4841955 =0AB@>9:0< 239 4842007 =0AB@>9:0<8 167 4842246 =0AB@>9:0=0AB@>9:8>D>@<;5=8O 86 4842413 =0AB@>9:0>1;0AB8>D>@<;5=8O 76 4842499 =0AB@>9:0>B1>@0 267 4842575 =0AB@>9:0>B1>@0AB@>: 55 4842842 =0AB@>9:0>B>1@065=8O4803@0<< 16 4842897 =0AB@>9:0>D>@<;5=8O 29 4842913 =0AB@>9:0?0@0<5B@>2 13 4842942 =0AB@>9:0?0@0<5B@>20=0;87040==KE 52 4842955 =0AB@>9:0?5@8>40 193 4843007 =0AB@>9:0?>@O4:0 237 4843200 =0AB@>9:0A5@28A0 69 4843437 =0AB@>9:0A?8A:0 12 4843506 =0AB@>9:0CA;>2=>3>>D>@<;5=8O 71 4843518 =0AB@>9:0E 387 4843589 =0AB@>9:5 102 4843976 =0AB@>9:8 2363 4844078 =0AB@>9:802B><0B8G5A:>3>A>E@0=5=8O0CB5=B8D8:0F88 34 4846441 =0AB@>9:802B><0B8G5A:>3>A>E@0=5=8O?0@0<5B@>20CB5=B8D8:0F88 25 4846475 =0AB@>9:80CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 105 4846500 =0AB@>9:81;>:8@>2:80CB5=B8D8:0F88?>;L7>20B5;598=D>@<0F8>==>9107K 30 4846605 =0AB@>9:82;>65==>3>>1J5:B0:><?>=>2:840==KE 230 4846635 =0AB@>9:82=5H=59:><?>=5=BK 13 4846865 =0AB@>9:82>AAB0=>2;5=8O?0@>;O 121 4846878 =0AB@>9:82B>@>3>D0:B>@00CB5=B8D8:0F88 9 4846999 =0AB@>9:88=B5@D59A0:;85=BA:>3>?@8;>65=8O 33 4847008 =0AB@>9:88AB>@882K1>@0 11 4847041 =0AB@>9:88AB>@8840==KE 37 4847052 =0AB@>9:8:;85=BA:>3>?@8;>65=8O 56 4847089 =0AB@>9:8:><0=4=>3>8=B5@D59A0 35 4847145 =0AB@>9:8:><?>=>2:840==KE 446 4847180 =0AB@>9:8:>?89107K40==KE 6 4847626 =0AB@>9:8<>48D8F8@>20=K 9 4847632 =0AB@>9:8=0G0;L=>9AB@0=8FK 33 4847641 =0AB@>9:8>1@01>B:8>H81>: 165 4847674 =0AB@>9:8>1@01>B:8>H81>:?@870?CA:5 33 4847839 =0AB@>9:8>:=0 11 4847872 =0AB@>9:8>:=0251:;85=B0 7 4847883 =0AB@>9:8>:=0<>18;L=>3>:;85=B0 12 4847890 =0AB@>9:8>:=0<>18;L=>9?;0BD>@<K 12 4847902 =0AB@>9:8>:=0B>=:>3>:;85=B0 18 4847914 =0AB@>9:8>B>1@065=8O48=0<8G5A:8EA?8A:>2 8 4847932 =0AB@>9:8>B>1@065=8O48=0<8G5A:>3>A?8A:0 23 4847940 =0AB@>9:8>BG5B0 12 4847963 =0AB@>9:8?5G0B8 17 4847975 =0AB@>9:8?5G0B8?>;Ohtml4>:C<5=B0 7 4847992 =0AB@>9:8?5G0B8B01;8G=>3>4>:C<5=B0 14 4847999 =0AB@>9:8?;0=>2284>2@0AG5B>2 6 4848013 =0AB@>9:8?;0=>2284>2E0@0:B5@8AB8: 6 4848019 =0AB@>9:8?;0=>2AG5B>2 6 4848025 =0AB@>9:8?>AB@>8B5;O 4 4848031 =0AB@>9:8?>AB@>8B5;O>BG5B0 17 4848035 =0AB@>9:8?>C<>;G0=8N 11 4848052 =0AB@>9:8?@>25@:8 6 4848063 =0AB@>9:8?@>25@:8@0A:@KB8O?0@>;O 51 4848069 =0AB@>9:8@0A?>7=020=8O@5G8 6 4848120 =0AB@>9:8@568<003@530B>2@538AB@>2=0:>?;5=8O 6 4848126 =0AB@>9:8A5@28A08=B53@0F88 40 4848132 =0AB@>9:8A5@80;870F88 6 4848172 =0AB@>9:8A5@80;870F88json 31 4848178 =0AB@>9:8A>AB0208=B5@D59A0:;85=BA:>3>?@8;>65=8O 39 4848209 =0AB@>9:8A?8A:003@530B>2 6 4848248 =0AB@>9:8A?@02:8 12 4848254 =0AB@>9:8A?@02>G=8:>2 6 4848266 =0AB@>9:8A@02=5=8O 12 4848272 =0AB@>9:8AB0=40@B=>3>8=B5@D59A0odata 6 4848284 =0AB@>9:8B01;8FK48=0<8G5A:>3>A?8A:0 48 4848290 =0AB@>9:8D>@<K 21 4848338 =0AB@>9:8E@0=5=8O8B>3>2@538AB@01CE30;B5@88 6 4848359 =0AB@>9:8E@0=5=8O8B>3>2@538AB@0=0:>?;5=8O 6 4848365 =0AB@>9:8E@0=5=8O8B>3>2@538AB@0A2545=89 6 4848371 =0AB@>9:8E@0=5=8O8B>3>2@538AB@>21CE30;B5@88 6 4848377 =0AB@>9:8E@0=5=8O8B>3>2@538AB@>2=0:>?;5=8O 6 4848383 =0AB@>9:8M;5<5=B0 12 4848389 =0AB@>9:>9 88 4848401 =0AB@>9:C 406 4848489 =0ABC?8; 10 4848895 =0ABC?8BL 10 4848905 =0ABC?;5=85 8 4848915 =0ABC?;5=88 4 4848923 =0ABC?;5=8O 4 4848927 =0AKI5==> 10 4848931 =0AKI5==>=515A=>3>;C1>9 11 4848941 =0AKI5==>@>7>2K9 11 4848952 =0AKI5==K9 10 4848963 =0BC@0;L=89 10 4848973 =0BC@0;L=>3> 10 4848983 =0BC@0;L=K5 10 4848993 =0BC@0;L=K9 30 4849003 =0BO65=85 28 4849033 =0BO65=85A3;06820=8O 32 4849061 =0BO65=8O 4 4849093 =0E>48;0AL 5 4849097 =0E>48;>AL 4 4849102 =0E>48B 47 4849106 =0E>48B8AO 152 4849153 =0E>48BAO 568 4849305 =0E>48BL 47 4849873 =0E>48BLAO 788 4849920 =0E>4OBAO 54 4850708 =0E>4OI0OAO 15 4850762 =0E>4OI53>AO 25 4850777 =0E>4OI55AO 6 4850802 =0E>4OI59AO 38 4850808 =0E>4OI85AO 50 4850846 =0E>4OI89AO 248 4850896 =0E>4OI8<8AO 5 4851144 =0E>4OI8EAO 94 4851149 =0E>4OICNAO 4 4851243 =0E>645=85 15 4851247 =0E>645=8O 15 4851262 =0F5=:0 18 4851277 =0F5=:8 6 4851295 =0F5=:C 5 4851301 =0F8>=0;L=K9 83 4851306 =0F8>=0;L=K< 6 4851389 =0F8>=0;L=K<8 6 4851395 =0F8>=0;L=KE 75 4851401 =0G02H53> 4 4851476 =0G02H85AO 4 4851480 =0G02H89AO 4 4851484 =0G0; 9 4851488 =0G0;0 1590 4851497 =0G0;5 294 4853087 =0G0;> 3753 4853381 =0G0;>20@80=B 23 4857134 =0G0;>25@E 18 4857157 =0G0;>2E>4OI53> 9 4857175 =0G0;>2K1>@0 53 4857184 =0G0;>2K1>@087A?8A:0 40 4857237 =0G0;>3>40 24 4857277 =0G0;>3@C??K=5>1O70B5;L=KEA>548=5=89 9 4857301 =0G0;>45:04K 6 4857310 =0G0;>4=O 41 4857316 =0G0;>8:>=5F 36 4857357 =0G0;>8=B5@20;0 24 4857393 =0G0;>8AE>4OI53> 9 4857417 =0G0;>:20@B0;0 18 4857426 =0G0;>:>;>=:8 44 4857444 =0G0;>:>=5F 9 4857488 =0G0;>;52> 18 4857497 =0G0;>< 218 4857515 =0G0;><0AA820 13 4857733 =0G0;><0AHB01=>3>480?07>=0 9 4857746 =0G0;><5AOF0 39 4857755 =0G0;><8=CBK 18 4857794 =0G0;>=0G0;> 9 4857812 =0G0;>=545;8 18 4857821 =0G0;>=>2>3>D>@<0B0AB@>: 9 4857839 =0G0;>>1;0AB8>B>1@065=8O 13 4857848 =0G0;>>1J5:B0 13 4857861 =0G0;>?5@5B0A:820=8O 119 4857874 =0G0;>?5@8>40 104 4857993 =0G0;>?5@8>404>?>;=5=8O 9 4858097 =0G0;>?5@8>40>B>1@065=8O 29 4858106 =0G0;>?>;=>3>8=B5@20;0 18 4858135 =0G0;>?>;C3>48O 6 4858153 =0G0;>?@>H;>3>3>40 9 4858159 =0G0;>?@>H;>3>4=O 9 4858168 =0G0;>?@>H;>3>:20@B0;0 9 4858177 =0G0;>?@>H;>3><5AOF0 9 4858186 =0G0;>?@>H;>3>?>;C3>48O 9 4858195 =0G0;>?@>H;>945:04K 9 4858204 =0G0;>?@>H;>9=545;8 9 4858213 =0G0;>A50=A0 18 4858222 =0G0;>A50=A0>A=>2=>3>A5@25@0 6 4858240 =0G0;>A83=0;02E>4OI53> 9 4858246 =0G0;>A;54CNI53>3>40 9 4858255 =0G0;>A;54CNI53>4=O 9 4858264 =0G0;>A;54CNI53>:20@B0;0 9 4858273 =0G0;>A;54CNI53><5AOF0 9 4858282 =0G0;>A;54CNI53>?>;C3>48O 9 4858291 =0G0;>A;54CNI5945:04K 9 4858300 =0G0;>A;54CNI59=545;8 9 4858309 =0G0;>A>548=5=8O 13 4858318 =0G0;>AB>;5B8O 6 4858331 =0G0;>AB>;5B8OA50=A0 11 4858337 =0G0;>AB>@>=0 23 4858348 =0G0;>AB@0=8FK 11 4858371 =0G0;>AB@>:8 44 4858382 =0G0;>AL 4 4858426 =0G0;>G0A0 18 4858430 =0G0;>M;5<5=B 18 4858448 =0G0;>M;5<5=B0 164 4858466 =0G0;>MB>3>3>40 9 4858630 =0G0;>MB>3>4=O 9 4858639 =0G0;>MB>3>:20@B0;0 9 4858648 =0G0;>MB>3><5AOF0 9 4858657 =0G0;>MB>3>?>;C3>48O 9 4858666 =0G0;>MB>945:04K 9 4858675 =0G0;>MB>9=545;8 9 4858684 =0G0;C 255 4858693 =0G0;L=0O 143 4858948 =0G0;L=0O5<:>ABL 5 4859091 =0G0;L=0O?>78F8O 115 4859096 =0G0;L=0OAB@0=8F0 48 4859211 =0G0;L=0OAB@>:0 12 4859259 =0G0;L=>3> 154 4859271 =0G0;L=>5 175 4859425 =0G0;L=>52K@065=85 20 4859600 =0G0;L=>57=0G5=85 21 4859620 =0G0;L=>57=0G5=852K1>@0 81 4859641 =0G0;L=>58<OD09;0 6 4859722 =0G0;L=>5>B>1@065=8545@520 50 4859728 =0G0;L=>5>B>1@065=85A?8A:0 45 4859778 =0G0;L=>5G8A;> 5 4859823 =0G0;L=>9 188 4859828 =0G0;L=><C 20 4860016 =0G0;L=CN 54 4860036 =0G0;L=K5 14 4860090 =0G0;L=K9 1045 4860104 =0G0;L=K9=><5@ 7 4861149 =0G0;L=K9>AB0B>: 43 4861156 =0G0;L=K9>AB0B>:4B 39 4861199 =0G0;L=K9>AB0B>::B 40 4861238 =0G0;L=K9@0725@=CBK9>AB0B>:4B 22 4861278 =0G0;L=K9@0725@=CBK9>AB0B>::B 22 4861300 =0G0;L=K9C3>; 32 4861322 =0G0;L=K9C3>;87<5@8B5;L=>94803@0<<K 13 4861354 =0G0;L=K< 22 4861367 =0G0;L=KE 11 4861389 =0G0B 10 4861400 =0G0B0 21 4861410 =0G0B8 3113 4861431 =0G0B> 10 4864544 =0G0B>3> 8 4864554 =0G0BCN 10 4864562 =0G0BK5 4 4864572 =0G0BK9 73 4864576 =0G0BKE 10 4864649 =0G0BL 3183 4864659 =0G0BL02B>3@C??8@>2:C:>;>=>: 25 4867842 =0G0BL02B>3@C??8@>2:CAB@>: 28 4867867 =0G0BL2845>:>=D5@5=F8N 27 4867895 =0G0BL2>AAB0=>2;5=85872K3@C7:840==KE 14 4867922 =0G0BL2>AAB0=>2;5=85872K3@C7:840==KE0A8=E 14 4867936 =0G0BL2K2>4 34 4867950 =0G0BL2K3@C7:C 27 4867984 =0G0BL2K7>2 14 4868011 =0G0BL3@C??C:>;>=>: 21 4868025 =0G0BL3@C??CAB@>: 29 4868046 =0G0BL4>102;5=85 19 4868075 =0G0BL4>102;5=850@E82=>9<5B:82@5<5=8 11 4868094 =0G0BL703@C7:C2845>>1JO2;5=8OA2>7=03@0645=85< 19 4868105 =0G0BL703@C7:C?>;=>M:@0==>9@5:;0<K 18 4868124 =0G0BL703@C7:C@5:;0<=>3>10==5@0 18 4868142 =0G0BL70:@KB85 151 4868160 =0G0BL70?8AL 276 4868311 =0G0BL70?8AL109B0 18 4868587 =0G0BL70?8AL1CD5@042>8G=KE40==KE 21 4868605 =0G0BL70?8AL2;>65=89 24 4868626 =0G0BL70?8AL6C@=0;0459AB289?>;L7>20B5;O 10 4868650 =0G0BL70?8AL>B>1@0605<>3>>1J5:B0 18 4868660 =0G0BL70?8AL?>4?8A8 18 4868678 =0G0BL70?8ALA8<2>;>2 20 4868696 =0G0BL70?8ALA@07C 5 4868716 =0G0BL70?8ALAB@>:8 20 4868721 =0G0BL70?8ALC40;5=8O2;>65=89 18 4868741 =0G0BL70?8ALD09;04;O?5G0B8 19 4868759 =0G0BL70?8ALF5;>3>16 18 4868778 =0G0BL70?8ALF5;>3>32 18 4868796 =0G0BL70?8ALF5;>3>64 18 4868814 =0G0BL70?@>A@07@5H5=8O?>;L7>20B5;O 26 4868832 =0G0BL70?CA:?@8;>65=8O 28 4868858 =0G0BL8=8F80;870F8N 71 4868886 =0G0BL:>?8@>20=852 72 4868957 =0G0BL:>?8@>20=85D09;0 28 4869029 =0G0BL>1=>2;5=85A?8A:>2>B7K20A5@B8D8:0B>2 20 4869057 =0G0BL>B:;NG5=85 10 4869077 =0G0BL>B:;NG5=85>1@01>BG8:0=>2KEA>>1I5=89 16 4869087 =0G0BL>B:@KB85 72 4869103 =0G0BL>B:@KB854;O4>?8AK20=8O 28 4869175 =0G0BL>B:@KB854;O70?8A8 28 4869203 =0G0BL>B:@KB854;OGB5=8O 28 4869231 =0G0BL>B:@KB85?>B>:04;OGB5=8O 18 4869259 =0G0BL>B<5=C@538AB@0F888=D>@<0F8>==>9107K 18 4869277 =0G0BL?5@5<5I5=85D09;0 28 4869295 =0G0BL?5@5E>4 60 4869323 =0G0BL?>4:;NG5=85 10 4869383 =0G0BL?>4:;NG5=852=5H=59:><?>=5=BK 27 4869393 =0G0BL?>4:;NG5=85>1@01>BG8:0=>2KEA>>1I5=89 26 4869420 =0G0BL?>4:;NG5=85@0AH8@5=8O?>;CG5=8O8=D>@<0F88>:><?LNB5@5 11 4869446 =0G0BL?>4:;NG5=85@0AH8@5=8O@01>BKA:@8?B>3@0D859 29 4869457 =0G0BL?>4:;NG5=85@0AH8@5=8O@01>BKAD09;0<8 29 4869486 =0G0BL?>4?8AK20=85 22 4869515 =0G0BL?>8A: 11 4869537 =0G0BL?>8A:?>>B?5G0B:C 18 4869548 =0G0BL?>8A:?>A5@89=><C=><5@C 18 4869566 =0G0BL?>8A:?>AC1J5:BC 18 4869584 =0G0BL?>8A:D09;>2 28 4869602 =0G0BL?>;CG5=85 14 4869630 =0G0BL?>;CG5=851CD5@042>8G=KE40==KE 18 4869644 =0G0BL?>;CG5=852;>65=89 18 4869662 =0G0BL?>;CG5=852@5<5=887<5=5=8O 20 4869680 =0G0BL?>;CG5=852A5E 18 4869700 =0G0BL?>;CG5=8540==KE 15 4869718 =0G0BL?>;CG5=8542>8G=KE40==KE 26 4869733 =0G0BL?>;CG5=858=D>@<0F88<>4C;O:@8?B>3@0D88 38 4869759 =0G0BL?>;CG5=858=D>@<0F88>A5B52KE040?B5@0E 16 4869797 =0G0BL?>;CG5=85:0@B8=:8?@54AB02;5=8OD09;0181;8>B5:8<>18;L=>3>CAB@>9AB20 18 4869813 =0G0BL?>;CG5=85:0B0;>30181;8>B5:8<>18;L=>3>CAB@>9AB20 11 4869831 =0G0BL?>;CG5=85:0B0;>302@5<5==KED09;>2 21 4869842 =0G0BL?>;CG5=85:0B0;>304>:C<5=B>2 23 4869863 =0G0BL?>;CG5=85:>=B59=5@0?>4?8A59:@8?B>3@0D88 14 4869886 =0G0BL?>;CG5=85=52848<>AB8 18 4869900 =0G0BL?>;CG5=85>1AC645=8O 15 4869918 =0G0BL?>;CG5=85>?8A0=8O?>4?8A59 18 4869933 =0G0BL?>;CG5=85@01>G53>:0B0;>3040==KE?>;L7>20B5;O 21 4869951 =0G0BL?>;CG5=85@07<5@0 72 4869972 =0G0BL?>;CG5=85A5@B8D8:0B>287?>4?8A8 19 4870044 =0G0BL?>;CG5=85B>;L:>GB5=8O 18 4870063 =0G0BL?>;CG5=85C=825@A0;L=>3>2@5<5=887<5=5=8O 18 4870081 =0G0BL?>;CG5=85D09;0AA5@25@0 33 4870099 =0G0BL?>;CG5=85D09;>2 34 4870132 =0G0BL?>;CG5=85D09;>2AA5@25@0 57 4870166 =0G0BL?>;CG5=85E@0=8;8I0A5@B8D8:0B>2 19 4870223 =0G0BL?><5I5=8540==KE 15 4870242 =0G0BL?><5I5=85D09;0 31 4870257 =0G0BL?><5I5=85D09;0=0A5@25@ 49 4870288 =0G0BL?><5I5=85D09;>2 33 4870337 =0G0BL?><5I5=85D09;>2=0A5@25@ 58 4870370 =0G0BL?>B>:>2>5@0A?>7=020=85 14 4870428 =0G0BL?@8>1@5B5=85 14 4870442 =0G0BL?@>25@:C 14 4870456 =0G0BL?@>25@:C<5B:82@5<5=8 10 4870470 =0G0BL?@>25@:C?>4?8A59 10 4870480 =0G0BL?@>25@:C?>4?8A8 38 4870490 =0G0BL?@>25@:CA5@B8D8:0B0 20 4870528 =0G0BL?@>25@:CACI5AB2>20=8O 18 4870548 =0G0BL?@>25@:CMB>:0B0;>3 18 4870566 =0G0BL?@>25@:CMB>D09; 18 4870584 =0G0BL?@>?CA: 18 4870602 =0G0BL?@>?CA:4> 23 4870620 =0G0BL@0745;5=85 25 4870643 =0G0BL@0745;5=85=0G0AB8?> 29 4870668 =0G0BL@0AH8D@>2:C 21 4870697 =0G0BL@538AB@0F8N8=D>@<0F8>==>9107K 22 4870718 =0G0BL@540:B8@>20=85B5:CI59>1;0AB8 10 4870740 =0G0BL@540:B8@>20=85M;5<5=B0 11 4870750 =0G0BLA1@>A1CD5@>2 72 4870761 =0G0BLA8=B57 18 4870833 =0G0BLA>740=85 23 4870851 =0G0BLA>740=852@5<5==>3>D09;0 24 4870874 =0G0BLA>740=852K3@C7:840==KE 14 4870898 =0G0BLA>740=852K3@C7:840==KE0A8=E 14 4870912 =0G0BLA>740=8542>8G=KE40==KE87D09;0 25 4870926 =0G0BLA>740=85:0B0;>30 28 4870951 =0G0BLAO 68 4870979 =0G0BLB@0=70:F8N 61 4871047 =0G0BLC40;5=85 19 4871108 =0G0BLC40;5=8540==KE 14 4871127 =0G0BLC40;5=85D09;>2 28 4871141 =0G0BLCA>25@H5=AB2>20=85?>4?8A8 18 4871169 =0G0BLCAB0=>2:C 34 4871187 =0G0BLCAB0=>2:C2=5H=59:><?>=5=BK 38 4871221 =0G0BLCAB0=>2:C2@5<5=887<5=5=8O 19 4871259 =0G0BLCAB0=>2:C=52848<>AB8 18 4871278 =0G0BLCAB0=>2:C@07<5@0 42 4871296 =0G0BLCAB0=>2:C@0AH8@5=8O?>;CG5=8O8=D>@<0F88>:><?LNB5@5 11 4871338 =0G0BLCAB0=>2:C@0AH8@5=8O@01>BKA:@8?B>3@0D859 35 4871349 =0G0BLCAB0=>2:C@0AH8@5=8O@01>BKAD09;0<8 30 4871384 =0G0BLCAB0=>2:CB>;L:>GB5=8O 18 4871414 =0G0BLCAB0=>2:CC=825@A0;L=>3>2@5<5=887<5=5=8O 18 4871432 =0G0BLGB5=85 200 4871450 =0G0BLGB5=85109B0 18 4871650 =0G0BLGB5=8521CD5@42>8G=KE40==KE 21 4871668 =0G0BLGB5=854> 23 4871689 =0G0BLGB5=85A8<2>;>2 20 4871712 =0G0BLGB5=85AB@>:8 20 4871732 =0G0BLGB5=85F5;>3>16 18 4871752 =0G0BLGB5=85F5;>3>32 18 4871770 =0G0BLGB5=85F5;>3>64 18 4871788 =0G0BLH8D@>20=85 22 4871806 =0G40B0 19 4871828 =0G5@B0=85 44 4871847 =0G5@B0=85< 4 4871891 =0G5@B0=88 8 4871895 =0G5@B0=89 4 4871903 =0G5@B0=8O 24 4871907 =0G5@B0=L5 4 4871931 =0G8=05B 661 4871935 =0G8=05BAO 469 4872596 =0G8=05BAOA 10 4873065 =0G8=0BL 132630 4873075 =0G8=0BLAO 1080 5005705 =0G8=0NB 20 5006785 =0G8=0NBAO 3 5006805 =0G8=0NI0OAO 8 5006808 =0G8=0NI53>AO 4 5006816 =0G8=0NI55AO 5 5006820 =0G8=0NI5<AO 4 5006825 =0G8=0NI5<C 10 5006829 =0G8=0NI5<CAO 4 5006839 =0G8=0NI85AO 3 5006843 =0G8=0NI89 15 5006846 =0G8=0NI89AO 28 5006861 =0G8=0NI8E 5 5006889 =0G8=0O 132454 5006894 =0G8A;5=85 33 5139348 =0G8A;5=89 11 5139381 =0G8A;5=8O 19 5139392 =0G8A;5=L5 11 5139411 =0G8A;8B8 11 5139422 =0G=5B 5 5139433 =0G=5BAO 64 5139438 =0G=CB 14 5139502 =0G>AB0B>: 5 5139516 =0G?5@8>40 12 5139521 =0G?>7 6 5139533 =0H 11 5139539 =0H4>;3 8 5139550 =0H53> 4 5139558 =0H5< 6 5139562 =0H:0;5 9 5139568 =0H;0AL 4 5139577 =0H;8 22 5139581 =0H;8AL 5 5139603 =0H;>AL 4 5139608 =4 6 5139612 =4D;4>E>4K 5 5139618 =4D;8AG8A;5==K913 6 5139623 =5 34576 5139629 =50:B825= 10 5174205 =50:B82=89 15 5174215 =50:B82=> 27 5174230 =50:B82=>3> 15 5174257 =50:B82=>AB8 5 5174272 =50:B82=>ABL 5 5174277 =50:B82=K5 41 5174282 =50:B82=K9 114 5174323 =50:BC0;L=>5 4 5174437 =50:BC0;L=>ABL 9 5174441 =50:BC0;L=K9 12 5174450 =50:BC0;L=K< 4 5174462 =50:BC0;L=K<8 4 5174466 =510;0=A>2KE 40 5174470 =5157>?0A=> 4 5174510 =5157>?0A=K9 4 5174514 =515A=> 15 5174518 =515A=>3>;C1>9 11 5174533 =515A=K9 15 5174544 =515A?>:>8BL 21 5174559 =51>;LH8<8 4 5174580 =51>;LH8E 5 5174584 =51>;LH>3> 10 5174589 =51>;LH>9 24 5174599 =520;84=K<8 6 5174623 =525@=> 4 5174629 =525@=>3> 28 5174633 =525@=>5 22 5174661 =525@=>5A>AB>O=858B5@0B>@0 9 5174683 =525@=>9 14 5174692 =525@=>< 14 5174706 =525@=K9 94 5174720 =52848< 8 5174814 =52848<>AB8 4 5174822 =52848<>ABL 25 5174826 =52848<K 5 5174851 =52848<K9 65 5174856 =52848<K< 14 5174921 =52848<K<8 10 5174935 =5285@0@E88 18 5174945 =52:;NG0BL 9 5174963 =52>7<>65= 31 5174972 =52>7<>6=0 23 5175003 =52>7<>6=> 660 5175026 =52>7<>6=>AB8 114 5175686 =52>7<>6=>ABL 118 5175800 =52>7<>6=K9 748 5175918 =52>7<>6=K< 34 5176666 =52>AAB0=02;820BL 19 5176700 =52>AAB0=>28<><C 6 5176719 =52>AAB0=>28<K9 7 5176725 =52>AAB0=>28<K< 6 5176732 =52A?8A:5 33 5176738 =52A?8A:5?>85@0@E88 28 5176771 =52K2>48BL 36 5176799 =52K?>;=5==K5 5 5176835 =52K?>;=5==K9 20 5176840 =52K?>;=5==KE 15 5176860 =52K?>;=OBL459AB289A107>940==KE 14 5176875 =52K?>;=OBL?@>25@:C?>4?8A8 9 5176889 =530B82=> 6 5176898 =530B82=K9 6 5176904 =53;>10;L=>3> 51 5176910 =53;>10;L=K9 6 5176961 =53;>10;L=KE 18 5176967 =53> 924 5176985 =5402=85 22 5177909 =5402=89 22 5177931 =5402=> 4 5177953 =5459AB28B5;L=>3> 4 5177957 =5459AB28B5;L=>5 4 5177961 =5459AB28B5;L=>9 22 5177965 =5459AB28B5;L=K9 39 5177987 =5459AB28B5;L=K< 12 5178026 =545;8 243 5178038 =545;N 18 5178281 =545;O 447 5178299 =545;O3>40 18 5178746 =545;O< 59 5178764 =545;O>B=0G0;0?5@8>40 9 5178823 =545;OE 8 5178832 =54>102;OBL 9 5178840 =54>?CAB8< 45 5178849 =54>?CAB8<0O>?5@0F8O 6 5178894 =54>?CAB8<89 8 5178900 =54>?CAB8<> 42 5178908 =54>?CAB8<>3> 8 5178950 =54>?CAB8<>5 70 5178958 =54>?CAB8<>< 6 5179028 =54>?CAB8<K5 92 5179034 =54>?CAB8<K5?>4AB0=>2:8 16 5179126 =54>?CAB8<K5?>4AB0=>2:8xs 25 5179142 =54>?CAB8<K9 329 5179167 =54>?CAB8<K920@80=B8A?>;L7>20=8O107K40==KE:>?88 9 5179496 =54>?CAB8<K< 16 5179505 =54>?CAB8<K<8 55 5179521 =54>?CAB8<KE 10 5179576 =54>AB0B:5 12 5179586 =54>AB0B>: 12 5179598 =54>AB0B>G=> 48 5179610 =54>AB0B>G=>< 12 5179658 =54>AB0B>G=K9 60 5179670 =54>AB0G=K< 6 5179730 =54>AB0NI55:>;8G5AB2> 11 5179736 =54>ABC?5= 197 5179747 =54>ABC?=0 64 5179944 =54>ABC?=89 74 5180008 =54>ABC?=> 742 5180082 =54>ABC?=>3> 10 5180824 =54>ABC?=>9 9 5180834 =54>ABC?=>AB8 74 5180843 =54>ABC?=>ABL 82 5180917 =54>ABC?=K 81 5180999 =54>ABC?=K5 14 5181080 =54>ABC?=K54;O@0AH8@5=8O<>4C;8 47 5181094 =54>ABC?=K9 1166 5181141 =54>ABC?=K< 24 5182307 =54>ABC?=K<8 23 5182331 =54>ABC?=KE 6 5182354 =55 182 5182360 =57025@H5=0 9 5182542 =57025@H5=89 9 5182551 =57025@H5=> 9 5182560 =57028A8<0O 15 5182569 =57028A8<> 274 5182584 =57028A8<>3> 23 5182858 =57028A8<>8A>2<5AB=> 528 5182881 =57028A8<>9 4 5183409 =57028A8<>AB8 12 5183413 =57028A8<>ABL 12 5183425 =57028A8<K5 64 5183437 =57028A8<K5?@020?>4G8=5==KE>1J5:B>2 36 5183501 =57028A8<K9 518 5183537 =57028A8<KE 77 5184055 =5703@C65=0 9 5184132 =5703@C65==K9 9 5184141 =57040=> 9 5184150 =570:@KBK9 5 5184159 =570:@KBKE 5 5184164 =570?8A0==>3> 29 5184169 =570?8A0==>5 5 5184198 =570?8A0==>9 4 5184203 =570?8A0==K5 6 5184207 =570?8A0==K9 80 5184213 =570?8A0==KE 36 5184293 =570?>;=5==0O 14 5184329 =570?>;=5==>3> 41 5184343 =570?>;=5==CN 16 5184384 =570?>;=5==K9 94 5184400 =570?>;=5==K< 4 5184494 =570?>;=5==K<8 5 5184498 =570?>;=5==KE 14 5184503 =570?>;=5=> 9 5184517 =570?>;=OBL 18 5184526 =570?>;=OBL02B><0B8G5A:8 13 5184544 =570?CI5= 9 5184557 =570I8I5==>5 25 5184566 =570I8I5==>< 5 5184591 =570I8I5==K5 12 5184596 =570I8I5==K9 58 5184608 =570I8I5==KE 16 5184666 =57=0G0I85 30 5184682 =57=0G0I89 43 5184712 =57=0G0I8< 20 5184755 =57=0G0I8<8 5 5184775 =57=0G8B5;L=> 4 5184780 =57=0G8B5;L=K9 4 5184784 =585@0@E8G5A:89 10 5184788 =585@0@E8G5A:>9 10 5184798 =58725AB5= 8 5184808 =58725AB=0 20 5184816 =58725AB=0O 4 5184836 =58725AB=0O70?8ALndef 15 5184840 =58725AB=0O>H81:0 9 5184855 =58725AB=> 63 5184864 =58725AB=>3> 21 5184927 =58725AB=>5 22 5184948 =58725AB=>9 4 5184970 =58725AB=><C 4 5184974 =58725AB=K 11 5184978 =58725AB=K9 147 5184989 =58725AB=K9D>@<0B 9 5185136 =587<5==>9 10 5185145 =587<5==>ABL 4 5185155 =587<5==K9 14 5185159 =587<5==K< 4 5185173 =587<5=O5<>5 4 5185177 =587<5=O5<CN 10 5185181 =587<5=O5<K9 24 5185191 =587<5=O5<KE 5 5185215 =587<5=OBL 27 5185220 =587<5=OBL?>2545=85 9 5185247 =587>;8@>20==> 16 5185256 =58<5=>20==K9 10 5185272 =58<5=>20==KE 10 5185282 =58<?>@B8@>20BL 9 5185292 =58=45:A8@>20BL 9 5185301 =58=8F80;878@>20==>3> 95 5185310 =58=8F80;878@>20==><C 4 5185405 =58=8F80;878@>20==K9 141 5185409 =58=8F80;878@>20==K< 11 5185550 =58=8F80;878@>20==K<8 4 5185561 =58=8F80;878@>20==KE 6 5185565 =58=B5@0:B82=>3> 10 5185571 =58=B5@0:B82=>5 32 5185581 =58=B5@0:B82=>9 5 5185613 =58=B5@0:B82=>< 11 5185618 =58=B5@0:B82=K9 58 5185629 =58A?>;L7>20=85 4 5185687 =58A?>;L7>20=8O 4 5185691 =58A?>;L7>20BL 1024 5185695 =58A?>;L7>20BL:>?88 9 5186719 =58A?>;L7>20BL?@>:A84;O04@5A>2 9 5186728 =58A?>;L7>20BL?@>:A84;O;>:0;L=KE04@5A>2 9 5186737 =58A?>;L7C5<0O 45 5186746 =58A?>;L7C5<>3> 21 5186791 =58A?>;L7C5<>5 5 5186812 =58A?>;L7C5<>53> 9 5186817 =58A?>;L7C5<K5 11 5186826 =58A?>;L7C5<K9 101 5186837 =58A?>;L7C5<K< 22 5186938 =58A?>;L7C5<K<8 4 5186960 =58A?>;L7C5B 13 5186964 =58A?>;L7C5BAO 22 5186977 =58F80;878@>20==><C 4 5186999 =59 193 5187003 =59B@0;L=> 50 5187196 =59B@0;L=>0:20<0@8=>2K9 11 5187246 =59B@0;L=>18@N7>2K9 11 5187257 =59B@0;L=>25A5==575;5=K9 12 5187268 =59B@0;L=>3@8D5;L=>A8=89 12 5187280 =59B@0;L=>75;5=K9 12 5187292 =59B@0;L=>:>@8G=52K9 12 5187304 =59B@0;L=>?C@?C@=K9 12 5187316 =59B@0;L=>A5@K9 12 5187328 =59B@0;L=>A8=89 12 5187340 =59B@0;L=>D8>;5B>2>:@0A=K9 12 5187352 =59B@0;L=K9 65 5187364 =5:20;8D8F8@>20==0O 10 5187429 =5:20;8D8F8@>20==K9 10 5187439 =5:89 4 5187449 =5:;NG52>9 10 5187453 =5:;NG52KE 4 5187463 =5:>9 432 5187467 =5:>=:C@8@CNI8E 5 5187899 =5:>=B5:AB=>3> 8 5187904 =5:>=B5:AB=>5 8 5187912 =5:>=B5:AB=>< 74 5187920 =5:>=B5:AB=K5 5 5187994 =5:>=B5:AB=KE 11 5187999 =5:>@@5:B5= 5 5188010 =5:>@@5:B=0 4 5188015 =5:>@@5:B=> 41 5188019 =5:>@@5:B=>3> 12 5188060 =5:>@@5:B=>5 4 5188072 =5:>@@5:B=K5 12 5188076 =5:>@@5:B=K9 109 5188088 =5:>@@5:B=K< 23 5188197 =5:>@@5:B=KE 4 5188220 =5:>B>@>3> 46 5188224 =5:>B>@>5 40 5188270 =5:>B>@>9 23 5188310 =5:>B>@CN 13 5188333 =5:>B>@K5 422 5188346 =5:>B>@K9 987 5188768 =5:>B>@K< 25 5189755 =5:>B>@K<8 19 5189780 =5:>B>@KE 242 5189799 =5:@8B8G=0O 4 5190041 =5:@8B8G=K9 4 5190045 =5;>:0;87>20==K5 6 5190049 =5;>:0;87>20==K9 6 5190055 =5;L7O 576 5190061 =5< 197 5190637 =5<54;5==> 30 5190834 =5<54;5==>3> 12 5190864 =5<54;5==>5 10 5190876 =5<54;5==>9 9 5190886 =5<54;5==K9 31 5190895 =5<5F:89 48 5190926 =5<5F:>3> 14 5190974 =5<=>3> 10 5190988 =5<=>65AB25==CN 4 5190998 =5<=>65AB25==KE 4 5191002 =5<>40;L=> 10 5191006 =5<>40;L=>3> 14 5191016 =5<>40;L=>5 4 5191030 =5<>40;L=K9 50 5191034 =5<>48D8F8@>20==K5 4 5191084 =5<>48D8F8@>20==K9 4 5191088 =5<>9 197 5191092 =5<C 102 5191289 =5<CB015;L=K<8 4 5191391 =5=07=0G0BL 9 5191395 =5=0G8=05BAOA 10 5191404 =5=C6=>5 6 5191414 =5=C6=K5 6 5191420 =5=C6=K9 12 5191426 =5=C;52>9 6 5191438 =5>1=>2;OBL 9 5191444 =5>1=>2;OBL02B><0B8G5A:8 56 5191453 =5>1@010BK20BL 58 5191509 =5>1@0B8<> 4 5191567 =5>1@0B8<K9 4 5191571 =5>1E>48< 218 5191575 =5>1E>48<0 83 5191793 =5>1E>48<0O 8 5191876 =5>1E>48<> 3258 5191884 =5>1E>48<>3> 18 5195142 =5>1E>48<>5 192 5195160 =5>1E>48<>7025@H8BL 9 5195352 =5>1E>48<>9 13 5195361 =5>1E>48<>< 12 5195374 =5>1E>48<>AB8 661 5195386 =5>1E>48<>ABL 1638 5196047 =5>1E>48<>ABL7025@H5=8OA>548=5=8O 29 5197685 =5>1E>48<CN 23 5197714 =5>1E>48<K 9 5197737 =5>1E>48<K5 198 5197746 =5>1E>48<K9 4006 5197944 =5>1E>48<K< 133 5201950 =5>1E>48<K<8 3 5202083 =5>1E>48<KE 21 5202086 =5>1J5:B=>9 11 5202107 =5>1J5:B=K5 4 5202118 =5>1J5:B=K540==K5 50 5202122 =5>1J5:B=K9 17 5202172 =5>1J5:B=KE 6 5202189 =5>1O70B5;L=0O 17 5202195 =5>1O70B5;L=> 204 5202212 =5>1O70B5;L=>3> 15 5202416 =5>1O70B5;L=>5 37 5202431 =5>1O70B5;L=K 8 5202468 =5>1O70B5;L=K5 11 5202476 =5>1O70B5;L=K9 9967 5202487 =5>1O70B5;L=K< 23 5212454 =5>1O70B5;L=KE 4 5212477 =5>3@0=8G5= 8 5212481 =5>3@0=8G5==0 4 5212489 =5>3@0=8G5==0O 4 5212493 =5>3@0=8G5==> 8 5212497 =5>3@0=8G5==>5 15 5212505 =5>3@0=8G5==>9 242 5212520 =5>3@0=8G5==K9 281 5212762 =5>3@0=8G5=> 8 5213043 =5>3@0=8G5=K 9 5213051 =5>4=>7=0G=> 17 5213060 =5>4=>7=0G=>AB8 11 5213077 =5>4=>7=0G=>ABL 11 5213088 =5>4=>7=0G=K9 17 5213099 =5>4=>:@0B=> 12 5213116 =5>4=>:@0B=K9 12 5213128 =5>6840==> 5 5213140 =5>6840==K9 5 5213145 =5>?5@0B82=>5 4 5213150 =5>?5@0B82=>< 9 5213154 =5>?5@0B82=K9 30 5213163 =5>?>25I0BL 12 5213193 =5>?>7=0==0O 5 5213205 =5>?>7=0==>5 5 5213210 =5>?>7=0==K9 8 5213215 =5>?@545;5= 20 5213223 =5>?@545;5==>5 10 5213243 =5>?@545;5==>< 45 5213253 =5>?@545;5==K9 55 5213298 =5>?@545;5=> 12337 5213353 =5>@85=B8@>20==K5 4 5225690 =5>@85=B8@>20==K9 4 5225694 =5>A2>1>640BL02B><0B8G5A:8 9 5225698 =5>B>1@0605<K9 10 5225707 =5>B>1@0605<KE 10 5225717 =5>B>1@060BL 204 5225727 =5>B?@02;5==K9 5 5225931 =5>B?@02;5==KE 5 5225936 =5>B?@02;OBL 9 5225941 =5>B@8F0B5;L=>5 19 5225950 =5>B@8F0B5;L=K9 42 5225969 =5>B@8F0B5;L=K< 4 5226011 =5?5@570?8AK205<>9 4 5226015 =5?5@5:@K20BL2;045;LF0 9 5226019 =5?5@5<5I0BL 13 5226028 =5?5@5=>A8BL 9 5226041 =5?5@5A5:0NI89AO 10 5226050 =5?5@5A5:0NI8EAO 10 5226060 =5?5@5E20G5==>3> 5 5226070 =5?5@8>48G5A:0O 4 5226075 =5?5@8>48G5A:89 114 5226079 =5?5@8>48G5A:8< 6 5226193 =5?5@8>48G5A:8E 34 5226199 =5?5@8>48G5A:>3> 22 5226233 =5?5@8>48G5A:>9 5 5226255 =5?>4286=K9 5 5226260 =5?>4286=K< 5 5226265 =5?>445@68205<>3> 4 5226270 =5?>445@68205<>5 4 5226274 =5?>445@68205<K9 25 5226278 =5?>445@68205<K9D>@<0B 9 5226303 =5?>445@68205<K<8 4 5226312 =5?>445@68205<KE 9 5226316 =5?>4>1=> 9 5226325 =5?>4?8A0==K9 26 5226334 =5?>4?8A0==KE 26 5226360 =5?>4B25@645==>52@5<O?>4?8A8 11 5226386 =5?>4E>4OI53> 25 5226397 =5?>4E>4OI89 25 5226422 =5?>4G8=5==>3> 15 5226447 =5?>4G8=5==K9 15 5226462 =5?>:070==K9 4 5226477 =5?>:070==KE 4 5226481 =5?><5G5==>9 4 5226485 =5?><5G5==K9 4 5226489 =5?>=OB=> 12 5226493 =5?>=OB=K9 12 5226505 =5?>A5IQ==KE 4 5226517 =5?>A@54AB25==> 380 5226521 =5?>A@54AB25==>3> 135 5226901 =5?>A@54AB25==>5 317 5227036 =5?>A@54AB25==>< 4 5227353 =5?>A@54AB25==K9 876 5227357 =5?>A@54AB25==K< 40 5228233 =5?>AB>O=5= 5 5228273 =5?>AB>O==K9 5 5228278 =5?@028;L=89 4 5228283 =5?@028;L=> 34 5228287 =5?@028;L=>3> 4 5228321 =5?@028;L=>5 40 5228325 =5?@028;L=K5 5 5228365 =5?@028;L=K57=0G5=8O 8 5228370 =5?@028;L=K9 96 5228378 =5?@028;L=K9?0@>;L 13 5228474 =5?@028;L=K< 8 5228487 =5?@542845==K9 4 5228495 =5?@542845==KE 4 5228499 =5?@54>?@545;5==>3> 4 5228503 =5?@5@K2=0 5 5228507 =5?@5@K2=0O 8 5228512 =5?@5@K2=>3> 31 5228520 =5?@5@K2=>5 4 5228551 =5?@5@K2=>9 9 5228555 =5?@5@K2=>< 4 5228564 =5?@5@K2=>ABL 5 5228568 =5?@5@K2=K5 10 5228573 =5?@5@K2=K5?>;O 9 5228583 =5?@5@K2=K9 72 5228592 =5?@5@K2=KE 4 5228664 =5?@8<5=OBL 13 5228668 =5?@>15;L=K5 5 5228681 =5?@>15;L=KE 4 5228686 =5?@>2545==K9 6 5228690 =5?@>2545==K< 6 5228696 =5?@>25@OBL 36 5228702 =5?@>7@0G=K 4 5228738 =5?@>7@0G=K9 4 5228742 =5?@>872>48B5;L=K9 10 5228746 =5?@>872>48B5;L=K< 10 5228756 =5?@>8=45:A8@>20==KE 5 5228766 =5?@>945==K5 5 5228771 =5?@>G8B0==>3> 10 5228776 =5?@>G8B0==K5 4 5228786 =5?@>G8B0==K5A>>1I5=8O 5 5228790 =5?@>G8B0==K9 14 5228795 =5?@>GB5==>5 4 5228809 =5?@>GB5=> 9 5228813 =5?CAB0O 13 5228822 =5?CAB>3> 36 5228835 =5?CAB>9 95 5228871 =5?CABCN 18 5228966 =5?CABK<8 12 5228984 =5@025=AB20 10 5228996 =5@025=AB2> 18 5229006 =5@02=> 51 5229024 =5@02=K9 51 5229075 =5@0718@05<0O 12 5229126 =5@0718@05<CN 12 5229138 =5@0718@05<KE 4 5229150 =5@0745;5==>3> 6 5229154 =5@0745;5==K9 6 5229160 =5@07@5H5==K9 4 5229166 =5@07@5H5==K< 4 5229170 =5@07@K2=>3> 12 5229174 =5@07@K2=K9 37 5229186 =5@0A:@K20BL 9 5229223 =5@0A?@545;5==>9 4 5229232 =5@0A?@545;5==K9 4 5229236 =5@0ABO3820BL 9 5229240 =5@8A>20BL 9 5229249 =5@>2=K5 4 5229258 =5@>2=K9 4 5229262 =5A0=:F8>=8@>20==>3> 8 5229266 =5A0=:F8>=8@>20==K9 8 5229274 =5A5@80;87C5<KE 6 5229282 =5A5B 10 5229288 =5A:>;L:85 392 5229298 =5A:>;L:8< 25 5229690 =5A:>;L:8<8 32 5229715 =5A:>;L:8E 344 5229747 =5A:>;L:> 1072 5230091 =5A<>B@O 25 5231163 =5A>2<5AB8<0 5 5231188 =5A>2<5AB8<>AB8 4 5231193 =5A>2<5AB8<>ABL 4 5231197 =5A>2<5AB8<K9 5 5231201 =5A>2?045=85 25 5231206 =5A>2?045=88 5 5231231 =5A>2?045=8O 20 5231236 =5A>45@68B 29 5231256 =5A>548=OBL 13 5231285 =5A>87<5@8<> 8 5231298 =5A>87<5@8<K9 8 5231306 =5A>>B25BAB285 59 5231314 =5A>>B25BAB28540==KE 9 5231373 =5A>>B25BAB288 19 5231382 =5A>>B25BAB2C5BB@51>20=8O<<8=8<0;L=>94;8=K 9 5231401 =5A>>B25BAB2C5BB@51>20=8O<>3@0=8G5=8O?>2B>@5=8OA@548?>A;54=8E 9 5231410 =5A>>B25BAB2C5BB@51>20=8O<?@>25@:8@0A:@KB8O 9 5231419 =5A>>B25BAB2C5BB@51>20=8O<A;>6=>AB8 9 5231428 =5A>>B25BAB2C5BH01;>=C 4 5231437 =5A>>B25BAB2CNI89 4 5231441 =5A>E@0=5==K9 4 5231445 =5A>E@0=5==KE 4 5231449 =5A>E@0=O5<K9 5 5231453 =5A>E@0=OBL?CB8 28 5231458 =5A?OI53> 10 5231486 =5AB0=40@B878@>20BL 9 5231496 =5AB0=40@B=>3> 5 5231505 =5AB0=40@B=>5 19 5231510 =5AB0=40@B=>< 4 5231529 =5AB0=40@B=K5 4 5231533 =5AB0=40@B=K9 42 5231537 =5AB0=40@B=K< 4 5231579 =5AB0=40@B=K<8 4 5231583 =5AB0=40@B=KE 4 5231587 =5AB8 10 5231591 =5AB@>389 9 5231601 =5ACI5AB25=5= 5 5231610 =5ACI5AB2CNI59 12 5231615 =5ACI5AB2CNI85 45 5231627 =5ACI5AB2CNI89 89 5231672 =5ACI5AB2CNI8E 4 5231761 =5B 3635 5231765 =5B5:AB>2K9 8 5235400 =5B5:AB>2KE 8 5235408 =5B;8=88 57 5235416 =5B>G=>AB59 4 5235473 =5B>G=>ABL 4 5235477 =5B?@>25@:8 17 5235481 =5B@>=CBK9 6 5235498 =5B@>=CBK<8 6 5235504 =5BA>548=5=8O 9 5235510 =5BB@0=70:F88 9 5235519 =5C1K20NI59 5 5235528 =5C1K20NI89 5 5235533 =5C40;OBL02B><0B8G5A:8 13 5235538 =5C40;OBL7040==K5=5?>A@54AB25==> 6 5235551 =5C40G0 10 5235557 =5C40G=> 41 5235567 =5C40G=>9 8 5235608 =5C40G=K9 49 5235616 =5C<5AB82H85AO 4 5235665 =5C=8:0;L=K9 49 5235669 =5C=8:0;L=KE 45 5235718 =5C?>@O4>G5==>9 4 5235763 =5C?>@O4>G5==K9 12 5235767 =5C?>@O4>G5==K98B5@0B>@C7;>2 13 5235779 =5C?>@O4>G5==K9A=8<>:C7;>2 21 5235792 =5C?>@O4>G820BL 10 5235813 =5C?@02;O5<K9 4 5235823 =5C?@02;O5<KE 4 5235827 =5C?@>I0BL 9 5235831 =5CA?5H=> 5 5235840 =5CA?5H=>ABL 4 5235845 =5CA?5H=K9 13 5235849 =5CA?5H=KE 8 5235862 =5CAB0=>2;5==K9 11 5235870 =5CAB0=>2;5==K< 4 5235881 =5CAB0=>2;5==KE 6 5235885 =5CAB0=>2;5=> 13 5235891 =5D>@<5 20 5235904 =5E20B:0 12 5235924 =5E20B:5 8 5235936 =5E20B:8 4 5235944 =5F5;5A>>1@075= 8 5235948 =5F5;5A>>1@07=> 14 5235956 =5F5;5A>>1@07=K9 22 5235970 =5G5B:89 16 5235992 =5G5B:>3> 10 5236008 =5G5B=K5 8 5236018 =5G5B=K9 8 5236026 =5G8A;>2>5 10 5236034 =5G8A;>2>9 18 5236044 =5G8A;>2K5 4 5236062 =5G8A;>2KE 4 5236066 =5H01;>==K9 10 5236070 =5H01;>==K< 10 5236080 =5HB0B=>9 4 5236090 =5HB0B=K9 4 5236094 =5O2=89 6 5236098 =5O2=> 48 5236104 =5O2=>3> 6 5236152 =5O2=>5 62 5236158 =5O2=K9 121 5236220 =5O2=KE 4 5236341 =5Q 19 5236345 =8 724 5236364 =81C4L 44 5237088 =8345 6 5237132 =845@;0=4K 12 5237138 =865 498 5237150 =865;560I53> 8 5237648 =865;560I89 8 5237656 =86=53> 28 5237664 =86=55 5 5237692 =86=59 148 5237697 =86=5< 34 5237845 =86=5<C 17 5237879 =86=85 10 5237896 =86=89 383 5237906 =86=89480?07>= 4 5238289 =86=89:>;>=B8BC; 17 5238293 =86=NN 24 5238310 =86=OO 54 5238334 =86=OO3@0=8F0 57 5238388 =86=V9 54 5238445 =87 340 5238499 =870B8 498 5238839 =87:0 14 5239337 =87:0O 75 5239351 =87:89 623 5239426 =87:>5 30 5240049 =87:>9 14 5240079 =87C 4 5240093 =87H89 5 5240097 =8:0: 46 5240102 =8:0:0O 146 5240148 =8:0:85 445 5240294 =8:0:8< 6 5240739 =8:0:8E 208 5240745 =8:0:>3> 34 5240953 =8:0:>9 1019 5240987 =8:0@03C0 12 5242006 =8:>340 58 5242018 =8:>3> 16 5242076 =8; 20 5242092 =8< 252 5242112 =8<8 31 5242364 =8E 375 5242395 =8G53> 180 5242770 =8G5< 9 5242950 => 1619 5242959 =>20O 272 5244578 =>20O2;>65==0OAE5<0:><?>=>2:840==KE 12 5244850 =>20O3@C??0 6 5244862 =>20O3@C??8@>2:0:><?>=>2:840==KE 12 5244868 =>20O4803@0<<0:><?>=>2:840==KE 12 5244880 =>20O:=>?:0 34 5244892 =>20O:>;>=:0 9 5244926 =>20O=060B85 5 5244935 =>20O@0<:0 6 5244940 =>20OA2O7L 9 5244946 =>20OA5@8O 4 5244955 =>20OAB@>:0 79 5244959 =>20OB01;8F0:><?>=>2:840==KE 12 5245038 =>20OF5=0 5 5245050 =>24>: 11 5245055 =>24>:C<5=B 10 5245066 =>27040G0 14 5245076 =>289 2135 5245090 =>2=><5=:;0BC@0 17 5247225 =>2>3> 1819 5247242 =>2>5 2347 5249061 =>2>5459AB285 18 5251408 =>2>545@52>A>AB020 5 5251426 =>2>57=0G5=85 15 5251431 =>2>58<O 5 5251446 =>2>5>1AC645=85 12 5251451 =>2>5>:=> 12 5251463 =>2>9 779 5251475 =>2>< 15 5252254 =>2><C 77 5252269 =>2B01;8F0F5= 6 5252346 =>2CN 292 5252352 =>2K5 684 5252644 =>2K5>1>@>BK 6 5253328 =>2K5?0@0<5B@K 5 5253334 =>2K5A2O78 5 5253339 =>2K5A>>1 7 5253344 =>2K9 9556 5253351 =>2K9guid 4 5262907 =>2K90B@81CB 130 5262911 =>2K94>: 12 5263041 =>2K98=45:A 40 5263053 =>2K98AB>G=8: 5 5263093 =>2K9:;85=B 7 5263098 =>2K9:C@A 23 5263105 =>2K9<0AA82 17 5263128 =>2K9>1J5:B 35 5263145 =>2K9?0@0<5B@ 9 5263180 =>2K9?0@>;L 9 5263189 =>2K9?>4>?KB=K9 7 5263198 =>2K9?>;83>=0;L=K9>1J5:B 5 5263205 =>2K9?>@O4>: 12 5263210 =>2K9C75; 756 5263222 =>2K9M;5<5=B 25 5263978 =>2K< 175 5264003 =>2K<8 24 5264178 =>2KE 486 5264202 =>;L 5 5264688 =>< 24 5264693 =><0 24 5264717 =><5=:;0BC@0 600 5264741 =><5=:;0BC@0=08<5=>20=85 5 5265341 =><5=:;0BC@0>1J5:B 6 5265346 =><5=:;0BC@0>AB0B:8 10 5265352 =><5=:;0BC@0?@54AB02;5=85 9 5265362 =><5=:;0BC@C 26 5265371 =><5=:;0BC@K 16 5265397 =><5@ 2944 5265413 =><5@0 489 5268357 =><5@0< 18 5268846 =><5@0<8 67 5268864 =><5@0B5;5D>=>2 35 5268931 =><5@0B@81CB0 30 5268966 =><5@10=:>2A:>9:0@BK 9 5268996 =><5@187=5A?@>F5AA0 25 5269005 =><5@18B0 12 5269030 =><5@25@A88 103 5269042 =><5@25@A884>87<5=5=8O 14 5269145 =><5@25@A88:>=F0 6 5269159 =><5@25@A88=0G0;0 6 5269165 =><5@25@A88?5@5E>40=025@A8N8AB>@8840==KE 72 5269171 =><5@25@A88?>A;587<5=5=8O 14 5269243 =><5@2E>645=8O 12 5269257 =><5@4>: 6 5269269 =><5@4>:C<5=B0 6 5269275 =><5@5 5 5269281 =><5@6C@=0;0 7 5269286 =><5@7040G8 6 5269293 =><5@70?8A8 21 5269299 =><5@87<5@5=8O 18 5269320 =><5@:>@=52>925@H8=K 6 5269338 =><5@>2 182 5269344 =><5@>< 121 5269526 =><5@>B?@02;5==>3> 44 5269647 =><5@?5@2>9:>;>=:8 12 5269691 =><5@?5@2>9AB@0=8FK 11 5269703 =><5@?5@2>9AB@>:8 13 5269714 =><5@?5@8>40 10 5269727 =><5@?>?>@O4:C 5 5269737 =><5@?>?>@O4:C23@C??8@>2:5 5 5269742 =><5@?>@B0 5 5269747 =><5@?>A;54=59:>;>=:8 12 5269752 =><5@?>A;54=59AB@>:8 12 5269764 =><5@?@8;>65=8Ogooglecloud 5 5269776 =><5@?@8=OB>3> 86 5269781 =><5@@>48B5;LA:>3>A50=A0 11 5269867 =><5@A50=A0 49 5269878 =><5@A50=A01;>:8@CNI53>AC14 11 5269927 =><5@A50=A02K?>;=82H53>C?@02;O5<CN1;>:8@>2:C 22 5269938 =><5@A50=A08=D>@<0F8>==>9107K 15 5269960 =><5@A8<2>;0 6 5269975 =><5@A>548=5=8O 34 5269981 =><5@A>548=5=8O8=D>@<0F8>==>9107K 15 5270015 =><5@A>>1I5=8O 194 5270030 =><5@AB@0=8FK 23 5270224 =><5@AB@>:8 717 5270247 =><5@AB@>:8225@A884>87<5=5=8O 5 5270964 =><5@AB@>:8225@A88?>A;587<5=5=8O 5 5270969 =><5@B5:CI53>:04@0 9 5270974 =><5@B5:CI59AB@0=8FK 9 5270983 =><5@B5;5D>=0 67 5270992 =><5@B5;5D>=0F5=B@0;8F5=78@>20=8O 10 5271059 =><5@B>G:8 13 5271069 =><5@C 128 5271082 =><5@C7;0 4 5271210 =><5@C@>2=O 9 5271214 =><5@M;5<5=B0 6 5271223 =><8=0B82 12 5271229 =>=0 687 5271241 =>@2538O 14 5271928 =>@256A:89 18 5271942 =>@<0 22 5271960 =>@<0;870F88 168 5271982 =>@<0;870F8N 4 5272150 =>@<0;870F8O 369 5272154 =>@<0;87>20==K5 8 5272523 =>@<0;87>20==K9 8 5272531 =>@<0;87>20BL 634 5272539 =>@<0;87>20BL4>:C<5=B 10 5273173 =>@<0;L=0O 4 5273183 =>@<0;L=89 20 5273187 =>@<0;L=> 13 5273207 =>@<0;L=>3> 16 5273220 =>@<0;L=>5 18 5273236 =>@<0;L=>9 4 5273254 =>@<0;L=>< 9 5273258 =>@<0;L=CN 168 5273267 =>@<0;L=K9 215 5273435 =>@<8@>20==0O 25 5273650 =>@<8@>20==>5 20 5273675 =>@<8@>20==K9 62 5273695 =>@<8@>20==KE 4 5273757 =>@<8@>20BL 13 5273761 =>@<8@>20BLAO 4 5273774 =>@<8@CNBAO 4 5273778 =>A8B5;5 18 5273782 =>A8B5;L 32 5273800 =>A8B5;O 4 5273832 =>B0 196 5273836 =>B0F88 119 5274032 =>B0F89 240 5274151 =>B0F8N 9 5274391 =>B0F8O 593 5274400 =>B0F8Odom 829 5274993 =>B8D8:0F8N 10 5275822 =>B8D8:0F8O 10 5275832 =>O1@L 16 5275842 =>O1@O 16 5275858 =? 5 5275874 =?? 31 5275879 =@028BAO 6 5275910 =@028BLAO 6 5275916 =@53 23 5275922 =AB@ 326 5275945 =C65= 10 5276271 =C6=0 16 5276281 =C6=0O 4 5276297 =C6=> 1921 5276301 =C6=>3> 18 5278222 =C6=>9 21 5278240 =C6=CN 28 5278261 =C6=K 67 5278289 =C6=K5 9 5278356 =C6=K9 2092 5278365 =C6=K9:>=B@035=B 4 5280457 =C6=K9B>20@ 3 5280461 =C6=K< 9 5280464 =C6=KE 6 5280473 =C;520O 4 5280479 =C;52>3> 5 5280483 =C;52>5 29 5280488 =C;52>9 102 5280517 =C;52>< 10 5280619 =C;52><C 21 5280629 =C;52CN 10 5280650 =C;52K< 5 5280660 =C;59 18 5280665 =C;5< 58 5280683 =C;8 29 5280741 =C;L 278 5280770 =C;N 48 5281048 =C;O 144 5281096 =C;O< 5 5281240 =C;O<8 12 5281245 =C<5@0B>@ 287 5281257 =C<5@0B>@K 4 5281544 =C<5@0B>@K4>:C<5=B>2 9 5281548 =C<5@0F859 23 5281557 =C<5@0F88 33 5281580 =C<5@0F8N 7 5281613 =C<5@0F8O 1136 5281620 =C<5@>20==K9 9 5282756 =C<5@>20==K9A?8A>: 9 5282765 =C<5@>20==KE 5 5282774 =C<5@>20BL 4 5282779 =C<5@>20BLAO 27 5282783 =C<5@CNBAO 27 5282810 =N=>@A: 14 5282837 > 1417 5282851 >1 1003 5284268 >10 447 5285271 >125AB8 25 5285718 >12>48B 5 5285743 >12>48BL 5 5285748 >12>48BLAO 9 5285753 >15 244 5285762 >158< 5 5286006 >158E 24 5286011 >15A?5G5= 4 5286035 >15A?5G5=85 46 5286039 >15A?5G5=8O 41 5286085 >15A?5G5==K9 4 5286126 >15A?5G5=> 19 5286130 >15A?5G82 9 5286149 >15A?5G8205B 49 5286158 >15A?5G8205BAO 194 5286207 >15A?5G820BL 71 5286401 >15A?5G820BLAO 194 5286472 >15A?5G820NB 22 5286666 >15A?5G8BL 55 5286688 >15I0=85 1255 5286743 >15I0=85< 5 5287998 >15I0=8O 950 5288003 >1;1 9 5288953 >1;2 6 5288962 >1;0405B 88 5288968 >1;040BL 213 5289056 >1;040NB 4 5289269 >1;040NI85 22 5289273 >1;040NI89 39 5289295 >1;040NI8E 12 5289334 >1;0:> 8 5289346 >1;0:C 8 5289354 >1;0AB59 276 5289362 >1;0AB8 2285 5289638 >1;0ABL 3485 5291923 >1;0ABL22>40 9 5295408 >1;0ABL2848<>AB8 31 5295417 >1;0ABL40==KE 11 5295448 >1;0ABL459AB28O 117 5295459 >1;0ABL459AB28O@0AH8@5=8O:>=D83C@0F88 21 5295576 >1;0ABL703>;>2:0 78 5295597 >1;0ABL703>;>2:035>3@0D8G5A:>9AE5<K 54 5295675 >1;0ABL703>;>2:045=4@>3@0<<K 69 5295729 >1;0ABL703>;>2:04803@0<<K 78 5295798 >1;0ABL703>;>2:04803@0<<K30=B0 69 5295876 >1;0ABL703>;>2:0A2>4=>94803@0<<K 49 5295945 >1;0ABL703>;>2:>2:>;>=>: 11 5295994 >1;0ABL703>;>2:>2AB@>: 11 5296005 >1;0ABL85@0@E8O 10 5296016 >1;0ABL:>;>=:0 6 5296026 >1;0ABL:>;>=>: 6 5296032 >1;0ABL;535=4K 61 5296038 >1;0ABL;535=4K35>3@0D8G5A:>9AE5<K 58 5296099 >1;0ABL;535=4K4803@0<<K 74 5296157 >1;0ABL;535=4K4803@0<<K30=B0 69 5296231 >1;0ABL;535=4KA2>4=>94803@0<<K 49 5296300 >1;0ABL<0:5B0 8 5296349 >1;0ABL<0:5B0>D>@<;5=8O:><?>=>2:840==KE 69 5296357 >1;0ABL>D>@<;5=8O 65 5296426 >1;0ABL?5@5=5A5==>3>703>;>2:0H:0;K2@5<5=8 28 5296491 >1;0ABL?5G0B8 11 5296519 >1;0ABL?>4?8A8 18 5296530 >1;0ABL?>4?8A84803@0<<K 81 5296548 >1;0ABL?>8A:0 57 5296629 >1;0ABL?>AB@>5=8O 69 5296686 >1;0ABL?>AB@>5=8O35>3@0D8G5A:>9AE5<K 34 5296755 >1;0ABL?>AB@>5=8O45=4@>3@0<<K 94 5296789 >1;0ABL?>AB@>5=8O4803@0<<K 162 5296883 >1;0ABL?>AB@>5=8O4803@0<<K30=B0 119 5297045 >1;0ABL?>AB@>5=8OA2>4=>94803@0<<K 73 5297164 >1;0ABL?@85<=8: 6 5297237 >1;0ABL?@O<>C3>;L=0O 6 5297243 >1;0ABLAB@>: 6 5297249 >1;0ABLAB@>:0 6 5297255 >1;0ABLC@02=5=8O 9 5297261 >1;0ABLD>@<0B8@>20==>3>4>:C<5=B0 24 5297270 >1;0ABLN 88 5297294 >1;0ABLOG55: 12 5297382 >1;0ABLOG55:B01;8G=>3>4>:C<5=B0 736 5297394 >1;0ABO< 23 5298130 >1;0ABO<8 61 5298153 >1;0G=>< 10 5298214 >1;0G=><C 13 5298224 >1;0G=K9 28 5298237 >1;0G=KE 5 5298265 >1;53G05B 10 5298270 >1;53G0BL 10 5298280 >1;53G5=85 6 5298290 >1;53G5=8O 6 5298296 >1<5= 3386 5298302 >1<5=0 2014 5301688 >1<5=40==K<8 227 5303702 >1<5=40==K<8<>18;L=>3>:;85=B0 6 5303929 >1<5=40==K<8A>A=>2=K<A5@25@>< 9 5303935 >1<5=5 99 5303944 >1<5=820BLAO 6 5304043 >1<5=>2 4 5304049 >1<5=>< 75 5304053 >1<5=C 11 5304128 >1<5=D09;0<8A?5@A>=0;L=K<:><?LNB5@>< 9 5304139 >1=0@C65= 161 5304148 >1=0@C65=0 30 5304309 >1=0@C65=85 50 5304339 >1=0@C65=88 24 5304389 >1=0@C65=8O 25 5304413 >1=0@C65==>3> 4 5304438 >1=0@C65==K5 4 5304442 >1=0@C65==K9 361 5304446 >1=0@C65==KE 8 5304807 >1=0@C65=> 145 5304815 >1=0@C65=K 9 5304960 >1=0@C65=K>H81:8 19 5304969 >1=0@C68BL 10 5304988 >1=>28;8AL 5 5304998 >1=>28B 10 5305003 >1=>28B8 747 5305013 >1=>28B8AO 4 5305760 >1=>28BL 411 5305764 >1=>28BL03@530BK 17 5306175 >1=>28BL2D>=>2><@568<5 10 5306192 >1=>28BL8=45:A 14 5306202 >1=>28BL8=B5@D59A 19 5306216 >1=>28BL8=D>@<0F8N>?@8>1@5B5=88 24 5306235 >1=>28BL8AB>@8N 65 5306259 >1=>28BL<5AB>?>;>65=85 10 5306324 >1=>28BL=C<5@0F8N>1J5:B>2 11 5306334 >1=>28BL>B>1@065=8540==KE 12 5306345 >1=>28BL?>2B>@=>8A?>;L7C5<K57=0G5=8O 11 5306357 >1=>28BLA?8A:8>B7K20A5@B8D8:0B>2 22 5306368 >1=>28BLA?8A:8>B7K20A5@B8D8:0B>20A8=E 22 5306390 >1=>28BLAB@>:8 13 5306412 >1=>28BLAO 5 5306425 >1=>28BLB5:AB@540:B8@>20=8O 11 5306430 >1=>28BLM;5<5=Bdom 549 5306441 >1=>2;5= 4 5306990 >1=>2;5=85 1196 5306994 >1=>2;5=8581 6 5308190 >1=>2;5=858=45:A07025@H5=> 10 5308196 >1=>2;5=85:>=D83C@0F88107K40==KE 41 5308206 >1=>2;5=85< 4 5308247 >1=>2;5=85>B>1@065=8O 13 5308251 >1=>2;5=85?@54>?@545;5==KE 24 5308264 >1=>2;5=85?@54>?@545;5==KE40==KE 143 5308288 >1=>2;5=85?@887<5=5=8840==KE 26 5308431 >1=>2;5=85B5:AB0@540:B8@>20=8O 36 5308457 >1=>2;5=88 105 5308493 >1=>2;5=89 4 5308598 >1=>2;5=8O 607 5308602 >1=>2;5=8O:>?89107K40==KE 6 5309209 >1=>2;5=8O<8 60 5309215 >1=>2;5==>5 4 5309275 >1=>2;5==K5A53>4=OF5=K 6 5309279 >1=>2;5==K9 372 5309285 >1=>2;5==KE 5 5309657 >1=>2;5=> 301 5309662 >1=>2;5=K 50 5309963 >1=>2;5=L5 4 5310013 >1=>2;O5<K540==K5 13 5310017 >1=>2;O5<K9 14 5310030 >1=>2;O5<KE 4 5310044 >1=>2;O5B 241 5310048 >1=>2;O5BAO 39 5310289 >1=>2;OBL 304 5310328 >1=>2;OBL02B><0B8G5A:8 42 5310632 >1=>2;OBL8AB>@8N40==KEA@07C?>A;570?8A8 90 5310674 >1=>2;OBL8AB>@8NA@07C?>A;570?8A8 50 5310764 >1=>2;OBL?@887<5=5=88>B1>@0 33 5310814 >1=>2;OBL?@8=0;8G88@0AH8@5=8OA04@5A><ocsp 15 5310847 >1=>2;OBLAO 50 5310862 >1=>2;OBLM;5<5=BK 6 5310912 >1=>2;ONBAO 11 5310918 >1=C;5=85 5 5310929 >1=C;O5B 8 5310934 >1=C;OBL 8 5310942 >1> 9 5310950 >1>1I5=85 5 5310959 >1>1I5=8O 5 5310964 >1>1I5==>5 17 5310969 >1>1I5==>5:0G5AB2> 17 5310986 >1>1I5==K9 17 5311003 >1>53> 9 5311020 >1>7=0G05<K9 4 5311029 >1>7=0G05<KE 4 5311033 >1>7=0G05B 163 5311037 >1>7=0G0BL 185 5311200 >1>7=0G0NB 4 5311385 >1>7=0G0NI53> 47 5311389 >1>7=0G0NI55 17 5311436 >1>7=0G0NI59 60 5311453 >1>7=0G0NI85 26 5311513 >1>7=0G0NI89 155 5311539 >1>7=0G5=0 6 5311694 >1>7=0G5=85 42 5311700 >1>7=0G5=88 6 5311742 >1>7=0G5=8O 32 5311748 >1>7=0G5==>9 5 5311780 >1>7=0G5==K9 32 5311785 >1>7=0G5==KE 16 5311817 >1>7=0G5=K 5 5311833 >1>7=0G8BL 5 5311838 >1>8<8 33 5311843 >1>8<8A?>A>10<8 78 5311876 >1>8E 54 5311954 >1>945< 4 5312008 >1>945B 4 5312012 >1>9B8 11 5312016 >1>;>G:0 9 5312027 >1>;>G:0activedocument 19 5312036 >1>;>G:0html4>:C<5=B0 45 5312055 >1>;>G:8 4 5312100 >1>@0G8205B 4 5312104 >1>@0G820BL 4 5312108 >1>@>B 583 5312112 >1>@>B0 98 5312695 >1>@>B4B 69 5312793 >1>@>B:B 69 5312862 >1>@>B=>5 5 5312931 >1>@>B=>A0;L4>20O254><>ABL 5 5312936 >1>@>B=K9 6 5312941 >1>@>B=K< 5 5312947 >1>@>B>2 178 5312952 >1>@>BK 182 5313130 >1>@>BK4B:B 18 5313312 >1>@C4>20=85 8 5313330 >1>@C4>20=8N 4 5313338 >1>@C4>20=8O 4 5313342 >1@010BK205< 108 5313346 >1@010BK205<0O:0@B8=:0 76 5313454 >1@010BK205<>3> 12 5313530 >1@010BK205<>5 4 5313542 >1@010BK205<>9 54 5313546 >1@010BK205<K9 182 5313600 >1@010BK205<KE 4 5313782 >1@010BK205B 83 5313786 >1@010BK205BAO 62 5313869 >1@010BK20BL 311 5313931 >1@010BK20BL?@5@K20=85?>;L7>20B5;O 18 5314242 >1@010BK20BL@5:C@A82=> 19 5314260 >1@010BK20BLAO 117 5314279 >1@010BK20BLB5:ABK 10 5314396 >1@010BK20NB 9 5314406 >1@010BK20NBAO 36 5314415 >1@010BK20NI59 4 5314451 >1@010BK20NI85 4 5314455 >1@010BK20NI89 26 5314459 >1@010BK20NI8< 4 5314485 >1@01>B05B 9 5314489 >1@01>B0;8 89 5314498 >1@01>B0= 13 5314587 >1@01>B0=0 25 5314600 >1@01>B0==K9 135 5314625 >1@01>B0=> 41 5314760 >1@01>B0=K 56 5314801 >1@01>B0BL 180 5314857 >1@01>B0BL1>B>< 13 5315037 >1@01>B0BL:><0=4C 10 5315050 >1@01>B0BL=0:;85=B5 14 5315060 >1@01>B0BLB5:ABK 19 5315074 >1@01>B:0 3768 5315093 >1@01>B:00:B820F88 20 5318861 >1@01>B:00:B82870F88 11 5318881 >1@01>B:00:B82870F88>1J5:B0 18 5318892 >1@01>B:02=5H=53>A>1KB8O 43 5318910 >1@01>B:02A5EB8?>22E>4OI8E70?@>A>2?>45;8BLAO 9 5318953 >1@01>B:02K1>@0 171 5318962 >1@01>B:02K1>@020@80=B0 21 5319133 >1@01>B:02K1>@0H01;>=0A>>1I5=8OA8AB5<K2708<>459AB28O 11 5319154 >1@01>B:04>:C<5=B>2 23 5319165 >1@01>B:04>?>;=8B5;L=>9@0AH8D@>2:8 10 5319188 >1@01>B:0703@C7:8 17 5319198 >1@01>B:070?8A8=>2>3> 24 5319215 >1@01>B:070?8A8=>2>3>>1J5:B0 31 5319239 >1@01>B:070?>;=5=8O 206 5319270 >1@01>B:070?@>A0>1=>2;5=8O 11 5319476 >1@01>B:072>=:>2 9 5319487 >1@01>B:08=B5@0:B82=>90:B820F88 54 5319496 >1@01>B:0:0@B8=>: 21 5319550 >1@01>B:0:><0=4K 10 5319571 >1@01>B:0< 15 5319581 >1@01>B:0<5=5465@ 46 5319596 >1@01>B:0<8 10 5319642 >1@01>B:0=02830F8>==>9AAK;:8 41 5319652 >1@01>B:0=02830F8>==>9AAK;:8<=>65AB25==>3>7=0G5=8O 11 5319693 >1@01>B:0=060B8O 12 5319704 >1@01>B:0=060B8O:=>?:8?0=5;8:=>?>:A>>1I5=8OA8AB5<K2708<>459AB28O 14 5319716 >1@01>B:0=0AB@>5:2B>@>3>D0:B>@00CB5=B8D8:0F88 9 5319730 >1@01>B:0>1J5:B 85 5319739 >1@01>B:0>:>=G0=8O?><5I5=8O 9 5319824 >1@01>B:0>?>25I5=8O 35 5319833 >1@01>B:0>?>25I5=8O3;>10;L=0O 6 5319868 >1@01>B:0>B:;NG5=8O2=5H=59:><?>=5=BK?@8>H81:5 11 5319874 >1@01>B:0>B>1@065=8O>H81:8 16 5319885 >1@01>B:0>H81>: 15 5319901 >1@01>B:0?5@5E>40 11 5319916 >1@01>B:0?5@5E>40?>=02830F8>==>9AAK;:5 11 5319927 >1@01>B:0?>;CG5=8O40==KE2K1>@0 198 5319938 >1@01>B:0?>;CG5=8O=02830F8>==>9AAK;:8 21 5320136 >1@01>B:0?>;CG5=8O>?8A0=8O 22 5320157 >1@01>B:0?>;CG5=8O?>;59?@54AB02;5=8O 120 5320179 >1@01>B:0?>;CG5=8O?@54AB02;5=8O 120 5320299 >1@01>B:0?>;CG5=8OA?8A:0=02830F8>==KEAAK;>: 41 5320419 >1@01>B:0?>;CG5=8OD>@<K 252 5320460 >1@01>B:0?>;CG5=8OD>@<K2K1>@0?>;L7>20B5;59A8AB5<K2708<>459AB28O 23 5320712 >1@01>B:0?>A;570?8A825@A898AB>@8840==KE 167 5320735 >1@01>B:0?>ABC?;5=89 5 5320902 >1@01>B:0?@5@K20=8O?>;L7>20B5;O 13 5320907 >1@01>B:0?@83;0H5=8O2=5H=53>?>;L7>20B5;OA8AB5<K2708<>459AB28O 11 5320920 >1@01>B:0?@>15;L=KEA8<2>;>2xs 25 5320931 >1@01>B:0?@>2545=8O 27 5320956 >1@01>B:0?@>25@:82K?>;=5=8O 33 5320983 >1@01>B:0?@>25@:870?>;=5=8O 434 5321016 >1@01>B:0?@>25@:870?>;=5=8O=0A5@25@5 16 5321450 >1@01>B:0?@>4>;65=8O 7 5321466 >1@01>B:0@0AH8D@>2:8 143 5321473 >1@01>B:0@0AH8D@>2:8:><?>=>2:840==KE 131 5321616 >1@01>B:0A>45@68<>3>xs 25 5321747 >1@01>B:0A>>1I5=8OA8AB5<K2708<>459AB28O 18 5321772 >1@01>B:0A>E@0=5=8O 22 5321790 >1@01>B:0AB@>:8xml 13 5321812 >1@01>B:0B01;8G=0OG0ABL 6 5321825 >1@01>B:0B5:AB08=B5@=5B?>GB>2>3>A>>1I5=8O 28 5321831 >1@01>B:0C40;5=8O?@>2545=8O 12 5321859 >1@01>B:0CAB0=>2:8>?8A0=8O 22 5321871 >1@01>B:0D>@<8@>20=8O:><0=4 109 5321893 >1@01>B:0D>@<8@>20=8O:><0=42E>4OI53>70?@>A0?>45;8BLAO 11 5322002 >1@01>B:0D>@<8@>20=8O?>25@A888AB>@8840==KE 121 5322013 >1@01>B:5 337 5322134 >1@01>B:8 2458 5322471 >1@01>B:8<5=5465@ 25 5324929 >1@01>B:>9 27 5324954 >1@01>B:C 176 5324981 >1@01>B>: 100 5325157 >1@01>BG8: 5296 5325257 >1@01>BG8:0 2901 5330553 >1@01>BG8:0< 868 5333454 >1@01>BG8:0<8 14 5334322 >1@01>BG8:0E 103 5334336 >1@01>BG8:22>4040==KE?>;L7>20B5;O 5 5334439 >1@01>BG8:5 1436 5334444 >1@01>BG8:7025@H5=8OA:0=8@>20=8O 5 5335880 >1@01>BG8:70:@KB8OA>548=5=8O 14 5335885 >1@01>BG8:8 177 5335899 >1@01>BG8:8websocket:;85=BA>548=5=8O 51 5336076 >1@01>BG8:8A>1KB89 9 5336127 >1@01>BG8:>2 136 5336136 >1@01>BG8:>:>=G0=8O?><5I5=8O 8 5336272 >1@01>BG8:>:>=G0=8OA8=B570 5 5336280 >1@01>BG8:>< 81 5336285 >1@01>BG8:>AB0=>2:80C48>70?8A8 14 5336366 >1@01>BG8:>AB0=>2:82>A?@>872545=8O 14 5336380 >1@01>BG8:>B:@KB8OA>548=5=8O 14 5336394 >1@01>BG8:>H81:8 14 5336408 >1@01>BG8:?>;CG5=8OA>>1I5=8O 23 5336422 >1@01>BG8:@0A?>7=020=8O 5 5336445 >1@01>BG8:@57C;LB0B>2?@>25@:8 5 5336450 >1@01>BG8:A:0=8@>20=8O 10 5336455 >1@01>BG8:A>1KB8O 7 5336465 >1@01>BG8:C 80 5336472 >1@07 774 5336552 >1@070 38 5337326 >1@075F 47 5337364 >1@07>202H55AO 5 5337411 >1@07>202H89AO 5 5337416 >1@07>20==K9 10 5337421 >1@07>20==KE 6 5337431 >1@07>20BL 67 5337437 >1@07>20BLAO 33 5337504 >1@07>2K20BL 5 5337537 >1@07>< 736 5337542 >1@07C5<K9 4 5338278 >1@07C5BAO 28 5338282 >1@07CNB 44 5338310 >1@07CNI0O 22 5338354 >1@07CNI0OAO 4 5338376 >1@07CNI59 8 5338380 >1@07CNI89 32 5338388 >1@07CNI89AO 4 5338420 >1@07CNI8<8 4 5338424 >1@07CNI8E 10 5338428 >1@07CO 5 5338438 >1@07F0 17 5338443 >1@07F>2 4 5338460 >1@07F>2K9 4 5338464 >1@07FK 10 5338468 >1@0<;OBL 5 5338478 >1@0B82H8AL 8 5338483 >1@0B8< 9 5338491 >1@0B8<K9 9 5338500 >1@0B8B5 30 5338509 >1@0B8BL 43 5338539 >1@0B8BLAO 52 5338582 >1@0B=0O 4 5338634 >1@0B=0OAAK;:0 18 5338638 >1@0B=> 45 5338656 >1@0B=>5 42 5338701 >1@0B=>9 19 5338743 >1@0B=>< 13 5338762 >1@0B=CN 8 5338775 >1@0B=K5 79 5338783 >1@0B=K9 162 5338862 >1@0B=K904@5A 19 5339024 >1@0I05BAO 5 5339043 >1@0I0;8AL 45 5339048 >1@0I0BLAO 174 5339093 >1@0I0NBAO 4 5339267 >1@0I0NI89AO 6 5339271 >1@0I0NI8EAO 6 5339277 >1@0I5=85 4401 5339283 >1@0I5=85< 11 5343684 >1@0I5=88 203 5343695 >1@0I5=89 37 5343898 >1@0I5=8O 2245 5343935 >1@0I5=8OE 6 5346180 >1@0I5=L5 37 5346186 >1@570=0 54 5346223 >1@570==>3> 4 5346277 >1@570==K9 62 5346281 >1@570=K 4 5346343 >1@570BL 37 5346347 >1@570BLAO 8 5346384 >1A;C6820=85 37 5346392 >1A;C6820=8O 33 5346429 >1A;C6820BL 23 5346462 >1A;C6820NI89 8 5346485 >1AB>OB5;LAB20E 33 5346493 >1AB>OB5;LAB2> 33 5346526 >1AC645=85 521 5346559 >1AC645=85< 13 5347080 >1AC645=85A8AB5<K2708<>459AB28O 87 5347093 >1AC645=88 43 5347180 >1AC645=89 62 5347223 >1AC645=8N 8 5347285 >1AC645=8O 295 5347293 >1AC645=8OA8AB5<K2708<>459AB28O 9 5347588 >1AC645=8OE 8 5347597 >1AC645=L5 62 5347605 >1E>4 2097 5347667 >1E>40 247 5349764 >1E>445@520dom 84 5350011 >1E>45 1429 5350095 >1E>48< 72 5351524 >1E>48B 5 5351596 >1E>48B8 76 5351601 >1E>48BL 153 5351677 >1E>48BLAAK;:8=0ACI=>AB8 20 5351830 >1E>48BLAO 9 5351850 >1E>4>< 10 5351859 >1E>4@57C;LB0B070?@>A0 59 5351869 >1E>4OBAO 9 5351928 >1EV4 10 5351937 >1I0O 44 5351947 >1I0O:0@B8=:0 256 5351991 >1I0O:><0=40 312 5352247 >1I0OA5@8O 9 5352559 >1I0OA5@8O@07<5@0?C7K@L:0 32 5352568 >1I0OD>@<0 13 5352600 >1I53> 1509 5352613 >1I54>ABC?=CN 4 5354122 >1I54>ABC?=K9 4 5354126 >1I55 1879 5354130 >1I59 70 5356009 >1I5< 156 5356079 >1I5<C 7 5356235 >1I5?@8=OB>< 3 5356242 >1I5?@8=OBK9 3 5356245 >1I85 139 5356248 >1I858B>38 13 5356387 >1I858B>38?>25@B8:0;8 6 5356400 >1I858B>38?>25@B8:0;8A?8A:0 6 5356406 >1I85:0@B8=:8 9 5356412 >1I85:><0=4K 9 5356421 >1I85<0:5BK 14 5356430 >1I85<>4C;8 9 5356444 >1I85=0AB@>9:8 7 5356453 >1I85@5:2878BK 9 5356460 >1I85D>@<K 9 5356469 >1I89 2645 5356478 >1I898B>3 35 5359123 >1I898B>3703>;>2>: 9 5359158 >1I898B>3?>420; 9 5359167 >1I89<0:5B 35 5359176 >1I89<>4C;L 371 5359211 >1I89<>4C;L1 20 5359582 >1I89@5:2878B 451 5359602 >1I8< 81 5360053 >1I8<8 11 5360134 >1I8E 692 5360145 >1ICN 147 5360837 >1J548=5= 14 5360984 >1J548=5=0 10 5360998 >1J548=5=85 508 5361008 >1J548=5=857025@H5==>AB8?@>AB>3>B8?0xs 41 5361516 >1J548=5=857025@H5==>AB8A>AB02=>3>B8?0xs 35 5361557 >1J548=5=857025@H5==>AB8AE5<Kxs 47 5361592 >1J548=5=8570?@5I5==KE?>4AB0=>2>:xs 40 5361639 >1J548=5=858A:;NG5=893@C???>4AB0=>2:8xs 40 5361679 >1J548=5=85:>;>=>: 9 5361719 >1J548=5=85< 4 5361728 >1J548=5=85=54>?CAB8<KE?>4AB0=>2:8xs 45 5361732 >1J548=5=85AB@>: 9 5361777 >1J548=5=88 125 5361786 >1J548=5=8N 6 5361911 >1J548=5=8O 106 5361917 >1J548=5==0O 9 5362023 >1J548=5==>3> 10 5362032 >1J548=5==>9 4 5362042 >1J548=5==CN 6 5362046 >1J548=5==K5 17 5362052 >1J548=5==K9 116 5362069 >1J548=5==KE 39 5362185 >1J548=5=K 10 5362224 >1J548=8BL 109 5362234 >1J548=8BL2A5 9 5362343 >1J548=8BLD09;K 25 5362352 >1J548=8BLG0AB8G=K5 16 5362377 >1J548=O5<K5 10 5362393 >1J548=O5<K9 22 5362403 >1J548=O5<K<8 9 5362425 >1J548=O5<KE 11 5362434 >1J548=O5B 29 5362445 >1J548=O5BAO 8 5362474 >1J548=OBL 39 5362482 >1J548=OBL?>25@B8:0;8 5 5362521 >1J548=OBL?>3>@87>=B0;8 5 5362526 >1J548=OBLAO 113 5362531 >1J548=ONBAO 87 5362644 >1J548=OO 5 5362731 >1J5:B 29939 5362736 >1J5:B1 10 5392675 >1J5:B2 10 5392685 >1J5:Bxdto 226 5392695 >1J5:B0 14695 5392921 >1J5:B0< 454 5407616 >1J5:B0<8 133 5408070 >1J5:B0=0;87040==KE 54 5408203 >1J5:B0E 48 5408257 >1J5:B2;045;5F 13 5408305 >1J5:B40==KE 6 5408318 >1J5:B5 191 5408324 >1J5:B70?8AL 37 5408515 >1J5:B:0@BK 5 5408552 >1J5:B:>?8@>20=8O 54 5408557 >1J5:B<4 7 5408611 >1J5:B<5B040==KE 14207 5408618 >1J5:B<5B040==KE:>=D83C@0F8O 749 5422825 >1J5:B=0AB@>9:82;045;5F 5 5423574 >1J5:B=0O 21 5423579 >1J5:B=>3> 4 5423600 >1J5:B=>9 37 5423604 >1J5:B=CN 35 5423641 >1J5:B=K5 14 5423676 >1J5:B=K540==K5 35 5423690 >1J5:B=K9 205 5423725 >1J5:B=K<8 5 5423930 >1J5:B=KE 80 5423935 >1J5:B>2 4516 5424015 >1J5:B>< 679 5428531 >1J5:B>?8A0=8O<5B040==>3> 5 5429210 >1J5:B>A=>20=85 15 5429215 >1J5:B>B1>@0284>2E0@0:B5@8AB8: 9 5429230 >1J5:B?5@5@0AG5B0 69 5429239 >1J5:B?5@5E>40 5 5429308 >1J5:B?>8A:0 15 5429313 >1J5:B@0AH8@O5<>9:>=D83C@0F88 683 5429328 >1J5:BA@02=5=8O 28 5430011 >1J5:BAAK;:0 23 5430039 >1J5:BAE5<K 12 5430062 >1J5:BB5:CI59AB@>:8A?8A:0 9 5430074 >1J5:BC 3074 5430083 >1J5:BK 1463 5433157 >1J5:BK87<5=5=8970?>;=5=8O:>?89107K40==KE 6 5434620 >1J5:BK:;0AB5@870F88 9 5434626 >1J5:BK<5B040==KE 12 5434635 >1J5:BKA;>O35>3@0D8G5A:>9AE5<K 34 5434647 >1J5< 391 5434681 >1J5<0 121 5435072 >1J5<0< 4 5435193 >1J5<0<8 8 5435197 >1J5<0E 5 5435205 >1J5<40==KE70?8A0==KE=048A: 22 5435210 >1J5<40==KE70?8A0==KE=048A:2A53> 11 5435232 >1J5<40==KE70?8A0==KE=048A:705<8= 11 5435243 >1J5<40==KE70?8A0==KE=048A:B5:CI55 11 5435254 >1J5<40==KE?5@540==KE8?>;CG5==KE:;85=B>< 11 5435265 >1J5<40==KE?5@540==KE8?>;CG5==KE:;85=B><705<8= 11 5435276 >1J5<40==KE?5@540==KE8?>;CG5==KEAC14 22 5435287 >1J5<40==KE?5@540==KE8?>;CG5==KEAC142A53> 11 5435309 >1J5<40==KE?5@540==KE8?>;CG5==KEAC14705<8= 11 5435320 >1J5<40==KEAG8B0==KEA48A:0 22 5435331 >1J5<40==KEAG8B0==KEA48A:02A53> 11 5435353 >1J5<40==KEAG8B0==KEA48A:0705<8=CB 11 5435364 >1J5<40==KEAG8B0==KEA48A:0B5:CI55 11 5435375 >1J5<5 40 5435386 >1J5<=0 6 5435426 >1J5<=0O 36 5435432 >1J5<=>9 25 5435468 >1J5<=K9 102 5435493 >1J5<=K< 4 5435595 >1J5<=KE 37 5435599 >1J5<>< 5 5435636 >1J5<?0<OB8 6 5435641 >1J5<?@>406 9 5435647 >1J5<C 5 5435656 >1J5<C40;5==KE40==KE 9 5435661 >1J5<E@0=8<KE40==KE 9 5435670 >1J5<E@0=8<KE40==KE=048A:5 9 5435679 >1J5<K 4 5435688 >1J5ABL 262 5435692 >1J:B5 4 5435954 >1J:BC 5 5435958 >1JO28BL 5 5435963 >1JO2;5= 8 5435968 >1JO2;5=85 473 5435976 >1JO2;5=85xml 57 5436449 >1JO2;5=850B@81CB0 25 5436506 >1JO2;5=850B@81CB0xs 919 5436531 >1JO2;5=85=>B0F88 9 5437450 >1JO2;5=85=>B0F88xs 850 5437459 >1JO2;5=85M;5<5=B0 9 5438309 >1JO2;5=85M;5<5=B0xs 980 5438318 >1JO2;5=88 45 5439298 >1JO2;5=89 31 5439343 >1JO2;5=8O 250 5439374 >1JO2;5=8O0B@81CB>2 16 5439624 >1JO2;5=8O=>B0F89 16 5439640 >1JO2;5=8OM;5<5=B>2 16 5439656 >1JO2;5==>9 3 5439672 >1JO2;5==K5 25 5439675 >1JO2;5==K9 48 5439700 >1JO2;5==KE 5 5439748 >1JO2;5=K 7 5439753 >1JO2;5=L5 31 5439760 >1JO2;O5<K9 8 5439791 >1JO2;O5<KE 8 5439799 >1JO2;OBLAO 12 5439807 >1JO2;ONBAO 12 5439819 >1JQ<=0O 4 5439831 >1KG=0O 113 5439835 >1KG=0O3@C??0 26 5439948 >1KG=0O:=>?:0 22 5439974 >1KG=> 124 5439996 >1KG=>3> 159 5440120 >1KG=>5 132 5440279 >1KG=>52K45;5=85 9 5440411 >1KG=>5?@8;>65=85 128 5440420 >1KG=>9 185 5440548 >1KG=>< 72 5440733 >1KG=><C 10 5440805 >1KG=CN 12 5440815 >1KG=K5 40 5440827 >1KG=K9 1054 5440867 >1KG=K9H@8DBB5:AB0 11 5441921 >1KG=K< 33 5441932 >1KG=K<8 4 5441965 >1KG=KE 76 5441969 >1O70==>ABL 5 5442045 >1O70==>ABO<8 5 5442050 >1O70B5;5= 47 5442055 >1O70B5;L=0O 14 5442102 >1O70B5;L=> 353 5442116 >1O70B5;L=>3> 42 5442469 >1O70B5;L=>5 28 5442511 >1O70B5;L=>58A?>;L7>20=852=5H=53>C?@02;5=8OA50=A0<8 47 5442539 >1O70B5;L=>5A>548=5=85 9 5442586 >1O70B5;L=>9 4 5442595 >1O70B5;L=>AB8 40 5442599 >1O70B5;L=>ABL 55 5442639 >1O70B5;L=K 12 5442694 >1O70B5;L=K5 10 5442706 >1O70B5;L=K5=01>@K40==KE 22 5442716 >1O70B5;L=K9 18595 5442738 >1O70B5;L=K< 34 5461333 >1O70B5;L=K<8 8 5461367 >2 13 5461375 >20; 13 5461388 >20;0 4 5461401 >25@ 4 5461405 >3>=5: 12 5461409 >3@0=8G5= 101 5461421 >3@0=8G5=0 244 5461522 >3@0=8G5=85 1591 5461766 >3@0=8G5=857=0G5=8Oxs 30 5463357 >3@0=8G5=858A?>;L7>20=8O 84 5463387 >3@0=8G5=858A?>;L7>20=8O4>ABC?=>3>?0@0<5B@0:><?>=>2:840==KE 23 5463471 >3@0=8G5=858A?>;L7>20=8O4>ABC?=>3>?>;O:><?>=>2:840==KE 93 5463494 >3@0=8G5=858A?>;L7>20=8O?>;OAE5<K:><?>=>2:840==KE 57 5463587 >3@0=8G5=858A?>;L7>20=8O@5:2878B>2 38 5463644 >3@0=8G5=85< 26 5463682 >3@0=8G5=85>1J5<0?0<OB8@01>G8E?@>F5AA>2 11 5463708 >3@0=8G5=85?>2B>@5=8O?0@>;59?>;L7>20B5;59A@548?>A;54=8E 36 5463719 >3@0=8G5=85?>2B>@5=8O?0@>;59A@548?>A;54=8E 63 5463755 >3@0=8G5=85?>:>;8G5AB2C>H81>:?@>F5AA0 11 5463818 >3@0=8G5=85?>?0<OB8?@>F5AA0 11 5463829 >3@0=8G5=85?@>AB@0=AB28<5= 12 5463840 >3@0=8G5=85@07<5@0 11 5463852 >3@0=8G5=85B8?0 26 5463863 >3@0=8G5=85CA;>285< 9 5463889 >3@0=8G5=88 24 5463898 >3@0=8G5=89 319 5463922 >3@0=8G5=8N 9 5464241 >3@0=8G5=8O 822 5464250 >3@0=8G5=8O845=B8G=>AB8 11 5465072 >3@0=8G5=8O8A?>;L7>20=8O 48 5465083 >3@0=8G5=8O8A?>;L7>20=8O4>ABC?=KE?0@0<5B@>2:><?>=>2:840==KE 75 5465131 >3@0=8G5=8O8A?>;L7>20=8O4>ABC?=KE?>;59:><?>=>2:840==KE 95 5465206 >3@0=8G5=8O< 14 5465301 >3@0=8G5=8O<8 28 5465315 >3@0=8G5=8OE 76 5465343 >3@0=8G5==0O 14 5465419 >3@0=8G5==>3> 3 5465433 >3@0=8G5==>5 14 5465436 >3@0=8G5==>9 4 5465450 >3@0=8G5==CN 13 5465454 >3@0=8G5==K9 214 5465467 >3@0=8G5==K< 10 5465681 >3@0=8G5==K<8 51 5465691 >3@0=8G5=> 205 5465742 >3@0=8G5=L5 319 5465947 >3@0=8G8205B 30 5466266 >3@0=8G8205BAO 13 5466296 >3@0=8G820BL 75 5466309 >3@0=8G820BL:>;8G5AB2>C@>2=59 14 5466384 >3@0=8G820BL?>;CG5=85?>;59?>AAK;:0<?>?@02C?@>A<>B@ 6 5466398 >3@0=8G820BLAB@>:C?>8A:0 105 5466404 >3@0=8G820BLAO 17 5466509 >3@0=8G820NBAO 4 5466526 >3@0=8G820NI53> 18 5466530 >3@0=8G820NI55 8 5466548 >3@0=8G820NI59 4 5466556 >3@0=8G820NI85 15 5466560 >3@0=8G820NI89 64 5466575 >3@0=8G820NI89?@O<>C3>;L=8: 73 5466639 >3@0=8G820NI8E 9 5466712 >3@0=8G820O 28 5466721 >3@0=8G8BL 28 5466749 >3@0=8G8BLAO 4 5466777 >45640 83 5466781 >4564K 60 5466864 >45@60I89 6 5466924 >48= 4785 5466930 >48=0:>20 28 5471715 >48=0:>20O 10 5471743 >48=0:>20OH8@8=0:>;>=>: 13 5471753 >48=0:>20OH8@8=0M;5<5=B>2 13 5471766 >48=0:>2> 8 5471779 >48=0:>2>3> 4 5471787 >48=0:>2>5 178 5471791 >48=0:>2>9 518 5471969 >48=0:>2CN 219 5472487 >48=0:>2K 4 5472706 >48=0:>2K5 79 5472710 >48=0:>2K9 1231 5472789 >48=0:>2K< 294 5474020 >48=0:>2K<8 188 5474314 >48=0:>2KE 210 5474502 >48=0@=0O 28 5474712 >48=0@=89 10 5474740 >48=0@=>9 4 5474750 >48=0@=><C 10 5474754 >48=0@=K5 25 5474764 >48=0@=K9 107 5474789 >48=0@=K< 4 5474896 >48=0@=K<8 6 5474900 >48=0@=KE 28 5474906 >48=>G=89 5 5474934 >48=>G=>3> 5 5474939 >48=>G=>5 10 5474944 >48=>G=K9 108 5474954 >48=>G=K9C75;7=0G5=85 9 5475062 >48=>G=KE 6 5475071 >48=@07 9 5475077 >4=0 1833 5475086 >4=0:> 143 5476919 >4=8 944 5477062 >4=8< 916 5478006 >4=8E 10 5478922 >4=> 3008 5478932 >4=>1C:25==>5 6 5481940 >4=>1C:25==K9 6 5481946 >4=>2@5<5==> 135 5481952 >4=>2@5<5==>3> 10 5482087 >4=>2@5<5==>5 16 5482097 >4=>2@5<5==>9 18 5482113 >4=>2@5<5==>< 6 5482131 >4=>2@5<5==K9 167 5482137 >4=>3> 1435 5482304 >4=>7=0G5=85 13 5483739 >4=>7=0G=89 12 5483752 >4=>7=0G=> 98 5483764 >4=>7=0G=>3> 12 5483862 >4=>7=0G=>5 4 5483874 >4=>7=0G=K9 114 5483878 >4=>8<5==>3> 41 5483992 >4=>8<5==>5 10 5484033 >4=>8<5==K5 20 5484043 >4=>8<5==K9 146 5484063 >4=>8<5==K< 33 5484209 >4=>8<5==K<8 59 5484242 >4=>8<5==KE 6 5484301 >4=>9 595 5484307 >4=>:04@>20O 5 5484902 >4=>:04@>2K9 5 5484907 >4=>:@0B=0O 8 5484912 >4=>:@0B=89 19 5484920 >4=>:@0B=> 31 5484939 >4=>:@0B=>3> 19 5484970 >4=>:@0B=K9 47 5484989 >4=>< 213 5485036 >4=><5@=K9 25 5485249 >4=><C 144 5485274 >4=>@07>2K9 4 5485418 >4=>@07>2K9?0@>;L 9 5485422 >4=>@>4=>9 5 5485431 >4=>@>4=K9 5 5485436 >4=>AB@>G=>3> 8 5485441 >4=>AB@>G=>9 4 5485449 >4=>AB@>G=K9 24 5485453 >4=>AB@>G=KE 8 5485477 >4=>B8?=K9 15 5485485 >4=>B8?=K<8 6 5485500 >4=>B8?=KE 9 5485506 >4=>B>==0O 5 5485515 >4=>B>==>9 5 5485520 >4=>B>==K9 7 5485525 >4=C 506 5485532 >68405<>3> 22 5486038 >68405<>52@5<O2K?>;=5=8O 9 5486060 >68405<><C 5 5486069 >68405<K5 4 5486074 >68405<K9 42 5486078 >68405<K9D>@<0B40BK 7 5486120 >68405B 107 5486127 >68405BAO 32 5486234 >6840=85 301 5486266 >6840=8N 12 5486567 >6840=8O 270 5486579 >6840BL 167 5486849 >6840BL7025@H5=8O 30 5487016 >6840BL7025@H5=8O2K?>;=5=8O 36 5487046 >6840BL70:@KB85 10 5487082 >6840BL>B>1@065=85>1J5:B0 10 5487092 >6840BLA>AB>O=8O 10 5487102 >6840BLAO 32 5487112 >6840BLD>@<8@>20=8O2K?040NI53>A?8A:0 10 5487144 >6840NB 4 5487154 >7=0:><8;AO 5 5487158 >7=0:><8BLAO 21 5487163 >7=0G05B 759 5487184 >7=0G0BL 887 5487943 >7=0G0NI53> 5 5488830 >7=0G0NI85 5 5488835 >7=0G0NI89 117 5488840 >7=0G8B8 18 5488957 >9 8 5488975 >: 59 5488983 >:065BAO 22 5489042 >:070;8AL 6 5489064 >:070;AO 16 5489070 >:070BLAO 54 5489086 >:07K205B 29 5489140 >:07K205BAO 15 5489169 >:07K20;8AL 5 5489184 >:07K20BL 249 5489189 >:07K20BLAO 20 5489438 >:07K20NB 210 5489458 >:0=B>2:0 63 5489668 >:0=B>2:8 12 5489731 >:0=G820NI85AO 7 5489743 >:0=G820NI89AO 36 5489750 >:0=G820NI8<8AO 6 5489786 >:0=G820NI8EAO 34 5489792 >:;04 15 5489826 >:=0 831 5489841 >:=0:;85=BA:>3>?@8;>65=8O 24 5490672 >:=0<8 10 5490696 >:=0E 22 5490706 >:=5 229 5490728 >:=> 1514 5490957 >:=>2=5H=53>A09B0 9 5492471 >:=>:;85=BA:>3>?@8;>65=8O 103 5492480 >:=>< 39 5492583 >:=>>?>25I5=8O 10 5492622 >:=>A>AB>O=8O 8 5492632 >:=C 53 5492640 >:=K 138 5492693 >:>;> 62 5492831 >:>= 106 5492893 >:>==K9 44 5492999 >:>=G0=85 1006 5493043 >:>=G0=8522>40B5:AB0 35 5494049 >:>=G0=85< 15 5494084 >:>=G0=85?5@5B0A:820=8O 118 5494099 >:>=G0=85?5@8>40 6 5494217 >:>=G0=88 196 5494223 >:>=G0=8N 6 5494419 >:>=G0=8O 758 5494425 >:>=G0B5;L=> 4 5495183 >:>=G0B5;L=>5 40 5495187 >:>=G0B5;L=>9 4 5495227 >:>=G0B5;L=K9 48 5495231 >:>=G8BL 14 5495279 >:>B<5=0 18 5495293 >:@ 45 5495311 >:@15:0:10 9 5495356 >:@15:0:20 38 5495365 >:@0H8205<0O 4 5495403 >:@0H8205<K9 4 5495407 >:@C3 4 5495411 >:@C30 4 5495415 >:@C3;5=85 63 5495419 >:@C3;5=85< 5 5495482 >:@C3;5=88 14 5495487 >:@C3;5=8O 37 5495501 >:@C3;5==0OF5=0 7 5495538 >:@C3;5=> 8 5495545 >:@C3;89 7 5495553 >:@C3;8< 7 5495560 >:@C3;8B8 8 5495567 >:@C3;8BL 7 5495575 >:@C3;O5<>5 5 5495582 >:@C3;O5B 11 5495587 >:@C3;O5BAO 40 5495598 >:@C3;OBL 11 5495638 >:@C3;OBLAO 40 5495649 >:@C60NI53> 40 5495689 >:@C60NI55 40 5495729 >:@C60NI59 4 5495769 >:@C60NI89 44 5495773 >:@C6=>AB8 8 5495817 >:@C6=>ABL 14 5495825 >;0 4 5495839 >;820 12 5495843 >;82:>2> 5 5495855 >;82:>2K9 18 5495860 >;8F5B2>@ONI55 6 5495878 >;8F5B2>@ONI89 6 5495884 >;O 4 5495890 >< 5 5495894 ><0= 12 5495899 ><0=0 12 5495911 >= 1950 5495923 >=0 817 5497873 >=8 1152 5498690 >=;09= 10 5499842 >=> 2747 5499852 >>> 7 5502599 >? 16 5502606 >?1 20 5502622 >?2 25 5502642 >?0A=>AB8 8 5502667 >?0A=>ABL 8 5502675 >?0A=K9 197 5502683 >?0A=K< 10 5502880 >?0A=KE 187 5502890 >?5@0=4 52 5503077 >?5@0=40 7 5503129 >?5@0=4>2 22 5503136 >?5@0=4C 5 5503158 >?5@0=4K 7 5503163 >?5@0B82=0O 5 5503170 >?5@0B82=0O?0<OBL 19 5503175 >?5@0B82=89 14 5503194 >?5@0B82=>3> 14 5503208 >?5@0B82=>5 22 5503222 >?5@0B82=>5?@>2545=85 37 5503244 >?5@0B82=>9 122 5503281 >?5@0B82=>< 4 5503403 >?5@0B82=CN 17 5503407 >?5@0B82=K9 177 5503424 >?5@0B>@ 3385 5503601 >?5@0B>@0 2433 5506986 >?5@0B>@0<8 17 5509419 >?5@0B>@0E 10 5509436 >?5@0B>@2K1@0BLAE5<K70?@>A0 88 5509446 >?5@0B>@5 19 5509534 >?5@0B>@=K9 15 5509553 >?5@0B>@=KE 15 5509568 >?5@0B>@>2 101 5509583 >?5@0B>@C 981 5509684 >?5@0B>@K 133 5510665 >?5@0B>@KAE5<K70?@>A0 49 5510798 >?5@0F859 4 5510847 >?5@0F88 715 5510851 >?5@0F89 281 5511566 >?5@0F8>==0O 790 5511847 >?5@0F8>==>9 716 5512637 >?5@0F8>==K9 790 5513353 >?5@0F8>==KE 109 5514143 >?5@0F8N 41 5514252 >?5@0F8O 1226 5514293 >?5@0F8OwebA5@28A0 297 5515519 >?5@0F8O< 8 5515816 >?5@0F8O<8 27 5515824 >?5@0F8OE 33 5515851 >?5@545;O5BAO 4 5515884 >?5@5605B 20 5515888 >?5@560BL 20 5515908 >?5@8@>20BL 70 5515928 >?8@0BLAO 5 5515998 >?8@0OAL 5 5516003 >?8A02 5 5516008 >?8A0= 267 5516013 >?8A0=0 15 5516280 >?8A0=85 109691 5516295 >?8A0=852=5H=59A8AB5<KA8AB5<K2708<>459AB28O 19 5625986 >?8A0=852@5<5==>9B01;8FKAE5<K70?@>A0 29 5626005 >?8A0=853>;>A0A8=B570@5G8 34 5626034 >?8A0=8570I8BK>B>?0A=KE459AB289 46 5626068 >?8A0=857=0G5=8O 7 5626114 >?8A0=857=0G5=8O?0@0<5B@03>;>A0A8=B570@5G8 20 5626121 >?8A0=8587<5=5=89:>=D83C@0F882A>>1I5=88>1<5=0 34 5626141 >?8A0=858A?>;L7>20=8O 24 5626175 >?8A0=858A?>;L7>20=8OA>1KB8O4>ABC?6C@=0;0@538AB@0F88 40 5626199 >?8A0=858A?>;L7>20=8OA>1KB8O>B:0724>ABC?56C@=0;0@538AB@0F88 35 5626239 >?8A0=858AB>G=8:040==KE 38 5626274 >?8A0=85:><0=4K2E>4OI53>70?@>A0?>45;8BLAO 37 5626312 >?8A0=85:><0=4K?;0=8@>2I8:0 36 5626349 >?8A0=85:><0=4K?>;O22>40 40 5626385 >?8A0=85:><0=4K?>;O?;0=8@>2I8:0 45 5626425 >?8A0=85:><0=4KA8AB5<K2708<>459AB28O 41 5626470 >?8A0=85:>=D83C@0F88 37 5626511 >?8A0=85< 64 5626548 >?8A0=85<0:5B0>1;0AB8<0:5B0:><?>=>2:840==KE 73 5626612 >?8A0=85<0:5B0AE5<K:><?>=>2:840==KE 72 5626685 >?8A0=85<5B040==>3> 5 5626757 >?8A0=85<>45;8@0A?>7=020=8O@5G8 58 5626762 >?8A0=85=0AB@>5: 123 5626820 >?8A0=85>1=>2;5=8O 4 5626943 >?8A0=85>1=>2;5=8O:>=D83C@0F88 23 5626947 >?8A0=85>1@01>B:8@0AH8D@>2:8:><?>=>2:840==KE 39 5626970 >?8A0=85>?>25I5=8O 1842 5627009 >?8A0=85>?>25I5=8O>7025@H5=88 155 5628851 >?8A0=85>?>25I5=8O>70:@KB88 102 5629006 >?8A0=85>?>25I5=8O>E>452K?>;=5=8O 69 5629108 >?8A0=85>?>25I5=8O?5@54=0G0;>< 65 5629177 >?8A0=85>?>25I5=8O?5@54=0G0;><?><5I5=8OD09;0 7 5629242 >?8A0=85>?>25I5=8O?5@54=0G0;><?><5I5=8OD09;>2 7 5629249 >?8A0=85>B>1@0605<>3>>1J5:B0 25 5629256 >?8A0=85>B>1@0605<>3>>1J5:B0pdf 58 5629281 >?8A0=85>H81:8 177 5629339 >?8A0=85?0;8B@KF25B>2 44 5629516 >?8A0=85?0;8B@KF25B>24803@0<<K 70 5629560 >?8A0=85?0;8B@KF25B>28=D>@<0F8>==KE8=B5@20;>2 32 5629630 >?8A0=85?0@0<5B@02=5H=59A8AB5<KA8AB5<K2708<>459AB28O 19 5629662 >?8A0=85?0@0<5B@03>;>A0A8=B570@5G8 38 5629681 >?8A0=85?0@0<5B@070?@>A0 18 5629719 >?8A0=85?0@0<5B@>270?@>A0 28 5629737 >?8A0=85?5@540205<>3>D09;0 69 5629765 >?8A0=85?5@540==>3>D09;0 70 5629834 >?8A0=85?>4?8A8 25 5629904 >?8A0=85?>4?8A8pdf 107 5629929 >?8A0=85?><5I5==>3>D09;0 55 5630036 >?8A0=85A8AB5<K;8=59=KEC@02=5=89 45 5630091 >?8A0=85AB0=40@B=>3>@5:2878B0 167 5630136 >?8A0=85AB0=40@B=>9B01;8G=>9G0AB8 53 5630303 >?8A0=85AB@>:8 47 5630356 >?8A0=85B8?>2 510 5630403 >?8A0=85B8?>2A 7 5630913 >?8A0=85B8?>2G 6 5630920 >?8A0=85E0@0:B5@8AB8: 78 5630926 >?8A0=85G8A;> 14 5631004 >?8A0=85M;5<5=B0A?8A:02K1>@0=02830F8>==>9AAK;:8 28 5631018 >?8A0=88 140 5631046 >?8A0=88>?>25I5=8O 5 5631186 >?8A0=89 90 5631191 >?8A0=8N 69 5631281 >?8A0=8O 2042 5631350 >?8A0=8O4>ABC? 9 5633392 >?8A0=8O<0:5B>2>1;0AB59<0:5B0:><?>=>2:840==KE 80 5633401 >?8A0=8O<0:5B>2AE5<K:><?>=>2:840==KE 75 5633481 >?8A0=8O<8 47 5633556 >?8A0=8O<>45;59@0A?>7=020=8O@5G8 9 5633603 >?8A0=8O>B:0724>ABC?5 8 5633612 >?8A0=8O?0@0<5B@>2 9 5633620 >?8A0=8O?5@540205<KED09;>2 18 5633629 >?8A0=8O?>4?8A59 5 5633647 >?8A0=8OA8AB5< 21 5633652 >?8A0=8OA8AB5<;8=59=KEC@02=5=89 62 5633673 >?8A0=8OAB0=40@B=KE@5:2878B>2 86 5633735 >?8A0=8OAB0=40@B=KEB01;8G=KEG0AB59 13 5633821 >?8A0=8OE 61 5633834 >?8A0=8OE0@0:B5@8AB8: 60 5633895 >?8A0==0O 12 5633955 >?8A0==>9 13 5633967 >?8A0==>< 6 5633980 >?8A0==CN 13 5633986 >?8A0==K5 48 5633999 >?8A0==K9 524 5634047 >?8A0==K< 14 5634571 >?8A0==KE 37 5634585 >?8A0=> 57 5634622 >?8A0=K 28 5634679 >?8A0=L5 90 5634707 >?8A0B5;L 5 5634797 >?8A0B5;O 5 5634802 >?8A0B8 152 5634807 >?8A0BL 63 5634959 >?8A:0 5 5635022 >?8AK205<K9 15 5635027 >?8AK205<KE 5 5635042 >?8AK205B 1111 5635047 >?8AK205BAO 171 5636158 >?8AK20BL 1530 5636329 >?8AK20BLAO 944 5637859 >?8AK20NB 200 5638803 >?8AK20NBAO 777 5639003 >?8AK20NI0O 26 5639780 >?8AK20NI59 12 5639806 >?8AK20NI85 45 5639818 >?8AK20NI89 772 5639863 >?8AK20NI8E 483 5640635 >?8AK20NICN 4 5641118 >?;0B0 10 5641122 >?;0BC 10 5641132 >?>25AB8BL 35 5641142 >?>25AB8BL>10:B82870F88 15 5641177 >?>25AB8BL>10:B82870F88>1J5:B0 19 5641192 >?>25AB8BL>187<5=5=88 13 5641211 >?>25AB8BL>2K1>@5 44 5641224 >?>25AB8BL>70?8A8=>2>3> 20 5641268 >?>25AB8BL>70?8A8=>2>3>>1J5:B0 24 5641288 >?>25I05B 4 5641312 >?>25I05BAO 4 5641316 >?>25I0BL 38 5641320 >?>25I0BLAO 4 5641358 >?>25I0NI0O 4 5641362 >?>25I0NI89 4 5641366 >?>25I5=85 411 5641370 >?>25I5=85A8AB5<K2708<>459AB28O 14 5641781 >?>25I5=88 10 5641795 >?>25I5=89 55 5641805 >?>25I5=8N 9 5641860 >?>25I5=8O 194 5641869 >?>25I5=L5 55 5642063 >?>740=85 46 5642118 >?>7=0= 5 5642164 >?>7=0==K9 5 5642169 >?>@=0O 36 5642174 >?>@=>9 8 5642210 >?>@=K9 60 5642218 >?@545;5= 366 5642278 >?@545;5=0 132 5642644 >?@545;5=85 1759 5642776 >?@545;5=85xpath 9 5644535 >?@545;5=850;3>@8B<0E5H8@>20=8O 9 5644544 >?@545;5=850;3>@8B<0H8D@>20=8O 9 5644553 >?@545;5=85107>2>3>B8?0 24 5644562 >?@545;5=853@C??K0B@81CB>2 9 5644586 >?@545;5=853@C??K0B@81CB>2xs 886 5644595 >?@545;5=853@C??K<>45;8 9 5645481 >?@545;5=853@C??K<>45;8xs 874 5645490 >?@545;5=85< 4 5646364 >?@545;5=85>3@0=8G5=8O845=B8G=>AB8 9 5646368 >?@545;5=85>3@0=8G5=8O845=B8G=>AB8xs 879 5646377 >?@545;5=85?@8<8B82=>3>B8?0 12 5647256 >?@545;5=85?@>AB>3>B8?0 157 5647268 >?@545;5=85?@>AB>3>B8?0xs 1038 5647425 >?@545;5=85A>AB02=>3>B8?0 9 5648463 >?@545;5=85A>AB02=>3>B8?0xs 1011 5648472 >?@545;5=85B8?0 24 5649483 >?@545;5=85B8?04>:C<5=B0 1670 5649507 >?@545;5=85B8?04>:C<5=B0dom 850 5651177 >?@545;5=85B8?0M;5<5=B0 12 5652027 >?@545;5=88 62 5652039 >?@545;5=89 259 5652101 >?@545;5=8N 29 5652360 >?@545;5=8O 1034 5652389 >?@545;5=8Oxpathxs 859 5653423 >?@545;5=8O3@C??0B@81CB>2 16 5654282 >?@545;5=8O3@C??<>45;59 16 5654298 >?@545;5=8O>3@0=8G5=89845=B8G=>AB8 16 5654314 >?@545;5=8OB8?>2 16 5654330 >?@545;5=8OB8?>2>1J548=5=8O 11 5654346 >?@545;5==0O 17 5654357 >?@545;5==> 4 5654374 >?@545;5==>3> 90 5654378 >?@545;5==>5 18 5654468 >?@545;5==>9 109 5654486 >?@545;5==>< 19 5654595 >?@545;5==><C 65 5654614 >?@545;5==CN 54 5654679 >?@545;5==K 5 5654733 >?@545;5==K5 216 5654738 >?@545;5==K9 1022 5654954 >?@545;5==K< 227 5655976 >?@545;5==K<8 4 5656203 >?@545;5==KE 98 5656207 >?@545;5=> 311 5656305 >?@545;5=K 930 5656616 >?@545;5=L5 259 5657546 >?@545;8< 13 5657805 >?@545;8<K9 13 5657818 >?@545;8B 4 5657831 >?@545;8BL 531 5657835 >?@545;8BL>?B8<0;L=K503@530BK 17 5658366 >?@545;8BLAO 16 5658383 >?@545;O5<0O 9 5658399 >?@545;O5<>3> 9 5658408 >?@545;O5<>9 21 5658417 >?@545;O5<>< 25 5658438 >?@545;O5<CN 5 5658463 >?@545;O5<K5 4 5658468 >?@545;O5<K5B8?K 9 5658472 >?@545;O5<K9 170 5658481 >?@545;O5<K9B8? 241 5658651 >?@545;O5<K< 8 5658892 >?@545;O5<KE 37 5658900 >?@545;O5B 6448 5658937 >?@545;O5BAO 3869 5665385 >?@545;O5BO 4 5669254 >?@545;OB 9 5669258 >?@545;OBAO 16 5669267 >?@545;OBL 6693 5669283 >?@545;OBLAO 4264 5675976 >?@545;ONB 47 5680240 >?@545;ONBAO 359 5680287 >?@545;ONI0O 161 5680646 >?@545;ONI55 55 5680807 >?@545;ONI59 5 5680862 >?@545;ONI85 13 5680867 >?@545;ONI89 396 5680880 >?@545;ONI8E 53 5681276 >?@545;ONICN 5 5681329 >?@545;OO 6 5681334 >?@545;Q==>9 8 5681340 >?@545;Q==K9 4 5681348 >?@>A 4 5681352 >?A0 15 5681356 >?B 14 5681371 >?B8<0;L=0O 10 5681385 >?B8<0;L=89 10 5681395 >?B8<0;L=>5 18 5681405 >?B8<0;L=K5 8 5681423 >?B8<0;L=K9 134 5681431 >?B8<0;L=KE 9 5681565 >?B8<870F88 13 5681574 >?B8<870F8O 13 5681587 >?B8<878@>20= 6 5681600 >?B8<878@>20==>3> 4 5681606 >?B8<878@>20==K9 39 5681610 >?B8<878@>20=> 29 5681649 >?B>2>< 50 5681678 >?B>2CN 6 5681728 >?B>2K9 56 5681734 >?C1;8:>20= 53 5681790 >?C1;8:>20==K9 64 5681843 >?C1;8:>20==KE 6 5681907 >?C1;8:>20=> 5 5681913 >?CA 4 5681918 >?CA:0BL 9 5681922 >?CAB8B8 6 5681931 >?CI5= 57 5681937 >?CI5=0 5 5681994 >?CI5==K9 73 5681999 >?CI5==K< 3 5682072 >?CI5=> 6 5682075 >?CI5=K 5 5682081 >?F88 98 5682086 >?F89 103 5682184 >?F8>=0;L=> 18 5682287 >?F8>=0;L=>5 4 5682305 >?F8>=0;L=K9 27 5682309 >?F8>=0;L=K< 5 5682336 >?F8N 4 5682341 >?F8O 206 5682345 >?F8O< 15 5682551 >?F8O<8 7 5682566 >?KB 3 5682573 >?KB0 3 5682576 >?KB=>9 5 5682579 >?KB=K9 5 5682584 >@0=6520O 9 5682589 >@0=65289 11 5682598 >@0=652> 5 5682609 >@0=652>3> 5 5682614 >@0=652>:@0A=K9 12 5682619 >@0=652K9 38 5682631 >@30=870B>@ 14 5682669 >@30=870B>@0 4 5682683 >@30=870F859 5 5682687 >@30=870F88 124 5682692 >@30=870F89 5 5682816 >@30=870F8>==K5 4 5682821 >@30=870F8>==K9 4 5682825 >@30=870F8O 299 5682829 >@30=87>20= 4 5683128 >@30=87>20==>9 4 5683132 >@30=87>20==K5 4 5683136 >@30=87>20==K9 124 5683140 >@30=87>20==KE 112 5683264 >@30=87>20BL 6 5683376 >@30=87>20BLAO 15 5683382 >@30=87>2K20BL 12 5683397 >@30=87C5BAO 15 5683409 >@3B5E=8:0 18 5683424 >@45@ 569 5683442 >@48=0@ 18 5684011 >@48=0B 31 5684029 >@48=0B0 39 5684060 >@48=0BK 8 5684099 >@838=0; 9 5684107 >@838=0;L=>3> 5 5684116 >@838=0;L=>5 4 5684121 >@838=0;L=>9 16 5684125 >@838=0;L=K5 4 5684141 >@838=0;L=K9 65 5684145 >@838=0;L=KE 32 5684210 >@85=B0F88 98 5684242 >@85=B0F8N 77 5684340 >@85=B0F8O 345 5684417 >@85=B0F8O45=4@>3@0<<K 29 5684762 >@85=B0F8O4803@0<<K 19 5684791 >@85=B0F8O<5B>:3>@87>=B0;L=>9H:0;K 13 5684810 >@85=B0F8O<5B>:A2>4=>94803@0<<K 24 5684823 >@85=B0F8O?>4?8A59 13 5684847 >@85=B0F8O?>4?8A594803@0<<K 33 5684860 >@85=B0F8OAB@0=8FK 51 5684893 >@85=B0F8OB5:AB0 50 5684944 >@85=B0F8OM;5<5=B0D>@<K 23 5684994 >@85=B8@>20= 17 5685017 >@85=B8@>20=85 4 5685034 >@85=B8@>20=8O 4 5685038 >@85=B8@>20==K5 4 5685042 >@85=B8@>20==K9 41 5685046 >@85=B8@>20=K 20 5685087 >@8O 14 5685107 >@><> 16 5685121 >@E845O 23 5685137 >@E845O=59B@0;L=K9 12 5685160 >@E845OB5<=K9 12 5685172 >A 334 5685184 >A0 334 5685518 >A25I5= 4 5685852 >A25I5==>AB8 14 5685856 >A25I5==>ABL 14 5685870 >A25I5==K9 7 5685884 >A25I5=K 3 5685891 >A2>1>482H85AO 12 5685894 >A2>1>482H89AO 12 5685906 >A2>1>48BL 6 5685918 >A2>1>6405B 46 5685924 >A2>1>6405BAO 17 5685970 >A2>1>640BL 46 5685987 >A2>1>640BL02B><0B8G5A:8 9 5686033 >A2>1>640BLAO 19 5686042 >A2>1>640NBAO 8 5686061 >A2>1>645= 5 5686069 >A2>1>645=85 16 5686074 >A2>1>645=85< 4 5686090 >A2>1>645=8O 12 5686094 >A2>1>645==K9 17 5686106 >A2>1>645=K 12 5686123 >A2>@30=870F88 5 5686135 >A59 4 5686140 >A5=L 10 5686144 >A8 283 5686154 >A<>B@8B5;L=> 60 5686437 >A<>B@8B5;L=K9 60 5686497 >A<KA;5==K9 5 5686557 >A<KA;5==K<8 5 5686562 >A=>20 532 5686567 >A=>20=0 4 5687099 >A=>20=85 1395 5687103 >A=>20=85< 64 5688498 >A=>20=88 1201 5688562 >A=>20=8O 55 5689763 >A=>20=8O<8 5 5689818 >A=>20==K9 4 5689823 >A=>25 532 5689827 >A=>2=0O 837 5690359 >A=>2=0O?0=5;L 21 5691196 >A=>2=0OAE5<0:><?>=>2:840==KE 13 5691217 >A=>2=0OB01;8F0 9 5691230 >A=>2=0OD>@<0 47 5691239 >A=>2=0OD>@<020@80=B0 9 5691286 >A=>2=0OD>@<020@80=B0>BG5B0 9 5691295 >A=>2=0OD>@<02K1>@0?>;L7>20B5;59A8AB5<K2708<>459AB28O 14 5691304 >A=>2=0OD>@<03@C??K 18 5691318 >A=>2=0OD>@<040==KE25@A888AB>@8840==KE 9 5691336 >A=>2=0OD>@<04;O2K1>@0 99 5691345 >A=>2=0OD>@<04;O2K1>@03@C??K 18 5691444 >A=>2=0OD>@<0703@C7:8 13 5691462 >A=>2=0OD>@<070?8A8 27 5691475 >A=>2=0OD>@<08AB>@8887<5=5=898AB>@8840==KE 9 5691502 >A=>2=0OD>@<0:>=AB0=B 9 5691511 >A=>2=0OD>@<0=0AB@>5: 9 5691520 >A=>2=0OD>@<0=0AB@>5:48=0<8G5A:>3>A?8A:0 9 5691529 >A=>2=0OD>@<0=0AB@>5:>BG5B0 9 5691538 >A=>2=0OD>@<0>1J5:B0 90 5691547 >A=>2=0OD>@<0>BG5B0 10 5691637 >A=>2=0OD>@<0?>8A:0 10 5691647 >A=>2=0OD>@<0@07;8G8925@A898AB>@8840==KE 10 5691657 >A=>2=0OD>@<0A>E@0=5=8O 13 5691667 >A=>2=0OD>@<0A?8A:0 144 5691680 >A=>2=89 458 5691824 >A=>2=>3> 440 5692282 >A=>2=>5 1017 5692722 >A=>2=>5459AB285 20 5693739 >A=>2=>5>:=> 9 5693759 >A=>2=>5?@54AB02;5=85 54 5693768 >A=>2=>5?@54AB02;5=852840@0AG5B0 30 5693822 >A=>2=>5?@54AB02;5=852840E0@0:B5@8AB8:8 30 5693852 >A=>2=>5?@54AB02;5=857040G8 30 5693882 >A=>2=>5?@54AB02;5=85?;0=0>1<5=0 30 5693912 >A=>2=>5?@54AB02;5=85A?@02>G=8:0 30 5693942 >A=>2=>5?@54AB02;5=85AG5B0 30 5693972 >A=>2=>5A@54AB2> 21 5694002 >A=>2=>9 2884 5694023 >A=>2=>9ip?>@B 29 5696907 >A=>2=>98=B5@D59A 84 5696936 >A=>2=>9<0:5B>D>@<;5=8O>BG5B0 10 5697020 >A=>2=>9>B1>@ 9 5697030 >A=>2=>9>B1>@?>?5@8>4C 9 5697039 >A=>2=>9@0745; 7 5697048 >A=>2=>9@538AB@ 6 5697055 >A=>2=>9@568<70?CA:0 14 5697061 >A=>2=>9@5:2878B04@5A0F88 25 5697075 >A=>2=>9A5@25@ 9 5697100 >A=>2=>9A5@25@4>ABC?5= 11 5697109 >A=>2=>9AB8;L 14 5697120 >A=>2=>9O7K: 14 5697134 >A=>2=>< 81 5697148 >A=>2=><C 18 5697229 >A=>2=CN 52 5697247 >A=>2=K5 77 5697299 >A=>2=K540==K5 22 5697376 >A=>2=K5=0G8A;5=8O 15 5697398 >A=>2=K5=0G8A;5=8O>@3 11 5697413 >A=>2=K5=0G8A;5=8OA>B@C4=8:>2 22 5697424 >A=>2=K5=0G8A;5=8OA>B@C4=8:>2>@3 5 5697446 >A=>2=K5=0G8A;5=8OA>B@C4=8:>2>@30=870F88 26 5697451 >A=>2=K5=0G8A;5=8OA>B@C4=8:>2>@30=870F89 17 5697477 >A=>2=K5@>;8 178 5697494 >A=>2=K5A@54AB20 5 5697672 >A=>2=K9 2884 5697677 >A=>2=K< 267 5700561 >A=>2=KE 180 5700828 >A=>2K20BLAO 11 5701008 >A=>2K20OAL 11 5701019 >A>10O 6 5701030 >A>15==> 6 5701036 >A>15==>AB59 48 5701042 >A>15==>AB8 74 5701090 >A>15==>ABL 218 5701164 >A>15==>ABO<8 76 5701382 >A>15==K9 140 5701458 >A>15==K< 134 5701598 >A>1>3> 5 5701732 >A>1CN 15 5701737 >A>1K9 91 5701752 >A>1K< 69 5701843 >AB020BLAO 183 5701912 >AB028; 5 5702095 >AB028B8 12 5702100 >AB028BL 9 5702112 >AB02;5==K9 11 5702121 >AB02;5=K 11 5702132 >AB02;O5B 4 5702143 >AB02;OBL 12 5702147 >AB02H59AO 4 5702159 >AB02H85AO 15 5702163 >AB02H89AO 59 5702178 >AB02H8EAO 30 5702237 >AB05BAO 75 5702267 >AB0;8AL 5 5702342 >AB0;>AL 10 5702347 >AB0;AO 7 5702357 >AB0;L=>5 13 5702364 >AB0;L=>9 18 5702377 >AB0;L=CN 30 5702395 >AB0;L=K5 726 5702425 >AB0;L=K< 13 5703151 >AB0;L=K<8 4 5703164 >AB0;L=KE 562 5703168 >AB0=02;8205<KE 10 5703730 >AB0=02;8205B 40 5703740 >AB0=02;8205BAO 12 5703780 >AB0=02;820BL 40 5703792 >AB0=02;820BLAO 20 5703832 >AB0=02;820NBAO 8 5703852 >AB0=5BAO 18 5703860 >AB0=>28BAO 5 5703878 >AB0=>28BL 44 5703883 >AB0=>28BL2>A?@>872545=850C48> 10 5703927 >AB0=>28BL2>A?@>872545=85B5:AB0 10 5703937 >AB0=>28BL>1@01>B:C 10 5703947 >AB0=>28BL?>B>:>2>5@0A?>7=020=85 10 5703957 >AB0=>28BLA8=B57 10 5703967 >AB0=>28BLAO 5 5703977 >AB0=>2:0 28 5703982 >AB0=>2:5 13 5704010 >AB0=>2:8 18 5704023 >AB0=>2;5= 28 5704041 >AB0=>2;5==K9 41 5704069 >AB0=>2;5=> 13 5704110 >AB0=CBAO 215 5704123 >AB0B0B>: 5 5704338 >AB0B:0 83 5704343 >AB0B:0E 10 5704426 >AB0B:8 317 5704436 >AB0B:88>1>@>BK 24 5704753 >AB0B:8=><5=:;0BC@K 10 5704777 >AB0B:8B>20@>2 6 5704787 >AB0B:8B>20@>2:><?0=88 5 5704793 >AB0B:>2 228 5704798 >AB0B:>< 16 5705026 >AB0B>: 796 5705042 >AB0B>:4B 38 5705838 >AB0B>::B 38 5705876 >AB0B>:B>20@0 6 5705914 >AB0BLAO 277 5705920 >AB0NBAO 99 5706197 >AB>@>6=>ABL 6 5706296 >AB>@>6=K9 12 5706302 >AB>@>6=K< 12 5706314 >AB@>2 18 5706326 >AB@>20 18 5706344 >AB@V2 18 5706362 >ACI5AB28<K9 5 5706380 >ACI5AB28<K< 5 5706385 >ACI5AB28BL 31 5706390 >ACI5AB2;5= 214 5706421 >ACI5AB2;5=0 100 5706635 >ACI5AB2;5=85 84 5706735 >ACI5AB2;5=85< 5 5706819 >ACI5AB2;5=88 4 5706824 >ACI5AB2;5=8O 75 5706828 >ACI5AB2;5==> 4 5706903 >ACI5AB2;5==K9 324 5706907 >ACI5AB2;5=> 10 5707231 >ACI5AB2;O5<>3> 13 5707241 >ACI5AB2;O5<>9 8 5707254 >ACI5AB2;O5<K9 33 5707262 >ACI5AB2;O5<KE 12 5707295 >ACI5AB2;O5B 1316 5707307 >ACI5AB2;O5BAO 2655 5708623 >ACI5AB2;O;0AL 4 5711278 >ACI5AB2;OBL 1363 5711282 >ACI5AB2;OBLAO 3002 5712645 >ACI5AB2;ONBAO 4 5715647 >ACI5AB2;ONI89 8 5715651 >AL 322 5715659 >AL4803@0<<K 75 5715981 >AL7=0G5=89 52 5716056 >ALB>G5: 32 5716108 >ALN 4 5716140 >AO 318 5716144 >AOE 9 5716462 >B 8849 5716471 >B18@05<>5 31 5725320 >B18@05<K9 31 5725351 >B18@05B 5 5725382 >B18@0BL 47 5725387 >B18@0BLAO 107 5725434 >B18@0NBAO 107 5725541 >B1>@ 3838 5725648 >B1>@0 1851 5729486 >B1>@0E 28 5731337 >B1>@20;NB 8 5731365 >B1>@3@C??8@>2>: 33 5731373 >B1>@3@C??8@>2>:A85@0@E859 33 5731406 >B1>@3@C??8@>2>:B>;L:>85@0@E8O 33 5731439 >B1>@5 143 5731472 >B1>@70?8A59 55 5731615 >B1>@8A>@B8@>2:0 12 5731670 >B1>@:>;8G5AB2> 7 5731682 >B1>@:><?>=>2:840==KE 226 5731689 >B1>@:><?>=>2:840==KE=54>ABC?=K9 12 5731915 >B1>@>1AC645=89A8AB5<K2708<>459AB28O 70 5731927 >B1>@>2 51 5731997 >B1>@>< 107 5732048 >B1>@?>20;NB5 7 5732155 >B1>@?>284C 12 5732162 >B1>@?>;L7>20B5;59A8AB5<K2708<>459AB28O 78 5732174 >B1>@?>B5:CI5<C7=0G5=8N 12 5732252 >B1>@?>B>20@C 15 5732264 >B1>@A>>1I5=89A8AB5<K2708<>459AB28O 35 5732279 >B1>@AB@>: 82 5732314 >B1>@C 233 5732396 >B1>@K 28 5732629 >B1@0 4 5732657 >B2545==>9 17 5732661 >B2545==>< 4 5732678 >B2545==CN 12 5732682 >B2545==K9 33 5732694 >B25@305B 5 5732727 >B25@30BL 5 5732732 >B25B 312 5732737 >B25B0 220 5733049 >B25B5 16 5733269 >B25B8BL 7 5733285 >B25B=>3> 4 5733292 >B25B=K9 8 5733296 >B25B=KE 4 5733304 >B25B>2 10 5733308 >B25B>< 8 5733318 >B25BAB25==>3> 16 5733326 >B25BAB25==>ABL 6 5733342 >B25BAB25==K9 21 5733348 >B25BF5=B@0;8F5=78@>20=8O 10 5733369 >B25G05B 272 5733379 >B25G0BL 290 5733651 >B25G0NI53> 5 5733941 >B25G0NI5<C 4 5733946 >B25G0NI85 38 5733950 >B25G0NI89 90 5733988 >B25G0NI8<8 10 5734078 >B25G0NI8E 37 5734088 >B25G5==>5 10 5734125 >B2>48<>5 4 5734135 >B2>48<K9 4 5734139 >B2>48BL 8 5734143 >B3@C60;AO 5 5734151 >B3@C60BLAO 5 5734156 >B3@C65==K9 7 5734161 >B3@C65=> 7 5734168 >B4020BLAO 5 5734175 >B405BAO 5 5734180 >B45; 73 5734185 >B45;0 4 5734258 >B45;0< 6 5734262 >B45;5==K5 5 5734268 >B45;5==K9 5 5734273 >B45;C 6 5734278 >B45;L=0O 9 5734284 >B45;L=0O:>;>=:0 9 5734293 >B45;L=> 75 5734302 >B45;L=>3> 30 5734377 >B45;L=>5 4 5734407 >B45;L=>8B>;L:>28B>30E 20 5734411 >B45;L=>9 104 5734431 >B45;L=>< 37 5734535 >B45;L=>AB8 5 5734572 >B45;L=>ABL 5 5734577 >B45;L=CN 29 5734582 >B45;L=K5 54 5734611 >B45;L=K5>:=0 9 5734665 >B45;L=K9 679 5734674 >B45;L=K< 66 5735353 >B45;L=KE 280 5735419 >B45;O5BAO 13 5735699 >B45;OBL 11 5735712 >B45;OBLAO 18 5735723 >B45;ONBAO 5 5735741 >B5F 10 5735746 >B7K2 74 5735756 >B7K20 62 5735830 >B7K2>2 6 5735892 >B7K2>< 5 5735898 >B7K2K 5 5735903 >B:065BAO 15 5735908 >B:07 2603 5735923 >B:070 1468 5738526 >B:070;AO 151 5739994 >B:070BLAO 372 5740145 >B:0724>ABC?5 16 5740517 >B:075 48 5740533 >B:07>B?><5I5=8O2A5ED09;>2 39 5740581 >B:07>B?><5I5=8OD09;0 60 5740620 >B:07>CAB>9G82>3> 4 5740680 >B:07>CAB>9G82>AB8 10 5740684 >B:07>CAB>9G82>ABL 10 5740694 >B:07>CAB>9G82K9 4 5740704 >B:0B 8 5740708 >B:0B5 8 5740716 >B:;04K205<K5 8 5740724 >B:;04K205<K9 12 5740732 >B:;04K205<KE 4 5740744 >B:;04K205BAO 20 5740748 >B:;04K20BLAO 70 5740768 >B:;04K20NBAO 53 5740838 >B:;>=5=0 5 5740891 >B:;>=5=85 23 5740896 >B:;>=5=8O 6 5740919 >B:;>=5==K9 41 5740925 >B:;>=5=> 36 5740966 >B:;NG05<>9 14 5741002 >B:;NG05<K9 14 5741016 >B:;NG05B 169 5741030 >B:;NG05BAO 37 5741199 >B:;NG0BL 169 5741236 >B:;NG0BLAO 37 5741405 >B:;NG5= 901 5741442 >B:;NG5=0 57 5742343 >B:;NG5=85 124 5742400 >B:;NG5=852=5H=59:><?>=5=BK?@8>H81:5 24 5742524 >B:;NG5=88 13 5742548 >B:;NG5=8O 39 5742561 >B:;NG5==K9 1030 5742600 >B:;NG5==KE 15 5743630 >B:;NG5=> 41 5743645 >B:;NG5=K 20 5743686 >B:;NG8BL 63 5743706 >B:;NG8BL0:B82=>5A:0=8@>20=85 15 5743769 >B:;NG8BL0C48>70?8AL 15 5743784 >B:;NG8BL4>ABC?=>ABL 9 5743799 >B:;NG8BL>1@01>BG8: 10 5743808 >B:;NG8BL>1@01>BG8:smsA>>1I5=89 12 5743818 >B:;NG8BL>1@01>BG8:459AB28OA>>1I5=8O 15 5743830 >B:;NG8BL>1@01>BG8:70?@>A0=0AB@>5::;85=B0;8F5=78@>20=8O 11 5743845 >B:;NG8BL>1@01>BG8:70?@>A0=0AB@>9:8:;85=B0;8F5=78@>20=8O 5 5743856 >B:;NG8BL>1@01>BG8:72>=:>2 12 5743861 >B:;NG8BL>1@01>BG8:87<5=5=8O40==KE 19 5743873 >B:;NG8BL>1@01>BG8:87<5=5=8O4>ABC?=>AB8?@>20945@>2 10 5743892 >B:;NG8BL>1@01>BG8:87<5=5=8O8=B5@=5BA>548=5=8O 10 5743902 >B:;NG8BL>1@01>BG8:87<5=5=8O<5AB>?>;>65=8O 10 5743912 >B:;NG8BL>1@01>BG8:87<5=5=8OA>AB>O=8O 22 5743922 >B:;NG8BL>1@01>BG8:=>2KEA>>1I5=890A8=E 16 5743944 >B:;NG8BL>1@01>BG8:>6840=8O 55 5743960 >B:;NG8BL>1@01>BG8:>:>=G0=8OCAB0=>2:8 10 5744015 >B:;NG8BL>1@01>BG8:>?>25I5=8O 23 5744025 >B:;NG8BL>1@01>BG8:?5@5A5G5=8O3@0=8F>BA;568205<KE35>7>= 10 5744048 >B:;NG8BL>1@01>BG8:?>A;5>B?@02:8A>>1I5=8O 10 5744058 >B:;NG8BL>1@01>BG8:A>>1I5=89 14 5744068 >B:;NG8BL>1@01>BG8:C254><;5=89 10 5744082 >B:;NG8BL>1@01>BG8:D>@<8@>20=8O:><0=4 10 5744092 >B:;NG8BL>B1>@ 12 5744102 >B:;NG8BL>B<5B:C=570?>;=5==>3> 11 5744114 >B:;NG8BL>BA;56820=852A5E35>7>= 10 5744125 >B:;NG8BL>BA;56820=8535>7>= 10 5744135 >B:;NG8BLAO 63 5744145 >B:@>5BAO 18 5744208 >B:@K205<>3> 79 5744226 >B:@K205<>9 779 5744305 >B:@K205<>< 15 5745084 >B:@K205<CN 5 5745099 >B:@K205<K9 884 5745104 >B:@K205<KE 6 5745988 >B:@K205B 489 5745994 >B:@K205BAO 303 5746483 >B:@K20;0AL 13 5746786 >B:@K20BL 1093 5746799 >B:@K20BLAO 343 5747892 >B:@K20NB 4 5748235 >B:@K20NBAO 15 5748239 >B:@K20NI53> 9 5748254 >B:@K20NI59 40 5748263 >B:@K20NI8E 12 5748303 >B:@K2H5<C 9 5748315 >B:@K2H89 9 5748324 >B:@KB 149 5748333 >B:@KB0 246 5748482 >B:@KB0;83@C??0 12 5748728 >B:@KB0O 453 5748740 >B:@KB85 1362 5749193 >B:@KB85< 33 5750555 >B:@KB85<=>65AB25==>3>7=0G5=8O 11 5750588 >B:@KB88 555 5750599 >B:@KB8O 546 5751154 >B:@KB> 96 5751700 >B:@KB>3> 69 5751796 >B:@KB>5 6 5751865 >B:@KB>9 76 5751871 >B:@KB>< 26 5751947 >B:@KB><C 16 5751973 >B:@KB>AB8 4 5751989 >B:@KB>ABL 4 5751993 >B:@KBCN 25 5751997 >B:@KBK 14 5752022 >B:@KBK5 35 5752036 >B:@KBK9 1529 5752071 >B:@KBK9:;NG 9 5753600 >B:@KBK< 17 5753609 >B:@KBK<8 25 5753626 >B:@KBKE 684 5753651 >B:@KBL 995 5754335 >B:@KBL0A8=E 143 5755330 >B:@KBL2;>65=85 9 5755473 >B:@KBL2K?040NI89A?8A>: 10 5755482 >B:@KBL4;O4>?8AK20=8O 18 5755492 >B:@KBL4;O4>?8AK20=8O0A8=E 23 5755510 >B:@KBL4;O70?8A8 24 5755533 >B:@KBL4;O70?8A80A8=E 23 5755557 >B:@KBL4;OGB5=8O 23 5755580 >B:@KBL4;OGB5=8O0A8=E 23 5755603 >B:@KBL7=0G5=85 48 5755626 >B:@KBL7=0G5=850A8=E 21 5755674 >B:@KBL8;8A>740BL 9 5755695 >B:@KBL8=45:AA?@02:8 12 5755704 >B:@KBL<>40;L=> 119 5755716 >B:@KBL?>B>: 82 5755835 >B:@KBL?>B>:4;OGB5=8O 59 5755917 >B:@KBL?>B>:4;OGB5=8O0A8=E 18 5755976 >B:@KBLA02B>=><=>3>A5@25@0 12 5755994 >B:@KBLA>45@60=85A?@02:8 12 5756006 >B:@KBLA>548=5=85 14 5756018 >B:@KBLA>A=>2=>3>A5@25@0 12 5756032 >B:@KBLA?8A>: 6 5756044 >B:@KBLA?@02:C 18 5756050 >B:@KBLA?@02:CD>@<K 23 5756068 >B:@KBLAO 18 5756091 >B:@KBLC@>25=L 11 5756109 >B:@KBLD09; 300 5756120 >B:@KBLD>@<C 38 5756420 >B:@KBLD>@<C<>40;L=> 33 5756458 >B:C40 73 5756491 >B;04:0 166 5756564 >B;04:8 144 5756730 >B;04G8: 17 5756874 >B;04G8:0 17 5756891 >B;8G05B 11 5756908 >B;8G05BAO 378 5756919 >B;8G0BL 11 5757297 >B;8G0BLAO 447 5757308 >B;8G0NBAO 22 5757755 >B;8G0NI89AO 21 5757777 >B;8G0NI8<AO 15 5757798 >B;8G0NI8EAO 6 5757813 >B;8G5= 9 5757819 >B;8G85 364 5757828 >B;8G85< 15 5758192 >B;8G89 10 5758207 >B;8G8O 22 5758217 >B;8G8O<8 9 5758239 >B;8G=0O 14 5758248 >B;8G==K5 5 5758262 >B;8G=> 57 5758267 >B;8G=>3> 4 5758324 >B;8G=>5 135 5758328 >B;8G=>< 14 5758463 >B;8G=K 5 5758477 >B;8G=K5 60 5758482 >B;8G=K9 1293 5758542 >B;8G=K< 651 5759835 >B;8G=K<8 8 5760486 >B;8G=KE 235 5760494 >B;8GL5 10 5760729 >B;>65==>3> 28 5760739 >B;>65==>5 21 5760767 >B;>65==K9 43 5760788 >B;>68BL8A?>;=5=85 9 5760831 >B<5=0 363 5760840 >B<5=0?@>2545=8O 26 5761203 >B<5=0@540:B8@>20=8O 59 5761229 >B<5=5 78 5761288 >B<5=5= 9 5761366 >B<5=5=0 125 5761375 >B<5=5==>5 10 5761500 >B<5=5==K9 292 5761510 >B<5=5=> 126 5761802 >B<5=5=>?>;L7>20B5;5< 12 5761928 >B<5=5=K 22 5761940 >B<5=8; 14 5761962 >B<5=8B 6 5761976 >B<5=8BL 138 5761982 >B<5=8BL;>:0;L=K5C254><;5=8O 10 5762120 >B<5=8BL>B;>65==>5@0A?>7=020=85 10 5762130 >B<5=8BL?>4?8A:C=0?>GB>2K9OI8: 10 5762140 >B<5=8BL?>8A: 12 5762150 >B<5=8BL?@5>1@07>20=854>:C<5=B0 13 5762162 >B<5=8BL@538AB@0F8N8=D>@<0F8>==>9107K 18 5762175 >B<5=8BL@538AB@0F8N8=D>@<0F8>==>9107K0A8=E 18 5762193 >B<5=8BL@540:B8@>20=85 20 5762211 >B<5=8BLA>2<5AB=>58A?>;L7>20=85?@8;>65=8901>=5=B0 10 5762231 >B<5=8BLA>>B25BAB285?@>AB@0=AB208<5= 10 5762241 >B<5=8BLB@0=70:F8N 41 5762251 >B<5=8BLC40;5=85A>>1I5=89 16 5762292 >B<5==K9 9 5762308 >B<5=>9 14 5762317 >B<5=C 18 5762331 >B<5=K 37 5762349 >B<5=O5B 392 5762386 >B<5=O5BAO 57 5762778 >B<5=OBL 392 5762835 >B<5=OBLAO 61 5763227 >B<5=ONBAO 4 5763288 >B<5=ONI55 5 5763292 >B<5=ONI89 5 5763297 >B<5B8BL 40 5763302 >B<5B8BLM;5<5=BK 18 5763342 >B<5B8BLM;5<5=BK0A8=E 17 5763360 >B<5B:0 133 5763377 >B<5B:040BK 14 5763510 >B<5B:0=0D>B>A=8<:5 32 5763524 >B<5B:0=570?>;=5==>3> 126 5763556 >B<5B:8 48 5763682 >B<5B:C 31 5763730 >B<5B>: 16 5763761 >B<5G05BAO 8 5763777 >B<5G0BL 25 5763785 >B<5G0BL:0:?@>GB5==K5 5 5763810 >B<5G0BLAO 46 5763815 >B<5G0NBAO 36 5763861 >B<5G5=0 5 5763897 >B<5G5==K5 5 5763902 >B<5G5==K9 25 5763907 >B<5G5==KE 6 5763932 >B<5G5=> 5 5763938 >B<5G5=K 4 5763943 >B=5A5==K9 10 5763947 >B=5A5=K 10 5763957 >B=8<05BAO 6 5763967 >B=8<0BLAO 6 5763973 >B=>A8;L=> 4 5763979 >B=>A8B5;L=0O 20 5763983 >B=>A8B5;L=0O=02830F8>==0OAAK;:0 15 5764003 >B=>A8B5;L=0O?@>872>48B5;L=>ABL 11 5764018 >B=>A8B5;L=0OG0AB>B0 4 5764029 >B=>A8B5;L=> 652 5764033 >B=>A8B5;L=>3> 4 5764685 >B=>A8B5;L=>5 116 5764689 >B=>A8B5;L=>9 9 5764805 >B=>A8B5;L=CN 32 5764814 >B=>A8B5;L=K5 20 5764846 >B=>A8B5;L=K9 863 5764866 >B=>A8B5;L=K9url 9 5765729 >B=>A8B5;L=KE 5 5765738 >B=>A8BAO 1696 5765743 >B=>A8BLAO 1816 5767439 >B=>AOBAO 103 5769255 >B=>AOI0OAO 4 5769358 >B=>AOI85AO 62 5769362 >B=>AOI89AO 95 5769424 >B=>AOI8EAO 33 5769519 >B=>H5=85 191 5769552 >B=>H5=88 9 5769743 >B=>H5=89 8 5769752 >B=>H5=8N 122 5769760 >B=>H5=8O 20 5769882 >B=>H5=L5 8 5769902 >B>1@0405BAO 4 5769910 >B>1@0605<0O 63 5769914 >B>1@0605<0O>1;0ABL 16 5769977 >B>1@0605<>3> 125 5769993 >B>1@0605<>5 100 5770118 >B>1@0605<>58<O 10 5770218 >B>1@0605<>9 14 5770228 >B>1@0605<>< 16 5770242 >B>1@0605<CN 86 5770258 >B>1@0605<K5 45 5770344 >B>1@0605<K9 865 5770389 >B>1@0605<K9B5:AB 16 5771254 >B>1@0605<K< 44 5771270 >B>1@0605<K<8 16 5771314 >B>1@0605<KE 227 5771330 >B>1@0605B 203 5771557 >B>1@0605BAO 1703 5771760 >B>1@060;8AL 5 5773463 >B>1@060;AO 8 5773468 >B>1@060BL 846 5773476 >B>1@060BL02B> 9 5774322 >B>1@060BL0B@81CB 23 5774331 >B>1@060BL22K?040NI5<A?8A:5 13 5774354 >B>1@060BL22K?040NI5<A?8A:582?>;522>40 9 5774367 >B>1@060BL2;535=45 9 5774376 >B>1@060BL2?>420;5 20 5774385 >B>1@060BL2?>;522>40 13 5774405 >B>1@060BL2A5 23 5774418 >B>1@060BL2A5M;5<5=BK 9 5774441 >B>1@060BL2A?;K20NICN8=D>@<0F8>==CN;8=8N4803@0<<K 55 5774450 >B>1@060BL2A?;K20NICN8=D>@<0F8>==CN;8=8N7=0G5=89 9 5774505 >B>1@060BL2E>4=K5:>;>=:8 9 5774514 >B>1@060BL2H0?:5 29 5774523 >B>1@060BL2K45;5=85 15 5774552 >B>1@060BL38?5@AAK;:C?><>I8 45 5774567 >B>1@060BL3@0D8G5A:>5?@54AB02;5=8540==KE24803@0<<5 19 5774612 >B>1@060BL3@0D8G5A:>5?@54AB02;5=8540==KE2;535=454803@0<<K 19 5774631 >B>1@060BL3@C??8@>2:8 20 5774650 >B>1@060BL40==K5 45 5774670 >B>1@060BL4;O1;8609H53> 13 5774715 >B>1@060BL4>:C<5=B 23 5774728 >B>1@060BL703>;>2:8 20 5774751 >B>1@060BL703>;>2>: 66 5774771 >B>1@060BL85@0@E8N 21 5774837 >B>1@060BL87<5@5=8O 11 5774858 >B>1@060BL8<5=0AB@>:8:>;>=>: 9 5774869 >B>1@060BL8<5=0OG55: 9 5774878 >B>1@060BL8=AB@C:F8N>1@01>B:8 23 5774887 >B>1@060BL8B>382?>420;5 44 5774910 >B>1@060BL:0:4>;N 9 5774954 >B>1@060BL:0:7=0G5=85 9 5774963 >B>1@060BL:0@B8=:C 38 5774972 >B>1@060BL:=>?:C70:@KB8O 21 5775010 >B>1@060BL:>;>=:88AB>G=8:040==KE 9 5775031 >B>1@060BL:><<5=B0@89 23 5775040 >B>1@060BL:>>@48=0BK 11 5775063 >B>1@060BL:>@5=L 13 5775074 >B>1@060BL:>MDD8F85=B45B5@<8=0F88 9 5775087 >B>1@060BL;535=4C 9 5775096 >B>1@060BL;8=88 15 5775105 >B>1@060BL=>B0F8N 23 5775120 >B>1@060BL>1;0ABLM;5<5=B>2B>;L:>4;O?>4G8=5==KE 9 5775143 >B>1@060BL>:=>?@>A;CH820=8O 5 5775152 >B>1@060BL>?@545;5=85B8?04>:C<5=B0 23 5775157 >B>1@060BL>B1>@ 11 5775180 >B>1@060BL>BABC?A;520 9 5775191 >B>1@060BL?0=5;8=02830F888459AB289 9 5775200 >B>1@060BL?0=5;L<5AOF52 9 5775209 >B>1@060BL?0=5;L@0745;>2 9 5775218 >B>1@060BL?5@5=5A5==K5703>;>2:8 9 5775227 >B>1@060BL?5@5=5A5==K5703>;>2:8H:0;K2@5<5=8 9 5775236 >B>1@060BL?5@8>48G5A:85<5B:8 11 5775245 >B>1@060BL?>4?8A88B>3>2 11 5775256 >B>1@060BL?>7=0G5=8O< 9 5775267 >B>1@060BL?>;O 31 5775276 >B>1@060BL?><5B:C 16 5775307 >B>1@060BL?>@O4>: 11 5775323 >B>1@060BL?@88A?>;L7>20=88?>;=>B5:AB>2>3>?>8A:0 9 5775334 >B>1@060BL?@8=02545=88 13 5775343 >B>1@060BL?@8D>@<8@>20=88 9 5775356 >B>1@060BL?@>3=>78@C5<K5:>;>=:8 9 5775365 >B>1@060BL?@>F5=B2K2>40 22 5775374 >B>1@060BL?@>F5=BK 20 5775396 >B>1@060BL?CABK57=0G5=8O 9 5775416 >B>1@060BLA25@EC 9 5775425 >B>1@060BLA5:F88cdata 23 5775434 >B>1@060BLA5B:C 44 5775457 >B>1@060BLA;520 9 5775501 >B>1@060BLA=87C 9 5775510 >B>1@060BLA>AB>O=85 18 5775519 >B>1@060BLA?@020 9 5775537 >B>1@060BLAAK;:C=0ACI=>ABL 23 5775546 >B>1@060BLAB0=40@B=CN:0@B8=:C 165 5775569 >B>1@060BLACI=>ABL 23 5775734 >B>1@060BLAO 2429 5775757 >B>1@060BLB01;8FC40==KE 32 5778186 >B>1@060BLB5:AB 40 5778218 >B>1@060BLB5:ABB>G5: 9 5778258 >B>1@060BLB5:CICN40BC 29 5778267 >B>1@060BLC40;5==K5 17 5778296 >B>1@060BLC@02=5=85 9 5778313 >B>1@060BLD;06:822K?040NI5<A?8A:5?@822>45<=>65AB25==KE7=0G5=89 24 5778322 >B>1@060BLD;06>: 17 5778346 >B>1@060BLD@03<5=B4>:C<5=B0 23 5778363 >B>1@060BLH:0;C 13 5778386 >B>1@060BLH:0;K 9 5778399 >B>1@060BLM;5<5=B 23 5778408 >B>1@060NB 14 5778431 >B>1@060NBAO 486 5778445 >B>1@060NI0O 29 5778931 >B>1@060NI53> 30 5778960 >B>1@060NI59 12 5778990 >B>1@060NI5< 4 5779002 >B>1@060NI85 8 5779006 >B>1@060NI89 190 5779014 >B>1@060NI8E 27 5779204 >B>1@060NICN 75 5779231 >B>1@060O 26 5779306 >B>1@065= 25 5779332 >B>1@065=0 29 5779357 >B>1@065=85 2970 5779386 >B>1@065=8524803@0<<5 38 5782356 >B>1@065=8524803@0<<530=B0 28 5782394 >B>1@065=852;535=454803@0<<K 34 5782422 >B>1@065=852@5<5=8M;5<5=B>2 9 5782456 >B>1@065=852@5<5=8M;5<5=B>2?;0=8@>2I8:0 24 5782465 >B>1@065=852A?;K20NI598=D>@<0F8>==>9;8=887=0G5=89 23 5782489 >B>1@065=852A?;K20NI598=D>@<0F8>==>9;8=88B>G5: 32 5782512 >B>1@065=852K45;5=8O 9 5782544 >B>1@065=852K45;5=8O82K1>@ 9 5782553 >B>1@065=853@C??K:=>?>: 24 5782562 >B>1@065=85703>;>2:0 14 5782586 >B>1@065=85703>;>2:0H:0;K4803@0<<K 24 5782600 >B>1@065=857040G 20 5782624 >B>1@065=8570:;04>: 84 5782644 >B>1@065=857=0G5=89A2>4=>94803@0<<K 29 5782728 >B>1@065=857=0G5=89A5@89 16 5782757 >B>1@065=857=0G5=89B>G5: 16 5782773 >B>1@065=857=0G5=8O87<5@8B5;L=>94803@0<<K 26 5782789 >B>1@065=858=B5@20;0 13 5782815 >B>1@065=858=B5@20;04803@0<<K30=B0 29 5782828 >B>1@065=85:=>?:8 49 5782857 >B>1@065=85:=>?:82K1>@0 35 5782906 >B>1@065=85:=>?:8:><0=4=>9?0=5;8 40 5782941 >B>1@065=85;8=89A5B:8 9 5782981 >B>1@065=85;8=89A5B:84803@0<<K 24 5782990 >B>1@065=85< 68 5783014 >B>1@065=85>1AC645=89 9 5783082 >B>1@065=85>1AC645=89D>@<K 24 5783091 >B>1@065=85>1KG=>93@C??K 29 5783115 >B>1@065=85>?>25I5=89 5 5783144 >B>1@065=85>?>25I5=89A8AB5<K2708<>459AB28O 23 5783149 >B>1@065=85>B@8F0B5;L=KE7=0G5=89?C7K@L:>2>94803@0<<K 62 5783172 >B>1@065=85?0=5;8@0745;>2 40 5783234 >B>1@065=85?>4A:07:8 110 5783274 >B>1@065=85?>4A:07:87=0G5=89 9 5783384 >B>1@065=85?>4A:07:87=0G5=894803@0<<K 29 5783393 >B>1@065=85?@54C?@5645=8O?@8@540:B8@>20=88 39 5783422 >B>1@065=85@07<5B:8 25 5783461 >B>1@065=85@07<5B:8?>;>AK@53C;8@>20=8O 34 5783486 >B>1@065=85@5:;0<=>3>10==5@0 30 5783520 >B>1@065=85@5:;0<K 9 5783550 >B>1@065=85A>AB>O=8O 39 5783559 >B>1@065=85A>AB>O=8O?@>A<>B@0 22 5783598 >B>1@065=85AB@0=8F 13 5783620 >B>1@065=85AB@0=8FD>@<K 44 5783633 >B>1@065=85AB@>:8?>8A:0 22 5783677 >B>1@065=85B01;8FK 44 5783699 >B>1@065=85B5:AB07=0G5=8O 13 5783743 >B>1@065=85B5:AB07=0G5=8O4803@0<<K30=B0 19 5783756 >B>1@065=85B5:AB08=B5@20;0 9 5783775 >B>1@065=85B5:AB08=B5@20;04803@0<<K30=B0 24 5783784 >B>1@065=85C?@02;5=8O 9 5783808 >B>1@065=85C?@02;5=8O>1KG=>93@C??K 19 5783817 >B>1@065=85D83C@K 18 5783836 >B>1@065=85D83C@K:=>?:8 33 5783854 >B>1@065=88 477 5783887 >B>1@065=8O 2244 5784364 >B>1@065==K9 191 5786608 >B>1@065=> 122 5786799 >B>1@065=K 7 5786921 >B>1@065BAO 4 5786928 >B>1@06=> 5 5786932 >B>1@06Q= 8 5786937 >B>1@078B 6 5786945 >B>1@078BAO 38 5786951 >B>1@078BL 66 5786989 >B>1@078BL87<5=5=8540==KE 15 5787055 >B>1@078BLAO 38 5787070 >B>1@0==K5 11 5787108 >B>1@0==K9 127 5787119 >B>1@0==K< 25 5787246 >B>1@0==KE 10 5787271 >B>1@0=K 81 5787281 >B>1@0BL 94 5787362 >B>720==K9 10 5787456 >B>720==KE 10 5787466 >B>720BL 4 5787476 >B?5G0B:0 8 5787480 >B?5G0B:>< 10 5787488 >B?5G0B:C 16 5787498 >B?5G0B>: 49 5787514 >B?@028; 4 5787563 >B?@028B5;59 4 5787567 >B?@028B5;5< 18 5787571 >B?@028B5;L 251 5787589 >B?@028B5;L0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 5787840 >B?@028B5;L2>AAB0=>2;5=8O?0@>;O 36 5787876 >B?@028B5;N 12 5787912 >B?@028B5;O 72 5787924 >B?@028BAO 4 5787996 >B?@028BL 127 5788000 >B?@028BL2@5<5==K9:>4 10 5788127 >B?@028BL4;O>1@01>B:8 26 5788137 >B?@028BL4;O>1@01>B:80A8=E 14 5788163 >B?@028BL=02830F8>==CNAAK;:C2=5H=53>4>ABC?0 14 5788177 >B?@028BLA>1KB85 12 5788191 >B?@028BLA>>1I5=85 71 5788203 >B?@028BLA>>1I5=85A40==K<8 17 5788274 >B?@028BLAO 4 5788291 >B?@028BLC254><;5=85 10 5788295 >B?@028BLM:@0= 12 5788305 >B?@02:0 462 5788317 >B?@02:04>AB02;O5<KEC254><;5=89 9 5788779 >B?@02:0:>40?>4B25@645=8O?>7040==K<?0@0<5B@0< 60 5788788 >B?@02:0:>40?>4B25@645=8OG5@57AB0=40@B=K9A5@28A 60 5788848 >B?@02:0=0704 14 5788908 >B?@02:0M;5<5=B0 12 5788922 >B?@02:0M;5<5=B040==KE 30 5788934 >B?@02:5 156 5788964 >B?@02:8 250 5789120 >B?@02:>9 32 5789370 >B?@02:C 33 5789402 >B?@02;5= 24 5789435 >B?@02;5=0 10 5789459 >B?@02;5=85 16 5789469 >B?@02;5=8O 16 5789485 >B?@02;5==>3> 29 5789501 >B?@02;5==>5 13 5789530 >B?@02;5==K9 177 5789543 >B?@02;5==K< 16 5789720 >B?@02;5==KE 13 5789736 >B?@02;5=> 63 5789749 >B?@02;5=>B25B 8 5789812 >B?@02;5=K 21 5789820 >B?@02;O5<>3> 34 5789841 >B?@02;O5<>5 9 5789875 >B?@02;O5<K9 47 5789884 >B?@02;O5<KE 8 5789931 >B?@02;O5B 80 5789939 >B?@02;O5BAO 37 5790019 >B?@02;O;8AL 5 5790056 >B?@02;OBL 97 5790061 >B?@02;OBL>BG5B 13 5790158 >B?@02;OBL>BG5B=0:;85=B5 13 5790171 >B?@02;OBL>BG5B=0A5@25@5 13 5790184 >B?@02;OBL>BG5B>1020@89=><7025@H5=88 9 5790197 >B?@02;OBL>BG5B>1020@89=><7025@H5=882A5@28A@538AB@0F88>H81>:?;0BD>@<K 9 5790206 >B?@02;OBL>BG5B>1020@89=><7025@H5=88=0:;85=B5 17 5790215 >B?@02;OBL>BG5B>1020@89=><7025@H5=88=0:;85=B52A5@28A@538AB@0F88>H81>:?;0BD>@<K 13 5790232 >B?@02;OBL>BG5B>1020@89=><7025@H5=88=0A5@25@5 13 5790245 >B?@02;OBL>BG5B>1020@89=><7025@H5=88=0A5@25@52A5@28A@538AB@0F88>H81>:?;0BD>@<K 13 5790258 >B?@02;OBL>G5B 9 5790271 >B?@02;OBLAO 65 5790280 >B?@02;ONBAO 23 5790345 >B?CA: 4 5790368 >B?CA:0 4 5790372 >B?CA:0=85 37 5790376 >B?CA:0=88 11 5790413 >B?CA:0=8O 31 5790424 >B?CAB8BL 12 5790455 >B@010BK205B 5 5790467 >B@010BK205BAO 8 5790472 >B@010BK20BL 20 5790480 >B@010BK20BLAO 17 5790500 >B@010BK20NB 11 5790517 >B@010BK20NBAO 5 5790528 >B@01>B05B 10 5790533 >B@01>B0; 4 5790543 >B@01>B0==K9 4 5790547 >B@01>B0==KE 4 5790551 >B@01>B0BL 14 5790555 >B@01>B0BL@0AH8D@>2:C 5 5790569 >B@01>B:0 85 5790574 >B@01>B:5 50 5790659 >B@01>B:8 26 5790709 >B@01>B:C 9 5790735 >B@0605B 30 5790744 >B@0605BAO 9 5790774 >B@060BL 30 5790783 >B@060BLAO 34 5790813 >B@060NBAO 25 5790847 >B@060NI55 4 5790872 >B@060NI59 4 5790876 >B@060NI89 8 5790880 >B@078BAO 77 5790888 >B@078BLAO 77 5790965 >B@540:B8@>20= 40 5791042 >B@540:B8@>20==>9 4 5791082 >B@540:B8@>20==><C 11 5791086 >B@540:B8@>20==K5 5 5791097 >B@540:B8@>20==K9 60 5791102 >B@540:B8@>20BL 4 5791162 >B@57:0 13 5791166 >B@57:C 5 5791179 >B@57>: 13 5791184 >B@8A>20= 8 5791197 >B@8A>20==>5 4 5791205 >B@8A>20=K 4 5791209 >B@8A>2:0 8 5791213 >B@8A>2:5 20 5791221 >B@8A>2:8 73 5791241 >B@8A>2K205<K5 4 5791314 >B@8A>2K205BAO 4 5791318 >B@8A>2K20BLAO 4 5791322 >B@8A>2K20NBAO 8 5791326 >B@8F0=85 24 5791334 >B@8F0=8O 11 5791358 >B@8F0B5;L=> 4 5791369 >B@8F0B5;L=>3> 50 5791373 >B@8F0B5;L=>5 322 5791423 >B@8F0B5;L=>< 15 5791745 >B@8F0B5;L=K5 39 5791760 >B@8F0B5;L=K9 593 5791799 >B@8F0B5;L=K< 56 5792392 >B@8F0B5;L=K<8 27 5792448 >B@8F0B5;L=KE 79 5792475 >B@8F0BLAO 4 5792554 >B@8F0NBAO 4 5792558 >BA5:05B 30 5792562 >BA5:05BAO 8 5792592 >BA5:0BL 48 5792600 >BA5:0BLAO 8 5792648 >BA5:0O 10 5792656 >BA5G5=85 38 5792666 >BA5G5=8O 38 5792704 >BA:0=8@>20=0 4 5792742 >BA:0=8@>20==>3> 12 5792746 >BA:0=8@>20==K9 20 5792758 >BA:0=8@>20==KE 4 5792778 >BA:0=8@>20BL 4 5792782 >BA;568205<>9 5 5792786 >BA;568205<K5 4 5792791 >BA;568205<K9 14 5792795 >BA;568205<KE 8 5792809 >BA;56820=85 46 5792817 >BA;56820=8O 29 5792863 >BA;56820BL 16 5792892 >BA;56820BL?>4G8=5==K540==K5 6 5792908 >BA;56820BLAO 5 5792914 >BA;56820NBAO 5 5792919 >BA>548=5= 9 5792924 >BA>548=5=85 29 5792933 >BA>548=5=8O 29 5792962 >BA>548=5==0O 12 5792991 >BA>548=5==>9 23 5793003 >BA>548=5==K9 44 5793026 >BA>548=8BL 10 5793070 >BA>548=O5B 4 5793080 >BA>548=OBL 4 5793084 >BA>@B8@>20==CN 4 5793088 >BA>@B8@>20==K9 69 5793092 >BA>@B8@>20=K 60 5793161 >BA>@B8@>20BL 5 5793221 >BAB020BL 20 5793226 >BAB05B 20 5793246 >BAB0NI89 4 5793266 >BAB0NI8E 4 5793270 >BABC? 261 5793274 >BABC?0 64 5793535 >BABC?0B@81CB>2 14 5793599 >BABC?4>OG59:8 9 5793613 >BABC?>2 18 5793622 >BABC?>< 4 5793640 >BABC?A25@EC 32 5793644 >BABC?A:>=F0?5@5=>A0H:0;K2@5<5=8 14 5793676 >BABC?A;520 32 5793690 >BABC?A=0G0;0?5@5=>A0H:0;K2@5<5=8 14 5793722 >BABC?A=87C 32 5793736 >BABC?A?@020 32 5793768 >BABC?K 17 5793800 >BACBA2>20BL 6 5793817 >BACBAB285 957 5793823 >BACBAB285< 15 5794780 >BACBAB285@07@5H5=8O4;O8A?>;L7>20=8ODC=:F8>=0;L=>AB8 13 5794795 >BACBAB288 323 5794808 >BACBAB28N 4 5795131 >BACBAB28O 515 5795135 >BACBAB2>20BL 1295 5795650 >BACBAB2C5B 852 5796945 >BACBAB2CNB 271 5797797 >BACBAB2CNI0O 20 5798068 >BACBAB2CNI53> 10 5798088 >BACBAB2CNI55 11 5798098 >BACBAB2CNI85 7 5798109 >BACBAB2CNI89 53 5798116 >BACBAB2CNI8E 7 5798169 >BACBAB2CNICN 5 5798176 >BAG5B 25 5798181 >BAG5B0 13 5798206 >BAG8BK205<>5 96 5798219 >BAG8BK205<K9 96 5798315 >BAG8BK205BAO 56 5798411 >BAG8BK20BLAO 117 5798467 >BAG8BK20NBAO 8 5798584 >BAK;0BL 4 5798592 >BAK;0NB 4 5798596 >BB5=:8 16 5798600 >BB5=:8A5@>3> 10 5798616 >BB5=:>2 4 5798626 >BB5=:>< 20 5798630 >BB5=>: 49 5798650 >BB5=>:F25B0D83C@K 13 5798699 >BBC40 4 5798712 >BD8;LB@>20= 5 5798716 >BD8;LB@>20==K9 11 5798721 >BD8;LB@>20=K 6 5798732 >BD8;LB@>20BL 62 5798738 >BG5AB20 4 5798800 >BG5AB2> 53 5798804 >BG5B 2196 5798857 >BG5B201 10 5801053 >BG5B0 1270 5801063 >BG5B0< 15 5802333 >BG5B0<8 10 5802348 >BG5B0E 14 5802358 >BG5B5 40 5802372 >BG5B<5=5465@ 46 5802412 >BG5B=>AB8 5 5802458 >BG5B=>ABL 5 5802463 >BG5B=K9 5 5802468 >BG5B=KE 5 5802473 >BG5B>1>H81:5 53 5802478 >BG5B>1J5:B 126 5802531 >BG5B>2 220 5802657 >BG5B>< 13 5802877 >BG5B>?@>4060E 13 5802890 >BG5B>?@>4060E7045=L 14 5802903 >BG5B>AB0B:8 6 5802917 >BG5B>AB0B:8=><5=:;0BC@K 6 5802923 >BG5B?>2708<>@0AG5B0< 9 5802929 >BG5B?@>4068 5 5802938 >BG5BAB5:CI8<8=0AB@>9:0<8 9 5802943 >BG5BB01;8G=0OG0ABL 6 5802952 >BG5BC 5 5802958 >BG5BK 171 5802963 >BG5BK<5=5465@ 25 5803134 >D8A 26 5803159 >D8AK 10 5803185 >D>@<8B5;LA:89 14 5803195 >D>@<8B5;LA:8E 9 5803209 >D>@<8B5;LA:>3> 5 5803218 >D>@<8B8 93 5803223 >D>@<8BL 52 5803316 >D>@<8BL<0:5B 11 5803368 >D>@<;5=85 1562 5803379 >D>@<;5=852>c:;8F0B5;L=K97=0: 12 5804941 >D>@<;5=852>A:;8F0B5;L=K97=0: 17 5804953 >D>@<;5=853@C??8@>2:84803@0<<K>1;0AB8:><?>=>2:840==KE 29 5804970 >D>@<;5=8540BK 44 5804999 >D>@<;5=8545D8A65;BK9 12 5805043 >D>@<;5=854803@0<<K>1;0AB8:><?>=>2:840==KE 29 5805055 >D>@<;5=8572574070?>;=5==0O 12 5805084 >D>@<;5=8572574070?>;=5==0O=0?>;>28=C 12 5805096 >D>@<;5=85725740?CAB0O 12 5805108 >D>@<;5=857=0:2>c:;8F0B5;L=K97=0: 12 5805120 >D>@<;5=857=0:2>A:;8F0B5;L=K97=0: 17 5805132 >D>@<;5=857=0::@5AB 12 5805149 >D>@<;5=857=0:D;06>: 12 5805161 >D>@<;5=857=0G5=89 71 5805173 >D>@<;5=85:204@0BK70?>;=5==K5 12 5805244 >D>@<;5=85:204@0BK70?>;=5==K5420 12 5805256 >D>@<;5=85:204@0BK70?>;=5==K5>48= 12 5805268 >D>@<;5=85:204@0BK70?>;=5==K5B@8 12 5805280 >D>@<;5=85:204@0BK?CABK5 12 5805292 >D>@<;5=85:><?>=>2:840==KE 99 5805304 >D>@<;5=85:@5AB 12 5805403 >D>@<;5=85:@C365;BK9 12 5805415 >D>@<;5=85:@C370?>;=5==K9 12 5805427 >D>@<;5=85:@C370?>;=5==K9=0425G5B25@B8 12 5805439 >D>@<;5=85:@C370?>;=5==K9=0>4=CG5B25@BL 12 5805451 >D>@<;5=85:@C370?>;=5==K9=0B@8G5B25@B8 12 5805463 >D>@<;5=85:@C375;5=K9 12 5805475 >D>@<;5=85:@C3:@0A=K9 12 5805487 >D>@<;5=85:@C3?CAB>9 12 5805499 >D>@<;5=85:@C3G5@=K9 12 5805511 >D>@<;5=85< 17 5805523 >D>@<;5=85<0:5B0>D>@<;5=8O:><?>=>2:840==KE 6 5805540 >D>@<;5=85>1;0AB8 6 5805546 >D>@<;5=85>B?CA:0 5 5805552 >D>@<;5=85>BG5B>2 9 5805557 >D>@<;5=85?5@8>40 59 5805566 >D>@<;5=85?>;O>1;0AB8:><?>=>2:840==KE 29 5805625 >D>@<;5=85@5AC@A04803@0<<K>1;0AB8:><?>=>2:840==KE 29 5805654 >D>@<;5=85AB@5;:0225@E75;5=0O 12 5805683 >D>@<;5=85AB@5;:0225@EA5@0O 12 5805695 >D>@<;5=85AB@5;:02=87:@0A=0O 12 5805707 >D>@<;5=85AB@5;:02=87A5@0O 12 5805719 >D>@<;5=85AB@5;:02?@02>65;B0O 12 5805731 >D>@<;5=85AB@5;:02?@02>A5@0O 12 5805743 >D>@<;5=85AB@5;:0=0:;>==0O225@E65;B0O 12 5805755 >D>@<;5=85AB@5;:0=0:;>==0O225@E75;5=0O 12 5805767 >D>@<;5=85AB@5;:0=0:;>==0O225@EA5@0O 12 5805779 >D>@<;5=85AB@5;:0=0:;>==0O2=8765;B0O 12 5805791 >D>@<;5=85AB@5;:0=0:;>==0O2=87:@0A=0O 12 5805803 >D>@<;5=85AB@5;:0=0:;>==0O2=87A5@0O 12 5805815 >D>@<;5=85AB@>:8 81 5805827 >D>@<;5=85B@5C3>;L=8:225@E75;5=K9 12 5805908 >D>@<;5=85B@5C3>;L=8:2=87:@0A=K9 12 5805920 >D>@<;5=85D;0365;BK9 12 5805932 >D>@<;5=85D;0375;5=K9 12 5805944 >D>@<;5=85D;03:@0A=K9 12 5805956 >D>@<;5=85D;06>: 12 5805968 >D>@<;5=85OG59:8 180 5805980 >D>@<;5=85OG59:848=0<8G5A:>3>A?8A:0 34 5806160 >D>@<;5=85OG59:8B01;8FK>1;0AB8:><?>=>2:840==KE 29 5806194 >D>@<;5=88 14 5806223 >D>@<;5=89 33 5806237 >D>@<;5=8N 24 5806270 >D>@<;5=8O 1042 5806294 >D>@<;5=8OAB@>: 35 5807336 >D>@<;5=8OOG55:48=0<8G5A:>3>A?8A:0 19 5807371 >D>@<;5=L5 33 5807390 >D>@<;O5<>3> 15 5807423 >D>@<;O5<>5 5 5807438 >D>@<;O5<>5?>;5:><?>=>2:840==KE 58 5807443 >D>@<;O5<><C 5 5807501 >D>@<;O5<K5 10 5807506 >D>@<;O5<K5?>;O:><?>=>2:840==KE 42 5807516 >D>@<;O5<K9 65 5807558 >D>@<;O5<KE 46 5807623 >D>@<;OBL 8 5807669 >D@ 7 5807677 >E>B=8G89 4 5807684 >E@0 13 5807688 >F5=8;8 6 5807701 >F5=8BL 7 5807707 >F5=:0 11 5807714 >F5=:8 5 5807725 >G5=L 67 5807730 >G5=L1KAB@> 9 5807797 >G5=L206=>5 9 5807806 >G5=L2KA>:0O 9 5807815 >G5=L:@C?=K9H@8DBB5:AB0 11 5807824 >G5=L<54;5==> 9 5807835 >G5=L=87:0O 9 5807844 >G5@548 88 5807853 >G5@54=>3> 97 5807941 >G5@54=>9 220 5808038 >G5@54=>< 13 5808258 >G5@54=CN 6 5808271 >G5@54=KE 12 5808277 >G5@54L 179 5808289 >G5@54L8AB>@8840==KE 6 5808468 >G5@54L>1@01>B:8?>A;570?8A88AB>@8840==KE 6 5808474 >G5@54L>B?@02:8:0=0;0A5@28A08=B53@0F88 6 5808480 >G5@54L?>;CG5=8O:0=0;0A5@28A08=B53@0F88 6 5808486 >G5@B0=85 9 5808492 >G5@G820NI0O 4 5808501 >G5@G820NI89 4 5808505 >G8AB82 120 5808509 >G8AB8< 16 5808629 >G8AB8B8 2446 5808645 >G8AB8BL 2458 5811091 >G8AB8BL03@530BK 12 5813549 >G8AB8BL107C40==KE 9 5813561 >G8AB8BL2A5 10 5813570 >G8AB8BL2K1>@M;5<5=B0 12 5813580 >G8AB8BL480?07>=K?>@B>2 12 5813592 >G8AB8BL6C@=0;@538AB@0F88 11 5813604 >G8AB8BL8=45:A 14 5813615 >G8AB8BL=0:>?;5==K5 5 5813629 >G8AB8BL=0:>?;5==K57=0G5=8O 12 5813634 >G8AB8BL=0:>?;5==K5?>:070B5;8?@>872>48B5;L=>AB8 10 5813646 >G8AB8BL=0AB@>9:8?>;L7>20B5;O 18 5813656 >G8AB8BL=58A?>;L7C5<>5<5AB> 12 5813674 >G8AB8BL=58A?>;L7C5<>5<5AB>?>C=825@A0;L=>940B5 29 5813686 >G8AB8BL>B1>@M;5<5=B0 12 5813715 >G8AB8BL?0@0<5B@K2K2>40M;5<5=B0 12 5813727 >G8AB8BL?0@0<5B@K>1;0AB8B01;8G=>3>4>:C<5=B0 5 5813739 >G8AB8BL?>@O4>:M;5<5=B0 12 5813744 >G8AB8BL@57C;LB0B480;>302K1>@0D09;0 10 5813756 >G8AB8BLA>>1I5=8O 12 5813766 >G8AB8BLC40;5==K5A>>1I5=8O 14 5813778 >G8AB8BLCA;>2=>5>D>@<;5=85M;5<5=B0 12 5813792 >G8AB8BLD09; 15 5813804 >G8AB:0 204 5813819 >G8AB:5 19 5814023 >G8AB:8 88 5814042 >G8AB:>9 4 5814130 >G8AB:C 4 5814134 >G8I05< 6 5814138 >G8I05<K5?0@0<5B@K 12 5814144 >G8I05<K9 10 5814156 >G8I05<KE 4 5814166 >G8I05B 594 5814170 >G8I05BAO 79 5814764 >G8I0BL 618 5814843 >G8I0BL@0<:8 6 5815461 >G8I0BLAO 100 5815467 >G8I0BLB5:AB 6 5815567 >G8I0BLD>@<0B8@>20=85 6 5815573 >G8I0NBAO 26 5815579 >G8I5=0 4 5815605 >G8I5=85 6 5815609 >G8I5=8O 6 5815615 >G8I5=> 4 5815621 >G:8 4 5815625 >G:> 4 5815629 >H81:0 3070 5815633 >H81:02=5H=53>8AB>G=8:040==KE 13 5818703 >H81:02>2@5<O2K?>;=5=8O2AB@>5==>3>O7K:0 30 5818716 >H81:02K?>;=5=8O70?@>A0 9 5818746 >H81:040==KE0CB5=B8D8:0F88 14 5818755 >H81:04>ABC?0:;>:0;L=><CD09;C 13 5818769 >H81:0845=B8D8:0B>@0?>4?8AG8:0 9 5818782 >H81:08A?>;L7>20=8O2AB@>5==>3>O7K:0 13 5818791 >H81:0:><?8;OF882AB@>5==>3>O7K:0 18 5818804 >H81:0:>=D83C@0F88 19 5818822 >H81:0:>?88107K40==KE 13 5818841 >H81:0< 64 5818854 >H81:0=0AB@>5::><?>=>2:840==KE 18 5818918 >H81:0>1=>2;5=8O 9 5818936 >H81:0>B?@02:8 13 5818945 >H81:0?5@5E>40?>=02830F8>==>9AAK;:5 13 5818958 >H81:0?>4:;NG5=8O:A5@28AC4>AB02;O5<KEC254><;5=89 9 5818971 >H81:0?>;=>B5:AB>2>3>?>8A:0 13 5818980 >H81:0?@5>1@07>20=8O4>:C<5=B0 13 5818993 >H81:0?@8G8=K>B:;NG5=8O 9 5819006 >H81:0?@>25@:8?>4?8A8 29 5819015 >H81:0@01>BKA?@8=B5@>< 13 5819044 >H81:0@01>BKA@5GLN 13 5819057 >H81:0A50=A0 13 5819070 >H81:0A5@28A04>AB02;O5<KEC254><;5=89 9 5819083 >H81:0A5B8 13 5819092 >H81:0A8AB5<K2708<>459AB28O 13 5819105 >H81:0A>548=5=8OA107>940==KE 13 5819118 >H81:0A@54AB2<C;LB8<5480 25 5819131 >H81:0B01;8G=>3>?@>AB@0=AB20107K40==KE 13 5819156 >H81:0B5;0C254><;5=8O 9 5819169 >H81:0E 44 5819178 >H81:0E@0=8<KE40==KE 13 5819222 >H81:5 674 5819235 >H81:8 783 5819909 >H81:>9 138 5820692 >H81:C 471 5820830 >H81>: 500 5821301 >H81>:=5>1=0@C65=> 10 5821801 >H81>G=>5 4 5821811 >H81>G=>9 11 5821815 >H81>G=K5?>;CG0B5;8 5 5821826 >H81>G=K9 27 5821831 >H81>G=KE 11 5821858 >›8<K= 9 5821869 ? 177 5821878 ?028;L>= 50 5822055 ?0456 33 5822105 ?04560 6 5822138 ?04565 6 5822144 ?04568 6 5822150 ?045=85 14 5822156 ?045=88 14 5822170 ?0:5B 304 5822184 ?0:5Bxdto 306 5822488 ?0:5B0 149 5822794 ?0:5B0<8 7 5822943 ?0:5B5 29 5822950 ?0:5B70?@>A>2 8 5822979 ?0:5B70?@>A>2AE5<K70?@>A0 54 5822987 ?0:5B=89 4 5823041 ?0:5B=>3> 4 5823045 ?0:5B=>< 313 5823049 ?0:5B=K9 333 5823362 ?0:5B=K< 4 5823695 ?0:5B=K<8 3 5823699 ?0:5B>2 53 5823702 ?0:5B>< 16 5823755 ?0:5B>B>1@0605<KE4>:C<5=B>2 115 5823771 ?0:5BC 8 5823886 ?0:5BK 57 5823894 ?0:5BKxdto 19 5823951 ?0:8AB0= 16 5823970 ?0;5F 14 5823986 ?0;8B@ 4 5824000 ?0;8B@0 163 5824004 ?0;8B@032 13 5824167 ?0;8B@08 9 5824180 ?0;8B@0F25B>2 28 5824189 ?0;8B@0F25B>24803@0<<K 93 5824217 ?0;8B@5 9 5824310 ?0;8B@C 12 5824319 ?0;8B@K 87 5824331 ?0;=8@>2I8:0 4 5824418 ?0;LF0 14 5824422 ?0<OB8 372 5824436 ?0<OBL 466 5824808 ?0=0<0 12 5825274 ?0=4601A:89 14 5825286 ?0=5;59 72 5825300 ?0=5;8 1033 5825372 ?0=5;L 1383 5826405 ?0=5;L459AB289 21 5827788 ?0=5;L459AB289>BG5BK 9 5827809 ?0=5;L459AB289A5@28A 9 5827818 ?0=5;L459AB289A>740BL 9 5827827 ?0=5;L7040G>A 28 5827836 ?0=5;L871@0==>3> 4 5827864 ?0=5;L8=AB@C<5=B>2 5 5827868 ?0=5;L8AB>@88 4 5827873 ?0=5;L:=>?>: 17 5827877 ?0=5;L:=>?>:A>>1I5=8OA8AB5<K2708<>459AB28O 31 5827894 ?0=5;L=02830F88 23 5827925 ?0=5;L=02830F88206=>5 9 5827948 ?0=5;L=02830F88>1KG=>5 9 5827957 ?0=5;L=02830F88A<B0:65 9 5827966 ?0=5;L=02830F88D>@<K 9 5827975 ?0=5;L=02830F88D>@<K206=>5 9 5827984 ?0=5;L=02830F88D>@<K?5@59B8 9 5827993 ?0=5;L=02830F88D>@<KA<B0:65 9 5828002 ?0=5;L>B1>@ 8 5828011 ?0=5;L>B:@KBKE 4 5828019 ?0=5;L@0745;>2 15 5828023 ?0=5;LDC=:F89B5:CI53>@0745;0 4 5828038 ?0=5;LN 4 5828042 ?0=5;O< 12 5828046 ?0=5;OE 4 5828058 ?0=B5@0 8 5828062 ?0?:0 92 5828070 ?0?:0?>;59=01>@040==KEAE5<K:><?>=>2:840==KE 63 5828162 ?0?:5 5 5828225 ?0?:8 10 5828230 ?0?:>9 17 5828240 ?0?:C 9 5828257 ?0?>: 30 5828266 ?0@ 216 5828296 ?0@1 11 5828512 ?0@2 7 5828523 ?0@3 7 5828530 ?0@0 228 5828537 ?0@03209 12 5828765 ?0@03@0D 86 5828777 ?0@03@0D0 40 5828863 ?0@03@0D0<8 5 5828903 ?0@03@0D>2 5 5828908 ?0@03@0DD>@<0B8@>20==>3>4>:C<5=B0 100 5828913 ?0@03@0DK 10 5829013 ?0@0;;5;5?8?54 4 5829023 ?0@0;;5;5?8?540<8 4 5829027 ?0@0;;5;>3@0<< 4 5829031 ?0@0;;5;>3@0<<0<8 4 5829035 ?0@0;;5;L=> 27 5829039 ?0@0;;5;L=>< 5 5829066 ?0@0;;5;L=>ABL 32 5829071 ?0@0;;5;L=K5 4 5829103 ?0@0;;5;L=K9 51 5829107 ?0@0;;5;L=K< 4 5829158 ?0@0;;5;L=KE 14 5829162 ?0@0< 15 5829176 ?0@0<1 14 5829191 ?0@0<2 6 5829205 ?0@0<5B@ 35230 5829211 ?0@0<5B@1 26 5864441 ?0@0<5B@2 12 5864467 ?0@0<5B@n 14 5864479 ?0@0<5B@webA5@28A0 288 5864493 ?0@0<5B@0 5025 5864781 ?0@0<5B@0< 358 5869806 ?0@0<5B@0<8 1409 5870164 ?0@0<5B@0=0;87040==KE 49 5871573 ?0@0<5B@0E 195 5871622 ?0@0<5B@1;>:8@>2:8 47 5871817 ?0@0<5B@20;NB0 11 5871864 ?0@0<5B@2K1>@0 55 5871875 ?0@0<5B@2K1>@0:><?>=>2:840==KE 61 5871930 ?0@0<5B@2K1>@3@C??8M;5<5=B>2 35 5871991 ?0@0<5B@2K1>@?>2;045;LFC 11 5872026 ?0@0<5B@2K1@0==>3>459AB28O 17 5872037 ?0@0<5B@2K?>;=5==>3>459AB28O 6 5872054 ?0@0<5B@40B0 10 5872060 ?0@0<5B@4>ABC?5= 12 5872070 ?0@0<5B@4>ABC?=>9B01;8FKAE5<K70?@>A0 58 5872082 ?0@0<5B@5 1825 5872140 ?0@0<5B@70:@KB8O 11 5873965 ?0@0<5B@70?CA:0 9 5873976 ?0@0<5B@870F88 24 5873985 ?0@0<5B@870F8O 24 5874009 ?0@0<5B@87>20=K 4 5874033 ?0@0<5B@:0@B8=:8 11 5874037 ?0@0<5B@:><0=4K 5 5874048 ?0@0<5B@:><?>=>2:840==KE 175 5874053 ?0@0<5B@=01>@040==KE?@>25@:885@0@E88 14 5874228 ?0@0<5B@>1;0AB82K@065=85:><?>=>2:840==KE 49 5874242 ?0@0<5B@>1;0AB8@0AH8D@>2:0:><?>=>2:840==KE 58 5874291 ?0@0<5B@>1J5:B:>?8@>20=8O 117 5874349 ?0@0<5B@>2 2665 5874466 ?0@0<5B@>< 932 5877131 ?0@0<5B@>A=>20=85 88 5878063 ?0@0<5B@>B1>@?>2;045;LFC 11 5878151 ?0@0<5B@>B1>@?>7=0G5=8N 11 5878162 ?0@0<5B@>B1>@?>87<5@5=8N 12 5878173 ?0@0<5B@>B1>@?>@538AB@0B>@C 46 5878185 ?0@0<5B@?5@5B0A:820=8O2=CB@8?;0=8@>2I8:0 30 5878231 ?0@0<5B@@0AH8D@>2:8 22 5878261 ?0@0<5B@A50=A0 256 5878283 ?0@0<5B@A50=A01 5 5878539 ?0@0<5B@A:;04 6 5878544 ?0@0<5B@AE5<K:><?>=>2:840==KE 134 5878550 ?0@0<5B@B01;8FKAE5<K70?@>A0 38 5878684 ?0@0<5B@B5:CI0OAB@>:0 197 5878722 ?0@0<5B@C 2246 5878919 ?0@0<5B@DC=:F8>=0;L=KE>?F89 269 5881165 ?0@0<5B@K 26514 5881434 ?0@0<5B@Kurl 9 5907948 ?0@0<5B@Kwebsocket:;85=BA>548=5=8O 57 5907957 ?0@0<5B@K0=0;87040==KE 65 5908014 ?0@0<5B@K0C48>70?8A8 42 5908079 ?0@0<5B@K2=5H=53>?>4:;NG5=8O@01>BKA@5GLN 37 5908121 ?0@0<5B@K2=5H=59A8AB5<K 9 5908158 ?0@0<5B@K2K1>@0 186 5908167 ?0@0<5B@K2K1>@070?CA:0?@8;>65=8O<>18;L=>3>CAB@>9AB20 45 5908353 ?0@0<5B@K2K1>@0:><?>=>2:840==KE 81 5908398 ?0@0<5B@K2K2>40 116 5908479 ?0@0<5B@K2K2>40:><?>=>2:840==KE 12 5908595 ?0@0<5B@K2K2>40:><?>=>2:840==KE=54>ABC?=K5 12 5908607 ?0@0<5B@K2K7>20 4 5908619 ?0@0<5B@K2K?>;=5=8O:><0=4K 40 5908623 ?0@0<5B@K40==KE 43 5908663 ?0@0<5B@K40==KE:><?>=>2:840==KE 12 5908706 ?0@0<5B@K40BK 8 5908718 ?0@0<5B@K480;>30 45 5908726 ?0@0<5B@K480;>30?>;CG5=8OD09;>2 62 5908771 ?0@0<5B@K480;>30?><5I5=8OD09;>2 65 5908833 ?0@0<5B@K4>ABC?0 53 5908898 ?0@0<5B@K4>ABC?02=5H=53>E@0=8;8I042>8G=KE40==KE 47 5908951 ?0@0<5B@K4>ABC?=>9B01;8FKAE5<K70?@>A0 30 5908998 ?0@0<5B@K70?8A8 349 5909028 ?0@0<5B@K70?8A8json 81 5909377 ?0@0<5B@K70?8A8xml 79 5909458 ?0@0<5B@K70?8A88AB>@8840==KE 100 5909537 ?0@0<5B@K70?>;=5=8O 10 5909637 ?0@0<5B@K70?>;=5=8O?@8?5@5>B:@KB88D>@<K 23 5909647 ?0@0<5B@K70?@>A0 9 5909670 ?0@0<5B@K:0G5AB20 9 5909679 ?0@0<5B@K:0G5AB20A:0=8@>20=8O4>:C<5=B>2 34 5909688 ?0@0<5B@K:>;>=:8:;0AB5@=>3>0=0;870 31 5909722 ?0@0<5B@K:><0=4 14 5909753 ?0@0<5B@K:><?>=>2:840==KE 9 5909767 ?0@0<5B@K:><?>=>2:840==KEB01;8FKAE5<K70?@>A0 24 5909776 ?0@0<5B@K:>=AB@C:B>@0 23 5909800 ?0@0<5B@K:>=AB@C:B@0 5 5909823 ?0@0<5B@K<0:5B0B01;8G=>3>4>:C<5=B0 42 5909828 ?0@0<5B@K<0:5B0B5:AB>2>3>4>:C<5=B0 41 5909870 ?0@0<5B@K<>45;8 15 5909911 ?0@0<5B@K<>45;8@0A?>7=020=8O@5G8 47 5909926 ?0@0<5B@K<>=>?>;L=>3> 10 5909973 ?0@0<5B@K<>=>?>;L=>3>@568<0 35 5909983 ?0@0<5B@K=02830F8>==>9AAK;:8 9 5910018 ?0@0<5B@K>1;0AB8:><?>=>2:840==KE 60 5910027 ?0@0<5B@K>1<5=040==K<8 121 5910087 ?0@0<5B@K>1@01>B:8 22 5910208 ?0@0<5B@K>1J5:B0 7 5910230 ?0@0<5B@K>B1>@0 95 5910237 ?0@0<5B@K>B1>@0imap 16 5910332 ?0@0<5B@K>B1>@0C7;>2dom 86 5910348 ?0@0<5B@K?5@5B0A:820=8O 292 5910434 ?0@0<5B@K?>4:;NG5=8O 21 5910726 ?0@0<5B@K?>4:;NG5=8O2=5H=53>E@0=8;8I042>8G=KE40==KE 57 5910747 ?0@0<5B@K?>4:;NG5=8OA5@25@>204<8=8AB@8@>20=8O 6 5910804 ?0@0<5B@K?>8A:0B01;8F 6 5910810 ?0@0<5B@K?>;CG5=8O0@E820D09;>2 47 5910816 ?0@0<5B@K?>;CG5=8O40==KE 12 5910863 ?0@0<5B@K?>AB@>8B5;O 4 5910875 ?0@0<5B@K?>B>:>2>3>@0A?>7=020=8O 5 5910879 ?0@0<5B@K?>B>:>2>3>@0A?>7=020=8O@5G8 41 5910884 ?0@0<5B@K?@54<5B08AG8A;5=8O 7 5910925 ?0@0<5B@K?@82O7:8 17 5910932 ?0@0<5B@K?@82O7:8::;NGC?>;CG5=8O;8F5=789 34 5910949 ?0@0<5B@K?@82O7:8::><?LNB5@C?>;CG5=8O;8F5=789 47 5910983 ?0@0<5B@K@538AB@0F88 15 5911030 ?0@0<5B@K@538AB@0F888=D>@<0F8>==>9107KA8AB5<K2708<>459AB28O 43 5911045 ?0@0<5B@K@540:B8@>20=8O 37 5911088 ?0@0<5B@K@540:B8@>20=8O:><?>=>2:840==KE 66 5911125 ?0@0<5B@KA50=A0 55 5911191 ?0@0<5B@KA8=B570 10 5911246 ?0@0<5B@KA:0=8@>20=8O 18 5911256 ?0@0<5B@KA:0=8@>20=8O4>:C<5=B>2 55 5911274 ?0@0<5B@KA>548=5=8O 27 5911329 ?0@0<5B@KA>548=5=8O2=5H=53>8AB>G=8:040==KE 78 5911356 ?0@0<5B@KAB@>:8 14 5911434 ?0@0<5B@KAE5<K:><?>=>2:840==KE 84 5911448 ?0@0<5B@KB01;8FKAE5<K70?@>A0 33 5911532 ?0@0<5B@KD>@<8@>20=8O:><0=4?;0=8@>2I8:0 55 5911565 ?0@0<5B@KD>@<8@>20=8O:><0=4?>;O22>40 19 5911620 ?0@0<5B@KD>@<8@>20=8O:><0=4?>;O?;0=8@>2I8:0 58 5911639 ?0@0<5B@KD>@<8@>20=8O:><0=4A8AB5<K2708<>459AB28O 44 5911697 ?0@0<5B@KDC=:F8>=0;L=KE>?F89 38 5911741 ?0@0<5B@KG8A;0 8 5911779 ?0@0<5B@KGB5=8Oxml 101 5911787 ?0@5 8 5911888 ?0@8B8 61 5911896 ?0@=0O 6 5911957 ?0@=>9 6 5911963 ?0@=><5=:;0BC@0 11 5911969 ?0@=K9 6 5911980 ?0@=K<8 6 5911986 ?0@>9 15 5911992 ?0@>;59 342 5912007 ?0@>;5< 91 5912349 ?0@>;8 26 5912440 ?0@>;L 1447 5912466 ?0@>;Limap 9 5913913 ?0@>;Lsmtp 65 5913922 ?0@>;Lsmtp0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC87<5=5= 36 5913987 ?0@>;Lsmtp87<5=5= 36 5914023 ?0@>;L4>ABC?0:70:@KB><C:;NGC 30 5914059 ?0@>;L87<5=5= 48 5914089 ?0@>;L=5A>>B25BAB2C5BB@51>20=8O< 57 5914137 ?0@>;L?>;L7>20B5;O 15 5914194 ?0@>;L?>;L7>20B5;O107K40==KE 30 5914209 ?0@>;L?>;L7>20B5;O2=5H=53>A5@28A08=B53@0F88 9 5914239 ?0@>;LCAB0=>2;5= 90 5914248 ?0@>;LCG5B=>970?8A8 9 5914338 ?0@>;N 13 5914347 ?0@>;O 473 5914360 ?0@>;OE 5 5914833 ?0@?@54<5B0 7 5914838 ?0@B=5@ 13 5914845 ?0@C 17 5914858 ?0@K 93 5914875 ?0@O 8 5914968 ?0AA82 9 5914976 ?0AA82=>5A>548=5=85 5 5914985 ?0AA82=>< 18 5914990 ?0AA82=K9 37 5915008 ?0AA82=K9@568< 9 5915045 ?0AB0 9 5915054 ?0AB5;L=0O 9 5915063 ?0AB5;L=K9 10 5915072 ?0AB5;L=KE 4 5915082 ?0BB5@= 54 5915086 ?0BG 50 5915140 ?0C7 5 5915190 ?0C70 52 5915195 ?0C70?>2B>@0 17 5915247 ?0HB> 14 5915264 ?1N; 5 5915278 ?2@ 16 5915283 ?2E 8 5915299 ?4 25 5915307 ?5@ 24 5915332 ?5@20O 149 5915356 ?5@20OG0ABL 23 5915505 ?5@28G=0O 4 5915528 ?5@28G=>9 22 5915532 ?5@28G=CN 22 5915554 ?5@28G=K9 34 5915576 ?5@28G=KE 4 5915610 ?5@2>3> 371 5915614 ?5@2>5 1056 5915985 ?5@2>5>1JO2;5=85 30 5917041 ?5@2>9 237 5917071 ?5@2>< 217 5917308 ?5@2><C 61 5917525 ?5@2>=0G0;L=> 9 5917586 ?5@2>=0G0;L=>3> 8 5917595 ?5@2>=0G0;L=>5 10 5917603 ?5@2>=0G0;L=>< 8 5917613 ?5@2>=0G0;L=K9 37 5917621 ?5@2>=0G0;L=K<8 6 5917658 ?5@2CN 80 5917664 ?5@2K5 135 5917744 ?5@2K9 2303 5917879 ?5@2K90B@81CB 42 5920182 ?5@2K923@C??5 11 5920224 ?5@2K945=L=545;8 54 5920235 ?5@2K94>G5@=89 388 5920289 ?5@2K9@0745;8B5;L 7 5920677 ?5@2K9A53<5=B 9 5920684 ?5@2K9C?>@O4>G5==K9C75; 9 5920693 ?5@2K9D09; 9 5920702 ?5@2K9M;5<5=B 25 5920711 ?5@2K< 315 5920736 ?5@2KE 84 5921051 ?5@504@5A0F8O 144 5921135 ?5@518@05BAO 4 5921279 ?5@518@0BLAO 26 5921283 ?5@518@0NBAO 22 5921309 ?5@51>@ 102 5921331 ?5@51>@0 88 5921433 ?5@51>@>< 14 5921521 ?5@51@02 4 5921535 ?5@51@0==K9 6 5921539 ?5@51@0=K 6 5921545 ?5@51@0B8 4 5921551 ?5@51@0BL 6 5921555 ?5@51V@ 14 5921561 ?5@525@=CB8 10 5921575 ?5@525@=CBL 10 5921585 ?5@52>4 219 5921595 ?5@52>40 43 5921814 ?5@52>40<8 5 5921857 ?5@52>48B 27 5921862 ?5@52>48BAO 21 5921889 ?5@52>48BL 27 5921910 ?5@52>48BLAO 29 5921937 ?5@52>4>2 5 5921966 ?5@52>4>< 5 5921971 ?5@52>4AB@>:8D>@<0B8@>20==>3>4>:C<5=B0 82 5921976 ?5@52>4K 20 5922058 ?5@52>4OBAO 8 5922078 ?5@52>@0G820BL 8 5922086 ?5@52>@>B 8 5922094 ?5@52>@>B225@E 13 5922102 ?5@52>@>B2;52> 13 5922115 ?5@52K?>;=5=85 8 5922128 ?5@52K?>;=5=8O 8 5922136 ?5@52V4 10 5922144 ?5@53@C60BL 5 5922154 ?5@54 2653 5922159 ?5@5402 6 5924812 ?5@540205<0O 10 5924818 ?5@540205<>3> 44 5924828 ?5@540205<>5 35 5924872 ?5@540205<>9 9 5924907 ?5@540205<>< 9 5924916 ?5@540205<><C 10 5924925 ?5@540205<CN 4 5924935 ?5@540205<K5 63 5924939 ?5@540205<K9 306 5925002 ?5@540205<K< 10 5925308 ?5@540205<KE 76 5925318 ?5@54020;8AL 7 5925394 ?5@54020BL 194 5925401 ?5@54020BLAO 2918 5925595 ?5@5405B 97 5928513 ?5@5405BAO 2714 5928610 ?5@540= 491 5931324 ?5@540=0 113 5931815 ?5@540=89 122 5931928 ?5@540==0O 53 5932050 ?5@540==>3> 656 5932103 ?5@540==>5 127 5932759 ?5@540==>9 190 5932886 ?5@540==>< 14 5933076 ?5@540==><C 200 5933090 ?5@540==CN 38 5933290 ?5@540==K5 131 5933328 ?5@540==K9 3224 5933459 ?5@540==K< 276 5936683 ?5@540==K<8 43 5936959 ?5@540==KE 739 5937002 ?5@540=> 151 5937741 ?5@540=>3> 9 5937892 ?5@540=K 117 5937901 ?5@540AB 5 5938018 ?5@540B8 157 5938023 ?5@540BL 554 5938180 ?5@540G0 322 5938734 ?5@540G5 42 5939056 ?5@540G59 6 5939098 ?5@540G8 202 5939104 ?5@540NBAO 78 5939306 ?5@540QBAO 4 5939384 ?5@5428305B 16 5939388 ?5@542830BL 16 5939404 ?5@5428=CB 5 5939420 ?5@5428=CB0 56 5939425 ?5@5428=CBK9 61 5939481 ?5@5428=CBL 46 5939542 ?5@542K?>;=5=85< 45 5939588 ?5@547025@H5=85<@01>BKA8AB5<K 34 5939633 ?5@54703@C7:>920@80=B0=0A5@25@5 10 5939667 ?5@54703@C7:>940==KE87=0AB@>5:=0A5@25@5 11 5939677 ?5@54703@C7:>9?>;L7>20B5;LA:8E=0AB@>5:=0A5@25@5 20 5939688 ?5@5470:@KB85< 30 5939708 ?5@5470?8ALN 709 5939738 ?5@5470?8ALN=0A5@25@5 134 5940447 ?5@5487<5=5=85<40BK 36 5940581 ?5@5487<5=5=85<@>48B5;O 36 5940617 ?5@548=B5@0:B82=K<2K?>;=5=85< 30 5940653 ?5@54=0G0;><1KAB@>3>@540:B8@>20=8O 15 5940683 ?5@54=0G0;><4>102;5=8O 125 5940698 ?5@54=0G0;><87<5=5=8O 30 5940823 ?5@54=0G0;><>B?@02:840==KE3;02=><C 16 5940853 ?5@54=0G0;><>B?@02:840==KE?>4G8=5==><C 17 5940869 ?5@54=0G0;><@01>BKA8AB5<K 66 5940886 ?5@54=0G0;><@540:B8@>20=8O 10 5940952 ?5@54=59 8 5940962 ?5@54=89 20 5940970 ?5@54=OO 20 5940990 ?5@54=V9 18 5941010 ?5@54>:>=G0=85<@540:B8@>20=8O 24 5941028 ?5@54>B:@KB85< 31 5941052 ?5@54>B<5=>9?@>2545=8O 24 5941083 ?5@54?5@5>B:@KB85<A4@C3>3>A5@25@0 11 5941107 ?5@54?5G0BLN 70 5941118 ?5@54?>4:;NG5=85< 11 5941188 ?5@54?@>2545=85< 24 5941199 ?5@54@072>@0G820=85< 84 5941223 ?5@54@072>@0G820=85<M;5<5=B087<5@5=8O 10 5941307 ?5@54A2>@0G820=85< 84 5941317 ?5@54A2>@0G820=85<M;5<5=B087<5@5=8O 10 5941401 ?5@54A>740=85< 23 5941411 ?5@54A>740=85<2;>65==KE187=5A?@>F5AA>2 12 5941434 ?5@54A>740=85<7040G 17 5941446 ?5@54A>740=85<=0G0;L=>3>>1@070 16 5941463 ?5@54A>E@0=5=85<7=0G5=89 24 5941479 ?5@54AB0@B>< 22 5941503 ?5@54B5:CI59AB@>:>9 18 5941525 ?5@54C40;5=85< 149 5941543 ?5@54CAB0=>2:>9?><5B:8C40;5=8O 108 5941692 ?5@5703@C7:0 11 5941800 ?5@5703@C7:5 6 5941811 ?5@570;82:0 4 5941817 ?5@570?8A0= 12 5941821 ?5@570?8A0==K9 43 5941833 ?5@570?8A0=> 4 5941876 ?5@570?8A0=K 27 5941880 ?5@570?8A0B8 4 5941907 ?5@570?8AK205<0O 4 5941911 ?5@570?8AK205<O 4 5941915 ?5@570?8AK205B 21 5941919 ?5@570?8AK205BAO 41 5941940 ?5@570?8AK20;0AL 15 5941981 ?5@570?8AK20BL 26 5941996 ?5@570?8AK20BLAO 56 5942022 ?5@570?8AK20O 5 5942078 ?5@570?8AL 23 5942083 ?5@570?CA: 147 5942106 ?5@570?CA:0 84 5942253 ?5@570?CA:0BL 4 5942337 ?5@570?CA:0BLAO 10 5942341 ?5@570?CA:0NBAO 10 5942351 ?5@570?CA:5 8 5942361 ?5@570?CA:C 10 5942369 ?5@570?CAB8BL 5 5942379 ?5@570?CAB8BL?@87025@H5=88 16 5942384 ?5@570?CI5= 21 5942400 ?5@570?CI5==K9 21 5942421 ?5@58<5=>20=85 392 5942442 ?5@58<5=>20=88 272 5942834 ?5@58<5=>20=8O 303 5943106 ?5@58<5=>20BL 17 5943409 ?5@58<5=>20BL?>GB>2K9OI8: 10 5943426 ?5@58<5=>20BLC75; 20 5943436 ?5@58<5=>2K205<>3> 9 5943456 ?5@58<5=>2K205<K9 11 5943465 ?5@58<5=>2K205B 12 5943476 ?5@58<5=>2K20BL 14 5943488 ?5@58=45:A0F8N 9 5943502 ?5@58=45:A0F8O 13 5943511 ?5@58=45:A8@>20BL 11 5943524 ?5@58A?>;L7>20=85 4 5943535 ?5@58A?>;L7>20BL 8 5943539 ?5@5945B 5 5943547 ?5@594O 12 5943552 ?5@594QB 4 5943564 ?5@59B8 262 5943568 ?5@59B80A8=E 60 5943830 ?5@59B82?5@54 12 5943890 ?5@59B8:40B5 10 5943902 ?5@59B8:7=0G5=8N 10 5943912 ?5@59B8::>=FC 12 5943922 ?5@59B8:=0G0;C 12 5943934 ?5@59B8:=0G0;L=>9AB@0=8F5 10 5943946 ?5@59B8:?5@2>9AB@>:5 10 5943956 ?5@59B8:?>A;54=59AB@>:5 10 5943966 ?5@59B8:?@54K4CI59AB@>:5 10 5943976 ?5@59B8:?@54K4CI5<C>:=C 10 5943986 ?5@59B8:?@54K4CI5<CM;5<5=BC 20 5943996 ?5@59B8:A;54CNI59AB@>:5 10 5944016 ?5@59B8:A;54CNI5<C>:=C 10 5944026 ?5@59B8:A;54CNI5<CM;5<5=BC 20 5944036 ?5@59B8:A>45@68<><C 48 5944056 ?5@59B8:AB@>:5 10 5944104 ?5@59B8=03>42?5@54 10 5944114 ?5@59B8=03>4=0704 10 5944124 ?5@59B8=0704 12 5944134 ?5@59B8=0<5AOF2?5@54 10 5944146 ?5@59B8=0<5AOF=0704 10 5944156 ?5@59B8=0C@>25=L225@E 10 5944166 ?5@59B8=0C@>25=L2=87 10 5944176 ?5@59B8?>2=5H=59=02830F8>==>9AAK;:5 12 5944186 ?5@59B8?>=02830F8>==>9AAK;:5 70 5944198 ?5@5:;NG05<K9 30 5944268 ?5@5:;NG05B 4 5944298 ?5@5:;NG0B5;59 15 5944302 ?5@5:;NG0B5;8 11 5944317 ?5@5:;NG0B5;L 268 5944328 ?5@5:;NG0B5;L1 6 5944596 ?5@5:;NG0B5;L2 6 5944602 ?5@5:;NG0B5;L3 6 5944608 ?5@5:;NG0B5;L4 6 5944614 ?5@5:;NG0B5;N 4 5944620 ?5@5:;NG0B5;O 165 5944624 ?5@5:;NG0B5;O<8 6 5944789 ?5@5:;NG0B5;OE 5 5944795 ?5@5:;NG0BL 34 5944800 ?5@5:;NG0BLAO 28 5944834 ?5@5:;NG5=85 176 5944862 ?5@5:;NG5=85< 6 5945038 ?5@5:;NG5=88 38 5945044 ?5@5:;NG5=8O 81 5945082 ?5@5:;NG8B8 9 5945163 ?5@5:;NG8B8AO 28 5945172 ?5@5:;NG8BL 9 5945200 ?5@5:;NG8BL0:B82=>ABL 12 5945209 ?5@5:;NG8BL2K45;5=85 25 5945221 ?5@5:;NG8BL8=B5@D59A 18 5945246 ?5@5:;NG8BL?><5B:CC40;5=8OAB@>:8 10 5945264 ?5@5:>48@>20=85 4 5945274 ?5@5:>48@>20=8O 4 5945278 ?5@5:@5AB85 4 5945282 ?5@5:@>5B 4 5945286 ?5@5:@K205B 5 5945290 ?5@5:@K20BL 17 5945295 ?5@5:@K20NB 12 5945312 ?5@5:@K20NI85AO 4 5945324 ?5@5:@K20NI89AO 55 5945328 ?5@5:@K20NI8EAO 51 5945383 ?5@5:@KB85 4 5945434 ?5@5:@KB8O 4 5945438 ?5@5:@KBL 4 5945442 ?5@5;8ABK20=85 4 5945446 ?5@5;8ABK20=8O 4 5945450 ?5@5< 47 5945454 ?5@5<1 7 5945501 ?5@5<5=0 4 5945508 ?5@5<5==0O 431 5945512 ?5@5<5==0OB8?0AB0=40@B=K9?5@8>4 5 5945943 ?5@5<5==>5 4 5945948 ?5@5<5==>9 139 5945952 ?5@5<5==CN 51 5946091 ?5@5<5==K5 75 5946142 ?5@5<5==K9 435 5946217 ?5@5<5==K< 10 5946652 ?5@5<5==K<8 12 5946662 ?5@5<5==KE 182 5946674 ?5@5<5=>9 4 5946856 ?5@5<5AB8; 4 5946860 ?5@5<5AB8BL 252 5946864 ?5@5<5AB8BL225@E 12 5947116 ?5@5<5AB8BL2;52> 12 5947128 ?5@5<5AB8BL2=87 12 5947140 ?5@5<5AB8BL2?>GB>2K9OI8: 10 5947152 ?5@5<5AB8BL2?@02> 12 5947162 ?5@5<5AB8BLD09; 28 5947174 ?5@5<5AB8BLD09;0A8=E 27 5947202 ?5@5<5B=>9 4 5947229 ?5@5<5B=K9 4 5947233 ?5@5<5H820BL 18 5947237 ?5@5<5I05<0O 5 5947255 ?5@5<5I05<>5 22 5947260 ?5@5<5I05<>9 5 5947282 ?5@5<5I05<K9 294 5947287 ?5@5<5I05<K9D09; 5 5947581 ?5@5<5I05=85 4 5947586 ?5@5<5I05B 354 5947590 ?5@5<5I05BAO 68 5947944 ?5@5<5I0BL 442 5948012 ?5@5<5I0BLAO 96 5948454 ?5@5<5I0NBAO 16 5948550 ?5@5<5I5= 14 5948566 ?5@5<5I5=85 226 5948580 ?5@5<5I5=853@0=8FK?@8?@>2545=88 37 5948806 ?5@5<5I5=85?>:0;5=40@N 20 5948843 ?5@5<5I5=85B>20@>2 6 5948863 ?5@5<5I5=88 42 5948869 ?5@5<5I5=8O 65 5948911 ?5@5<5I5==K5 5 5948976 ?5@5<5I5==K9 19 5948981 ?5@5=07=0G5=85 10 5949000 ?5@5=07=0G8BL2A5A5@28AK 6 5949010 ?5@5=0?@02;5= 5 5949016 ?5@5=0?@02;5==K9 5 5949021 ?5@5=5A5= 5 5949026 ?5@5=5A5=0 5 5949031 ?5@5=5A5==>< 4 5949036 ?5@5=5A5==K9 52 5949040 ?5@5=5A5==K< 5 5949092 ?5@5=5A5==KE 4 5949097 ?5@5=5A5=K 8 5949101 ?5@5=5AB8 39 5949109 ?5@5=5AB8M;5<5=B 12 5949148 ?5@5=>A 392 5949160 ?5@5=>A0 194 5949552 ?5@5=>A0E 8 5949746 ?5@5=>A5 34 5949754 ?5@5=>A8B8 38 5949788 ?5@5=>A8B8AO 13 5949826 ?5@5=>A8BAO 13 5949839 ?5@5=>A8BL 38 5949852 ?5@5=>A8BLAO 59 5949890 ?5@5=>A8BLM;5<5=BK?>206=>AB8 13 5949949 ?5@5=>A>2 4 5949962 ?5@5=>A>< 39 5949966 ?5@5=>AAB@>: 14 5950005 ?5@5=>AAB@>:json 38 5950019 ?5@5=>AC 4 5950057 ?5@5=>AOBAO 33 5950061 ?5@5>?@545;5= 5 5950094 ?5@5>?@545;5=85 28 5950099 ?5@5>?@545;5=85xs 841 5950127 ?5@5>?@545;5=89 5 5950968 ?5@5>?@545;5=8O 17 5950973 ?5@5>?@545;5==>9 12 5950990 ?5@5>?@545;5==K9 110 5951002 ?5@5>?@545;5==K< 6 5951112 ?5@5>?@545;5=> 76 5951118 ?5@5>?@545;5=K 4 5951194 ?5@5>?@545;8BL 162 5951198 ?5@5>?@545;O5BAO 8 5951360 ?5@5>?@545;OBL 4 5951368 ?5@5>?@545;OBLAO 8 5951372 ?5@5>?@545;ONB 4 5951380 ?5@5>B:@K205B 4 5951384 ?5@5>B:@KB0 4 5951388 ?5@5>B:@KB88 9 5951392 ?5@5>B:@KBL 4 5951401 ?5@5>B:@KBLA4@C3>3>A5@25@0 11 5951405 ?5@5?8A02 5 5951416 ?5@5?8A0B8 5 5951421 ?5@5?8A0BL 5 5951426 ?5@5?>;=5=85 40 5951431 ?5@5?>;=5=8O 35 5951471 ?5@5?@028B8AO 4 5951506 ?5@5?@02;OBLAO 4 5951510 ?5@5?@8A2>5=> 10 5951514 ?5@5?@>2545=85 8 5951524 ?5@5?@>2545=8O 8 5951532 ?5@5?@>2545=K 11 5951540 ?5@5?@>25AB8 6 5951551 ?5@5@0AAG8B0BL 10 5951557 ?5@5@0AG5B 703 5951567 ?5@5@0AG5B0 303 5952270 ?5@5@0AG5B0<8 5 5952573 ?5@5@0AG5B4>?>;=8B5;L=KE=0G8A;5=89 10 5952578 ?5@5@0AG5B70?8AL 60 5952588 ?5@5@0AG5B<5=5465@ 33 5952648 ?5@5@0AG5B=01>@70?8A59 177 5952681 ?5@5@0AG5B>2 71 5952858 ?5@5@0AG5B>A=>2=KE=0G8A;5=89 5 5952929 ?5@5@0AG5BK 83 5952934 ?5@5@0AG5BK<5=5465@ 22 5953017 ?5@5@0AG8B0BL 4 5953039 ?5@5A5:0BL 8 5953043 ?5@5A5:0BLAO 37 5953051 ?5@5A5:0NB 4 5953088 ?5@5A5:0NBAO 6 5953092 ?5@5A5:0O 4 5953098 ?5@5A5G5=85 56 5953102 ?5@5A5G5=88 31 5953158 ?5@5A5G5=8O 9 5953189 ?5@5A;0==>5 10 5953198 ?5@5A;0==K9 10 5953208 ?5@5A=8B8 4 5953218 ?5@5A=OBL 4 5953222 ?5@5A>740=85 4 5953226 ?5@5A>740=85< 4 5953230 ?5@5AB020BL 59 5953234 ?5@5AB028B8 10 5953293 ?5@5AB028BL 10 5953303 ?5@5AB05B 44 5953313 ?5@5AB0=5B 16 5953357 ?5@5AB0BL 16 5953373 ?5@5AB0NB 15 5953389 ?5@5AB@08205B 21 5953404 ?5@5AB@08205BAO 9 5953425 ?5@5AB@0820BL 21 5953434 ?5@5AB@0820BLAO 9 5953455 ?5@5AB@>5=85 20 5953464 ?5@5AB@>5=88 10 5953484 ?5@5AB@>5=8O 10 5953494 ?5@5AB@>8BL8A?>;L7>20=8503@530B>2 12 5953504 ?5@5AG5B 146 5953516 ?5@5AG5B0 46 5953662 ?5@5AG5B5 22 5953708 ?5@5AG8B0BL 10 5953730 ?5@5AG8B0BL8B>38 38 5953740 ?5@5AG8B0BL8B>3870?5@8>4 26 5953778 ?5@5AG8B0BLB5:CI858B>38 26 5953804 ?5@5AG8BK205B 5 5953830 ?5@5AG8BK20BL 5 5953835 ?5@5AG8BK20BLAO 5 5953840 ?5@5AG8BK20NBAO 5 5953845 ?5@5AGQB 8 5953850 ?5@5AK;:0 5 5953858 ?5@5AK;:8 5 5953863 ?5@5B0A:8205<>5 180 5953868 ?5@5B0A:8205<K9 188 5954048 ?5@5B0A:820=85 607 5954236 ?5@5B0A:820=85< 10 5954843 ?5@5B0A:820=88 230 5954853 ?5@5B0A:820=8O 339 5955083 ?5@5B0A:820BL 18 5955422 ?5@5B0A:820BLAO 4 5955440 ?5@5B0A:820NBAO 4 5955444 ?5@5BL 21635 5955448 ?5@5BO=CBL 4 5977083 ?5@5C;>: 4 5977087 ?5@5CAB0=02;820BL 12 5977091 ?5@5E20B 4 5977103 ?5@5E20B5 4 5977107 ?5@5E20BK205<K9 13 5977111 ?5@5E20BK205<KE 13 5977124 ?5@5E20G5==K9 11 5977137 ?5@5E20G5=> 11 5977148 ?5@5E>4 608 5977159 ?5@5E>40 194 5977767 ?5@5E>45 52 5977961 ?5@5E>48B 30 5978013 ?5@5E>48B8 35 5978043 ?5@5E>48BL 65 5978078 ?5@5E>4=025@A8N8AB>@8840==KE 6 5978143 ?5@5E>4>2 4 5978149 ?5@5E>4>< 10 5978153 ?5@5E>4?>=02830F8>==>9AAK;:5 45 5978163 ?5@5E>4?>M;5<5=B0<D>@<K 10 5978208 ?5@5E>4K 8 5978218 ?5@5EV4 10 5978226 ?5@5G5=L 83 5978236 ?5@5G8A;5= 15 5978319 ?5@5G8A;5=85 1690 5978334 ?5@5G8A;5=85<5=5465@ 98 5980024 ?5@5G8A;5=85A?8A>: 18 5980122 ?5@5G8A;5=85AAK;:0 69 5980140 ?5@5G8A;5=88 15 5980209 ?5@5G8A;5=89 132 5980224 ?5@5G8A;5=8N 5 5980356 ?5@5G8A;5=8O 1158 5980361 ?5@5G8A;5=8O< 25 5981519 ?5@5G8A;5=8O<5=5465@ 30 5981544 ?5@5G8A;5=8O<8 32 5981574 ?5@5G8A;5==K5 57 5981606 ?5@5G8A;5==K9 293 5981663 ?5@5G8A;5==K< 15 5981956 ?5@5G8A;5==KE 179 5981971 ?5@5G8A;5=K 34 5982150 ?5@5G8A;5=L5 132 5982184 ?5@5G8A;8<>9 4 5982316 ?5@5G8A;8<K5 4 5982320 ?5@5G8A;8<K5A2>9AB20>1J5:B>2<5B040==KE 583 5982324 ?5@5G8A;8<K9 8 5982907 ?5@5G8A;8BL 24 5982915 ?5@5G8A;OBLAO 54 5982939 ?5@5G8A;ONBAO 54 5982993 ?5@5G8B0BL 13 5983047 ?5@5G8BK205B 8 5983060 ?5@5G8BK20=85< 85 5983068 ?5@5G8BK20=88 40 5983153 ?5@5G8BK20BL 8 5983193 ?5@5G=5< 5 5983201 ?5@5G=O 5 5983206 ?5@8<5B@ 4 5983211 ?5@8<5B@C 4 5983215 ?5@8>4 3549 5983219 ?5@8>40 1916 5986768 ?5@8>402B>>1=>2;5=8O 208 5988684 ?5@8>40< 10 5988892 ?5@8>40<8 33 5988902 ?5@8>43>4 77 5988935 ?5@8>4459AB28O 124 5989012 ?5@8>4459AB28O107>2K9 44 5989136 ?5@8>4459AB28O:>=5F 90 5989180 ?5@8>4459AB28O=0G0;> 100 5989270 ?5@8>445:040 77 5989370 ?5@8>445=L 77 5989447 ?5@8>45 14 5989524 ?5@8>48G5A:8 19 5989538 ?5@8>48G5A:89 165 5989557 ?5@8>48G5A:8< 6 5989722 ?5@8>48G5A:8<8 5 5989728 ?5@8>48G5A:8E 80 5989733 ?5@8>48G5A:>3> 62 5989813 ?5@8>48G5A:>9 11 5989875 ?5@8>48G=>AB59 4 5989886 ?5@8>48G=>AB8 136 5989890 ?5@8>48G=>ABL 974 5990026 ?5@8>48G=>ABL03@530B0@538AB@0=0:>?;5=8O 49 5991000 ?5@8>48G=>ABL=><5@0 31 5991049 ?5@8>48G=>ABL=><5@0187=5A?@>F5AA0 53 5991080 ?5@8>48G=>ABL=><5@04>:C<5=B0 57 5991133 ?5@8>48G=>ABL@538AB@0@0AG5B0 40 5991190 ?5@8>48G=>ABL@538AB@0A2545=89 62 5991230 ?5@8>48G=>ABLN 440 5991292 ?5@8>4:20@B0; 77 5991732 ?5@8>4;5B 9 5991809 ?5@8>4<5AOF 77 5991818 ?5@8>4<5AOF52 9 5991895 ?5@8>4<8=CB0 77 5991904 ?5@8>4=545;L 22 5991981 ?5@8>4=545;O 77 5992003 ?5@8>4>2 125 5992080 ?5@8>4>< 207 5992205 ?5@8>4>B>1@065=8O?;0=8@>2I8:0 56 5992412 ?5@8>4?5@570?CA:0 13 5992468 ?5@8>4?5@570?CA:0?@>F5AA0 11 5992481 ?5@8>4?>2B>@02B5G5=854=O 21 5992492 ?5@8>4?>2B>@04=59 26 5992513 ?5@8>4?>;C3>485 77 5992539 ?5@8>4?@52KH5=8O2@5<5==>4>?CAB8<>3>>1J5<0?0<OB8?@>F5AA>2 21 5992616 ?5@8>4?@>25@:8A>548=5=8O 19 5992637 ?5@8>4@0745;5=8O 42 5992656 ?5@8>4@0745;5=8OE@0=5=8O40==KE 6 5992698 ?5@8>4@0745;5=8OE@0=5=8O40==KE6C@=0;0@538AB@0F88 50 5992704 ?5@8>4@538AB@0F88 117 5992754 ?5@8>4A5:C=40 79 5992871 ?5@8>4C 113 5992950 ?5@8>4G0A 79 5993063 ?5@8>4K 81 5993142 ?5@8>4K459AB28O 6 5993223 ?5@8D5@89=>3> 4 5993229 ?5@8D5@89=K9 39 5993233 ?5@8D5@89=K< 35 5993272 ?5@;0<CB@>2K9 13 5993307 ?5@<5==K5 5 5993320 ?5@> 24 5993325 ?5@?5=48:C;O@=>9 4 5993349 ?5@?5=48:C;O@=K9 4 5993353 ?5@A84A:89 16 5993357 ?5@A8:>2K9 13 5993373 ?5@A>=0 44 5993386 ?5@A>=0; 14 5993430 ?5@A>=0;L=0O 4 5993444 ?5@A>=0;L=89 13 5993448 ?5@A>=0;L=>3> 13 5993461 ?5@A>=0;L=>9 4 5993474 ?5@A>=0;L=K5 17 5993478 ?5@A>=0;L=K5A5@B8D8:0BK 17 5993495 ?5@A>=0;L=K9 73 5993512 ?5@A>=0;L=K< 4 5993585 ?5@A>=0;L=KE 33 5993589 ?5@A>=5 4 5993622 ?5@A>=K 40 5993626 ?5@A?5:B82=K58A:065=8O 9 5993666 ?5@A?5:B82=K9 4 5993675 ?5@A?5:B82=KE 4 5993679 ?5@B8 21629 5993683 ?5@C 12 6015312 ?5A>: 10 6015324 ?5A>G=> 5 6015334 ?5A>G=>:>@8G=52K9 12 6015339 ?5B@ 22 6015351 ?5B@>2 6 6015373 ?5B@>28G 11 6015379 ?5G0B05<K9 16 6015390 ?5G0B05<KE 8 6015406 ?5G0B05BAO 5 6015414 ?5G0B0BL 8 6015419 ?5G0B0BLAO 15 6015427 ?5G0B0NBAO 10 6015442 ?5G0B59 4 6015452 ?5G0B8 304 6015456 ?5G0B=K9 12 6015760 ?5G0B=KE 12 6015772 ?5G0BL 579 6015784 ?5G0BL=060B85 3 6016363 ?5G0BLA@07C 12 6016366 ?5G0BLN 46 6016378 ?8 6 6016424 ?89 18 6016430 ?8:A5;59 89 6016448 ?8:A5;L 173 6016537 ?8:A5;O 41 6016710 ?8:A5;OE 53 6016751 ?8:B>3@0<< 10 6016804 ?8:B>3@0<<0 52 6016814 ?8:B>3@0<<0<8 4 6016866 ?8:B>3@0<<C 5 6016870 ?8:B>3@0<<K 9 6016875 ?8; 335 6016884 ?8;0 335 6017219 ?8= 4 6017554 ?8=:>4 18 6017558 ?8=:>40 4 6017576 ?8@0<840 4 6017580 ?8@0<840<8 4 6017584 ?8A0BL 11 6017588 ?8A0BLAO 59 6017599 ?8A5< 27 6017658 ?8AL<0 134 6017685 ?8AL<5 4 6017819 ?8AL<> 187 6017823 ?8AL<C 4 6018010 ?8BL 335 6018014 ?8H5BAO 6 6018349 ?8HCBAO 53 6018355 ?: 26 6018408 ?; 7 6018434 ?;020BL 4 6018441 ?;020NI53> 20 6018445 ?;020NI59 4 6018465 ?;020NI5< 4 6018469 ?;020NI89 32 6018473 ?;02=>5 4 6018505 ?;02=>9 4 6018509 ?;02=K9 15 6018513 ?;0= 6852 6018528 ?;0=0 6074 6025380 ?;0=0< 15 6031454 ?;0=0<8 151 6031469 ?;0=284>2@0AG5B0 651 6031620 ?;0=284>2@0AG5B02K1>@:0 137 6032271 ?;0=284>2@0AG5B0<5=5465@ 201 6032408 ?;0=284>2@0AG5B0>1J5:B 384 6032609 ?;0=284>2@0AG5B0A?8A>: 46 6032993 ?;0=284>2@0AG5B0AAK;:0 398 6033039 ?;0=284>2@0AG5B0B01;8G=0OG0ABL 18 6033437 ?;0=284>2E0@0:B5@8AB8: 685 6033455 ?;0=284>2E0@0:B5@8AB8:2K1>@:0 125 6034140 ?;0=284>2E0@0:B5@8AB8:<5=5465@ 213 6034265 ?;0=284>2E0@0:B5@8AB8:>1J5:B 398 6034478 ?;0=284>2E0@0:B5@8AB8:A?8A>: 55 6034876 ?;0=284>2E0@0:B5@8AB8:AAK;:0 518 6034931 ?;0=284>2E0@0:B5@8AB8:B01;8G=0OG0ABL 18 6035449 ?;0=3;>10;L=>3>?>8A:0 71 6035467 ?;0=5 35 6035538 ?;0=8@>20=85 4 6035573 ?;0=8@>20=8O 4 6035577 ?;0=8@>20BLAO 4 6035581 ?;0=8@>2I8: 1156 6035585 ?;0=8@>2I8:0 1011 6036741 ?;0=8@>2I8:5 26 6037752 ?;0=8@>2I8:>< 4 6037778 ?;0=8@C5BAO 4 6037782 ?;0=>1<5=0 613 6037786 ?;0=>1<5=02K1>@:0 113 6038399 ?;0=>1<5=0<5=5465@ 170 6038512 ?;0=>1<5=0>1J5:B 469 6038682 ?;0=>1<5=0A?8A>: 42 6039151 ?;0=>1<5=0AAK;:0 462 6039193 ?;0=>1<5=0B01;8G=0OG0ABL 18 6039655 ?;0=>2 272 6039673 ?;0=>< 61 6039945 ?;0=?>8A:0 13 6040006 ?;0=AG5B>2 676 6040019 ?;0=AG5B>2284KAC1:>=B> 139 6040695 ?;0=AG5B>2284KAC1:>=B>AB@>:0 76 6040834 ?;0=AG5B>22K1>@:0 152 6040910 ?;0=AG5B>2<5=5465@ 204 6041062 ?;0=AG5B>2>1J5:B 415 6041266 ?;0=AG5B>2A?8A>: 50 6041681 ?;0=AG5B>2AAK;:0 543 6041731 ?;0=AG5B>2B01;8G=0OG0ABL 18 6042274 ?;0=C 5 6042292 ?;0=H5B 36 6042297 ?;0=H5B0 12 6042333 ?;0=H5B0E 4 6042345 ?;0=H5B5 5 6042349 ?;0=H5B>2 15 6042354 ?;0=K 97 6042369 ?;0=K284>2@0AG5B0 52 6042466 ?;0=K284>2@0AG5B0<5=5465@ 29 6042518 ?;0=K284>2E0@0:B5@8AB8: 88 6042547 ?;0=K284>2E0@0:B5@8AB8:<5=5465@ 29 6042635 ?;0=K>1<5=0 168 6042664 ?;0=K>1<5=0<5=5465@ 133 6042832 ?;0=K>1<5=>2 10 6042965 ?;0=KAG5B>2 74 6042975 ?;0=KAG5B>2<5=5465@ 29 6043049 ?;0B56 10 6043078 ?;0B5659 10 6043088 ?;0B56=K9 4 6043098 ?;0B56=K< 4 6043102 ?;0B5;LI8: 13 6043106 ?;0B8=0 10 6043119 ?;0B=K9 10 6043129 ?;0BD><5 4 6043139 ?;0BD>@< 4 6043143 ?;0BD>@<0 1446 6043147 ?;0BD>@<0E 16 6044593 ?;0BD>@<5 653 6044609 ?;0BD>@<>9 129 6045262 ?;0BD>@<C 24 6045391 ?;0BD>@<K 517 6045415 ?;0F 22 6045932 ?;8B0 12 6045954 ?;8BK 12 6045966 ?;>A:89 24 6045978 ?;>A:8E 10 6046002 ?;>A:>AB8 9 6046012 ?;>A:>ABL 9 6046021 ?;>B=>AB8 29 6046030 ?;>B=>ABL 48 6046059 ?;>B=>ABL?>25@B8:0;8 14 6046107 ?;>B=>ABL?>3>@87>=B0;8 14 6046121 ?;>B=>ABLA>E@0=O5<KE:0@B8=>: 26 6046135 ?;>B=>ABLA>E@0=O5<KE:0@B8=>:B01;8G=>3>4>:C<5=B0 40 6046161 ?;>B=>ABLN 4 6046201 ?;>E> 4 6046205 ?;>I048 5 6046209 ?;>I04L 22 6046214 ?;>I04LN 5 6046236 ?;NA 87 6046241 ?> 25913 6046328 ?>1 27 6072241 ?>18B>2>3> 17 6072268 ?>18B>2>5 9 6072285 ?>18B>2>58 22 6072294 ?>18B>2>58;8 11 6072316 ?>18B>2>58=5 11 6072327 ?>18B>2>58A:;NG8B5;L=>58;8 11 6072338 ?>18B>2>5=5 16 6072349 ?>18B>2>9 28 6072365 ?>18B>2K9 60 6072393 ?>18B>2K9A42832;52> 11 6072453 ?>18B>2K9A42832?@02> 13 6072464 ?>2545=85 415 6072477 ?>2545=85:;028H8enter 26 6072892 ?>2545=85< 8 6072918 ?>2545=85>1KG=>93@C??K 29 6072926 ?>2545=85?@8=54>ABC?=>AB8>A=>2=>3>A5@25@0 74 6072955 ?>2545=85?@8A60B88?>3>@87>=B0;8 9 6073029 ?>2545=85B01;8FK?@8A60B88?>3>@87>=B0;8 24 6073038 ?>2545=85M;5<5=B>2?;0=8@>2I8:0?@8=54>AB0B:5<5AB0 19 6073062 ?>2545=85M;5<5=B>2?@8=54>AB0B:5<5AB0 9 6073081 ?>2545=8N 5 6073090 ?>2545=8O 55 6073095 ?>25@=CB0 4 6073150 ?>25@=CB0O 4 6073154 ?>25@=CB8 36 6073158 ?>25@=CB89 4 6073194 ?>25@=CBK9 8 6073198 ?>25@=CBL 36 6073206 ?>25@=CBL?>G0A>2>9AB@5;:5 12 6073242 ?>25@=CBL?@>B82G0A>2>9AB@5;:8 12 6073254 ?>25@B8:0;8 19 6073266 ?>25@E 101 6073285 ?>25@E=>AB8 10 6073386 ?>25@E=>AB=0O 4 6073396 ?>25@E=>AB=K9 8 6073400 ?>25@E=>AB=KE 4 6073408 ?>25@E=>ABL 36 6073412 ?>2;8O5B 16 6073448 ?>2;8OBL 30 6073464 ?>2>4 5 6073494 ?>2>4C 5 6073499 ?>2>7@0AB0=8N 9 6073504 ?>2>7@0AB0=8N85@0@E88 9 6073513 ?>2>@0G8205B 8 6073522 ?>2>@0G820BL 16 6073530 ?>2>@0G820BLAO 5 6073546 ?>2>@>B 18 6073551 ?>2>@>B0 17 6073569 ?>2B>@ 40 6073586 ?>2B>@0 6 6073626 ?>2B>@5= 5 6073632 ?>2B>@5=85 59 6073637 ?>2B>@5=85A>1KB8O:0;5=40@O 34 6073696 ?>2B>@5=88 10 6073730 ?>2B>@5=89 5 6073740 ?>2B>@5=8O 42 6073745 ?>2B>@5==K5 4 6073787 ?>2B>@5==K9 25 6073791 ?>2B>@5==KE 4 6073816 ?>2B>@5=> 8 6073820 ?>2B>@5=L5 5 6073828 ?>2B>@8B8 54 6073833 ?>2B>@8B8AO 14 6073887 ?>2B>@8BL 37 6073901 ?>2B>@8BL>B<5=0 9 6073938 ?>2B>@=89 56 6073947 ?>2B>@=> 72 6074003 ?>2B>@=>3> 56 6074075 ?>2B>@=>5 50 6074131 ?>2B>@=>58A?>;L7>20=85 105 6074181 ?>2B>@=>58A?>;L7>20=852>72@0I05<KE7=0G5=89 42 6074286 ?>2B>@=>58A?>;L7>20=85A50=A>2 18 6074328 ?>2B>@=>9 14 6074346 ?>2B>@=>< 181 6074360 ?>2B>@=K9 383 6074541 ?>2B>@=K< 6 6074924 ?>2B>@=K<8 4 6074930 ?>2B>@>2 8 6074934 ?>2B>@K 16 6074942 ?>2B>@O5<>5GB5=85 13 6074958 ?>2B>@O5<>AB8 12 6074971 ?>2B>@O5<>ABL 12 6074983 ?>2B>@O5B 4 6074995 ?>2B>@O5BAO 43 6074999 ?>2B>@OBL 12 6075042 ?>2B>@OBL?@8?5G0B8:>;>=:8 11 6075054 ?>2B>@OBL?@8?5G0B8AB@>:8 11 6075065 ?>2B>@OBLAO 61 6075076 ?>2B>@ONBAO 4 6075137 ?>2B>@ONI85AO 10 6075141 ?>2B>@ONI89AO 11 6075151 ?>2B>@ONI8<8 5 6075162 ?>2B>@ONI8EAO 5 6075167 ?>2K45;5==K<:>;>=:0< 11 6075172 ?>2KA8BL 35 6075183 ?>2KH05B 20 6075218 ?>2KH05BAO 21 6075238 ?>2KH0BL 26 6075259 ?>2KH0BLAO 21 6075285 ?>2KH0NB 6 6075306 ?>2KH5= 6 6075312 ?>2KH5=85 33 6075318 ?>2KH5=88 6 6075351 ?>2KH5=8N 12 6075357 ?>2KH5=8O 7 6075369 ?>2V4 5 6075376 ?>3>@87>=B0;8 20 6075381 ?>3>@87>=B0;L=K<AB@>:0<B5:AB0 13 6075401 ?>3@5H=>ABL 8 6075414 ?>3@C??8@>2:0< 24 6075422 ?>3@C??8@>2:0<A85@0@E859 21 6075446 ?>4 661 6075467 ?>40= 5 6076128 ?>40==K9 5 6076133 ?>40@:8 4 6076138 ?>40@>: 4 6076142 ?>40AB 5 6076146 ?>40BL 5 6076151 ?>415@5B 4 6076156 ?>418@05B 5 6076160 ?>418@05BAO 29 6076165 ?>418@0BL 21 6076194 ?>418@0BLAO 55 6076215 ?>418@0NBAO 12 6076270 ?>41>@ 188 6076282 ?>41>@0 178 6076470 ?>41>@2K1>@ 6 6076648 ?>41>@5 16 6076654 ?>41>@>< 10 6076670 ?>420; 273 6076680 ?>420;0 167 6076953 ?>420;3@C??8@>2:8 5 6077120 ?>420;3@C??8@>2:8:>;>=:8 6 6077125 ?>420;3@C??8@>2:8A?8A:0 6 6077131 ?>420;4>:C<5=B0 5 6077137 ?>420;5 73 6077142 ?>420;85@0@E88 9 6077215 ?>420;85@0@E8G5A:>93@C??8@>2:8 5 6077224 ?>420;85@0@E8G5A:>93@C??8@>2:8:>;>=:8 6 6077229 ?>420;85@0@E8G5A:>93@C??8@>2:8A?8A:0 6 6077235 ?>420;>2 4 6077241 ?>42545=85 5 6077245 ?>42545=88 5 6077250 ?>42K@065=85 5 6077255 ?>42K@065=8O 5 6077260 ?>43>B>28BL 6 6077265 ?>43>B>28BLAO 10 6077271 ?>43>B>2:0?@5AA@5;870 5 6077281 ?>43>B>2;5= 9 6077286 ?>43>B>2;5=0 5 6077295 ?>43>B>2;5==K9 39 6077300 ?>43>B>2;5==K< 18 6077339 ?>43>B>2;5==KE 5 6077357 ?>43@0D 20 6077362 ?>43@0D0 10 6077382 ?>43@0DK 12 6077392 ?>445@520 378 6077404 ?>445@52> 432 6077782 ?>445@52C 12 6078214 ?>445@60=85 18 6078226 ?>445@68205<>3> 12 6078244 ?>445@68205<>5 9 6078256 ?>445@68205<>< 8 6078265 ?>445@68205<K5 288 6078273 ?>445@68205<K5=01>@K7=0:>2 9 6078561 ?>445@68205<K5B8?KA>45@60=8O 9 6078570 ?>445@68205<K9 352 6078579 ?>445@68205<KE 35 6078931 ?>445@68205B 770 6078966 ?>445@68205B2KA>BC 9 6079736 ?>445@68205B=0?@02;5=85 9 6079745 ?>445@68205BA:>@>ABL 9 6079754 ?>445@68205BAO 6115 6079763 ?>445@68205BAO0:B82=>5A:0=8@>20=85 15 6085878 ?>445@68205BAO0C48>70?8AL 26 6085893 ?>445@68205BAO1;>:8@>2:070?8A8=0<5B:C0A8=E 10 6085919 ?>445@68205BAO2845>70?8AL 15 6085929 ?>445@68205BAO2=5H=894>ABC? 10 6085944 ?>445@68205BAO2>7<>6=>ABL?>45;8BLAO40==K<8 10 6085954 ?>445@68205BAO2>A?@>872545=85B5:AB0 10 6085964 ?>445@68205BAO459AB285:=>?:8?0=5;8:=>?>:A>>1I5=8O 14 6085974 ?>445@68205BAO48=0<8G5A:0OCAB0=>2:02=5H=8E:><?>=5=B 11 6085988 ?>445@68205BAO4>102;5=85:0;5=40@59 15 6085999 ?>445@68205BAO4>102;5=85:>=B0:B>2 15 6086014 ?>445@68205BAO6C@=0;sms 18 6086029 ?>445@68205BAO6C@=0;72>=:>2 18 6086047 ?>445@68205BAO70?8AL=0<5B:C 22 6086065 ?>445@68205BAO70?8AL=0<5B:C0A8=E 19 6086087 ?>445@68205BAO70?CA: 23 6086106 ?>445@68205BAO70I8B04>ABC?0 10 6086129 ?>445@68205BAO87<5=5=85:0;5=40@O 20 6086139 ?>445@68205BAO87<5=5=85:>=B0:B0 20 6086159 ?>445@68205BAO87<5=5=85A>1KB89 25 6086179 ?>445@68205BAO8A?>;L7>20=852=5H=53>@0A?>;>65=8O 10 6086204 ?>445@68205BAO8AB>@8O?@8>1@5B5=89 14 6086214 ?>445@68205BAO=01>@=><5@0 17 6086228 ?>445@68205BAO>1@01>B:072>=:>2 18 6086245 ?>445@68205BAO>B>1@065=85:0@BK 17 6086263 ?>445@68205BAO>B?@02:0 15 6086280 ?>445@68205BAO>B?@02:0mms 18 6086295 ?>445@68205BAO>B?@02:0sms 18 6086313 ?>445@68205BAO?>4B25@645=85?>:C?>: 15 6086331 ?>445@68205BAO?>B>:>2>5@0A?>7=020=85 10 6086346 ?>445@68205BAO?@85<sms 18 6086356 ?>445@68205BAO?@>25@:0 10 6086374 ?>445@68205BAO@01>B0A2;>65=8O<8 10 6086384 ?>445@68205BAO@0AE>4>20=85?>:C?>: 15 6086394 ?>445@68205BAOA:0=8@>20=854>:C<5=B>2 20 6086409 ?>445@68205BAOA:0=8@>20=85HB@8E:>4>2 16 6086429 ?>445@68205BAOB>;L:>3;02=K<<5=5465@>< 11 6086445 ?>445@68205BAOD>=0@8: 18 6086456 ?>445@68205BAOD>=>2>5A:0=8@>20=85 10 6086474 ?>445@68205BAOD>@<0B40==KE 11 6086484 ?>445@68205BAOD>B>A=8<>: 21 6086495 ?>445@68205BAODC=:F8>=0;L=>ABL<>18;L=>3>?@8;>65=8O 11 6086516 ?>445@6820BL 1222 6086527 ?>445@6820BLA>>B25BAB285>1J5:B0<@0AH8@O5<>9:>=D83C@0F88?>2=CB@5==8<845=B8D8:0B>@0< 10 6087749 ?>445@6820BLAO 6375 6087759 ?>445@6820NB 65 6094134 ?>445@6820NBAO 263 6094199 ?>445@6820NBAO2845>:>=D5@5=F88 14 6094462 ?>445@6820NBAO3;>10;L=K5:;NG8:0;5=40@59 10 6094476 ?>445@6820NBAO3;>10;L=K5:;NG8:>=B0:B>2 10 6094486 ?>445@6820NBAO3;>10;L=K5:;NG8A>1KB89 10 6094496 ?>445@6820NBAO?>:C?:8 32 6094506 ?>445@6820NI53> 37 6094538 ?>445@6820NI89 104 6094575 ?>445@6820NI8E 67 6094679 ?>445@6:0 250 6094746 ?>445@6:0<0AHB010 62 6094996 ?>445@6:0<0AHB01045=4@>3@0<<K 24 6095058 ?>445@6:0<0AHB0104803@0<<K30=B0 29 6095082 ?>445@6:0<0AHB010A2>4=>94803@0<<K 29 6095111 ?>445@6:8 91 6095140 ?>445@6:>9 141 6095231 ?>45;5==K9 16 6095372 ?>45;5=> 16 6095388 ?>45;8BLAO 59 6095404 ?>45;8BLAO2;>65=85< 9 6095463 ?>45;8BLAO2>1AC645=88 9 6095472 ?>45;8BLAO40==K<8 10 6095481 ?>45;8BLAOA>>1I5=85< 9 6095491 ?>45@68205BAO 4 6095500 ?>45@6820NI53> 4 6095504 ?>4:0B0;>3 54 6095508 ?>4:0B0;>30< 10 6095562 ?>4:0B0;>38 25 6095572 ?>4:;1 4 6095597 ?>4:;0AA 4 6095601 ?>4:;NG0 11 6095605 ?>4:;NG05<>3> 43 6095616 ?>4:;NG05<>9 67 6095659 ?>4:;NG05<K9 96 6095726 ?>4:;NG05B 87 6095822 ?>4:;NG05BAO 10 6095909 ?>4:;NG0BL 87 6095919 ?>4:;NG0BL02B><0B8G5A:8 22 6096006 ?>4:;NG0BLAO 23 6096028 ?>4:;NG0NBAO 4 6096051 ?>4:;NG5= 51 6096055 ?>4:;NG5=0 53 6096106 ?>4:;NG5=85 664 6096159 ?>4:;NG5=85< 4 6096823 ?>4:;NG5=88 146 6096827 ?>4:;NG5=8O 435 6096973 ?>4:;NG5==>3> 16 6097408 ?>4:;NG5==>9 19 6097424 ?>4:;NG5==>< 8 6097443 ?>4:;NG5==>ABL 4 6097451 ?>4:;NG5==CN 30 6097455 ?>4:;NG5==K9 429 6097485 ?>4:;NG5==K< 5 6097914 ?>4:;NG5==KE 9 6097919 ?>4:;NG5=> 220 6097928 ?>4:;NG82 12 6098148 ?>4:;NG8;AO 48 6098160 ?>4:;NG8BL 590 6098208 ?>4:;NG8BL2=5H=NN:><?>=5=BC 83 6098798 ?>4:;NG8BL2=5H=NN:><?>=5=BC0A8=E 28 6098881 ?>4:;NG8BL>1@01>BG8: 10 6098909 ?>4:;NG8BL>1@01>BG8:smsA>>1I5=89 17 6098919 ?>4:;NG8BL>1@01>BG8:459AB28OA>>1I5=8O 19 6098936 ?>4:;NG8BL>1@01>BG8:70?@>A0=0AB@>5::;85=B0;8F5=78@>20=8O 16 6098955 ?>4:;NG8BL>1@01>BG8:70?@>A0=0AB@>9:8:;85=B0;8F5=78@>20=8O 5 6098971 ?>4:;NG8BL>1@01>BG8:72>=:>2 17 6098976 ?>4:;NG8BL>1@01>BG8:87<5=5=8O40==KE 19 6098993 ?>4:;NG8BL>1@01>BG8:87<5=5=8O4>ABC?=>AB8?@>20945@>2 10 6099012 ?>4:;NG8BL>1@01>BG8:87<5=5=8O8=B5@=5BA>548=5=8O 10 6099022 ?>4:;NG8BL>1@01>BG8:87<5=5=8O<5AB>?>;>65=8O 10 6099032 ?>4:;NG8BL>1@01>BG8:87<5=5=8OA>AB>O=8O 29 6099042 ?>4:;NG8BL>1@01>BG8:=>2KEA>>1I5=890A8=E 16 6099071 ?>4:;NG8BL>1@01>BG8:>6840=8O 61 6099087 ?>4:;NG8BL>1@01>BG8:>:>=G0=8OCAB0=>2:8 14 6099148 ?>4:;NG8BL>1@01>BG8:>?>25I5=8O 25 6099162 ?>4:;NG8BL>1@01>BG8:?5@5A5G5=8O3@0=8F>BA;568205<KE35>7>= 10 6099187 ?>4:;NG8BL>1@01>BG8:?>A;5>B?@02:8A>>1I5=8O 14 6099197 ?>4:;NG8BL>1@01>BG8:A>>1I5=89 18 6099211 ?>4:;NG8BL>1@01>BG8:C254><;5=89 10 6099229 ?>4:;NG8BL>1@01>BG8:D>@<8@>20=8O:><0=4 23 6099239 ?>4:;NG8BL@0AH8@5=85?>;CG5=8O8=D>@<0F88>:><?LNB5@50A8=E 11 6099262 ?>4:;NG8BL@0AH8@5=85@01>BKA:@8?B>3@0D859 22 6099273 ?>4:;NG8BL@0AH8@5=85@01>BKA:@8?B>3@0D8590A8=E 22 6099295 ?>4:;NG8BL@0AH8@5=85@01>BKAD09;0<8 21 6099317 ?>4:;NG8BL@0AH8@5=85@01>BKAD09;0<80A8=E 22 6099338 ?>4:;NG8BLAO 141 6099360 ?>4;560B 8 6099501 ?>4;560BL 12 6099509 ?>4;560I55 4 6099521 ?>4;560I59 5 6099525 ?>4;560I89 9 6099530 ?>4;560I8E 4 6099539 ?>4;568B 4 6099543 ?>4;8=5 9 6099547 ?>4;8==0O 4 6099556 ?>4;8==>AB8 4 6099560 ?>4;8==>ABL 8 6099564 ?>4;8==K9 4 6099572 ?>4;8=L 9 6099576 ?>4<0B@8F 4 6099585 ?>4<0B@8F0 4 6099589 ?>4<5=8BL 221 6099593 ?>4<5=N 221 6099814 ?>4<5=OBLAO 4 6100035 ?>4<=>65AB20 18 6100039 ?>4<=>65AB2> 84 6100057 ?>4<=>65AB2>< 19 6100141 ?>4=O< 6 6100160 ?>4>185 11 6100166 ?>4>1;0AB59 5 6100177 ?>4>1;0AB8 6 6100182 ?>4>1;0ABL 19 6100188 ?>4>1;0ABLN 5 6100207 ?>4>1;0ABOE 6 6100212 ?>4>1=0 5 6100218 ?>4>1=> 74 6100223 ?>4>1=>3> 9 6100297 ?>4>1=>5 9 6100306 ?>4>1=>9 9 6100315 ?>4>1=K9 97 6100324 ?>4>1@0==K9 5 6100421 ?>4>1@0==KE 5 6100426 ?>4>1@0BL 28 6100431 ?>4>1@0BL20@80=B 27 6100459 ?>4>3=0BL 5 6100486 ?>4>7@8B5;L=K9 5 6100491 ?>4>7@8B5;L=K< 5 6100496 ?>4>AB>25@=>AB8 9 6100501 ?>4?8A0=85 37 6100510 ?>4?8A0=88 24 6100547 ?>4?8A0=8O 13 6100571 ?>4?8A0==K5 31 6100584 ?>4?8A0==K540==K5 10 6100615 ?>4?8A0==K9 33 6100625 ?>4?8A0==KE 9 6100658 ?>4?8A0BL 45 6100667 ?>4?8A0BL0A8=E 34 6100712 ?>4?8A0BLAO=0?>GB>2K9OI8: 10 6100746 ?>4?8A59 275 6100756 ?>4?8A8 924 6101031 ?>4?8A8H:0;K7=0G5=8987<5@8B5;L=>94803@0<<K24>;LH:0;K 10 6101955 ?>4?8A:0 163 6101965 ?>4?8A:0=0A>1KB85 261 6102128 ?>4?8A:0E 6 6102389 ?>4?8A:5 95 6102395 ?>4?8A:8 28 6102490 ?>4?8A:8=0A>1KB8O 10 6102518 ?>4?8A:C 8 6102528 ?>4?8A>: 12 6102536 ?>4?8AG8: 31 6102548 ?>4?8AG8:0 23 6102579 ?>4?8AG8:>2 4 6102602 ?>4?8AG8:>< 4 6102606 ?>4?8AK20=85 17 6102610 ?>4?8AK20=8O 17 6102627 ?>4?8AL 1443 6102644 ?>4?8ALcadesa 5 6104087 ?>4?8ALcadesbes 5 6104092 ?>4?8AL:@8?B>3@0D88 84 6104097 ?>4?8AL<>18;L=>3>:;85=B0 10 6104181 ?>4?8ALN 27 6104191 ?>4?8AOE 60 6104218 ?>4@0745;5=85 14 6104278 ?>4@0745;5=8O 4 6104292 ?>4@0745;5=8O< 5 6104296 ?>4@0745;8BL 6 6104301 ?>4@07C<5205B 8 6104307 ?>4@07C<5205BAO 13 6104315 ?>4@07C<520BL 8 6104328 ?>4@07C<520BLAO 13 6104336 ?>4@>1=0O 4 6104349 ?>4@>1=0O8=D>@<0F8O 10 6104353 ?>4@>1=0O=0AB@>9:0 11 6104363 ?>4@>1=55 105 6104374 ?>4@>1=> 15 6104479 ?>4@>1=>5 12 6104494 ?>4@>1=>5>B>1@065=858<5=>20==KEM;5<5=B>2=0AB@>9:8 40 6104506 ?>4@>1=>5?@54AB02;5=85 11 6104546 ?>4@>1=>5?@54AB02;5=85>H81:8 47 6104557 ?>4@>1=>9 5 6104604 ?>4@>1=>AB8 14 6104609 ?>4@>1=>ABL 14 6104623 ?>4@>1=CN 4 6104637 ?>4@>1=K9 162 6104641 ?>4@>1=K< 4 6104803 ?>4@>1=KE 5 6104807 ?>4@O4 33 6104812 ?>4A25B8BL 11 6104845 ?>4A25B:0 13 6104856 ?>4A25B:8 9 6104869 ?>4A25G5==>3> 10 6104878 ?>4A25G5==>9 5 6104888 ?>4A25G5==K9 31 6104893 ?>4A25G5=K 9 6104924 ?>4A25G820BLAO 12 6104933 ?>4A25G820NBAO 12 6104945 ?>4A8AB5< 8 6104957 ?>4A8AB5<0 346 6104965 ?>4A8AB5<0< 8 6105311 ?>4A8AB5<5 4 6105319 ?>4A8AB5<C 4 6105323 ?>4A8AB5<K 45 6105327 ?>4A:07:0 1104 6105372 ?>4A:07:002B>70?>;=5=8O 9 6106476 ?>4A:07:002B>70?>;=5=8O?>;O22>40 104 6106485 ?>4A:07:022>40 9 6106589 ?>4A:07:02H0?:5 11 6106598 ?>4A:07:0E 8 6106609 ?>4A:07:5 8 6106617 ?>4A:07:8 530 6106625 ?>4A:07:C 40 6107155 ?>4A:07>: 9 6107195 ?>4A>548=5= 16 6107204 ?>4A>548=5=85 6 6107220 ?>4A>548=5==>3> 5 6107226 ?>4A>548=5==K9 21 6107231 ?>4A>548=8;>AL 5 6107252 ?>4A>548=8BLAO 5 6107257 ?>4AB028B 5 6107262 ?>4AB028BL 11 6107267 ?>4AB02;5= 4 6107278 ?>4AB02;5==K9 16 6107282 ?>4AB02;5==K<8 6 6107298 ?>4AB02;5=> 6 6107304 ?>4AB02;5=K 5 6107310 ?>4AB02;O5B 6 6107315 ?>4AB02;O5BAO 16 6107321 ?>4AB02;OBL 6 6107337 ?>4AB02;OBLAO 20 6107343 ?>4AB0=>2:0 346 6107363 ?>4AB0=>2:8 257 6107709 ?>4AB0=>2:>9 22 6107966 ?>4AB0=>2:C 10 6107988 ?>4AB0=>2>: 43 6107998 ?>4AB@>:0 183 6108041 ?>4AB@>:070<5=K 20 6108224 ?>4AB@>:0?>8A:0 46 6108244 ?>4AB@>:8 103 6108290 ?>4AB@>:>9 12 6108393 ?>4AB@>:C 48 6108405 ?>4AG5B 30 6108453 ?>4AG5B0 14 6108483 ?>4AG5B5 22 6108497 ?>4AG8B0= 5 6108519 ?>4AG8B0==K9 5 6108524 ?>4AG8B0BL 32 6108529 ?>4AG8BK205B 5 6108561 ?>4AG8BK205BAO 50 6108566 ?>4AG8BK20BL 5 6108616 ?>4AG8BK20BLAO 110 6108621 ?>4AG8BK20NBAO 60 6108731 ?>4B25@48; 45 6108791 ?>4B25@48BL 56 6108836 ?>4B25@48BL?>:C?:C 15 6108892 ?>4B25@6405B 4 6108907 ?>4B25@6405BAO 4 6108911 ?>4B25@640BL 4 6108915 ?>4B25@640BLAO 4 6108919 ?>4B25@645=0 23 6108923 ?>4B25@645=85 68 6108946 ?>4B25@645=85< 6 6109014 ?>4B25@645=88 6 6109020 ?>4B25@645=8O 45 6109026 ?>4B25@645==K9 59 6109071 ?>4B25@645=> 36 6109130 ?>4B8? 5 6109166 ?>4BO38205BAO 5 6109171 ?>4BO3820BLAO 5 6109176 ?>4E>4 66 6109181 ?>4E>48B 97 6109247 ?>4E>48BL 120 6109344 ?>4E>4OB 5 6109464 ?>4E>4OI0O 7 6109469 ?>4E>4OI53> 37 6109476 ?>4E>4OI55 42 6109513 ?>4E>4OI59 5 6109555 ?>4E>4OI85 4 6109560 ?>4E>4OI89 176 6109564 ?>4E>4OI8E 63 6109740 ?>4G5@:820=85 90 6109803 ?>4G5@:820=85< 10 6109893 ?>4G5@:820=89 4 6109903 ?>4G5@:820=8O 33 6109907 ?>4G5@:820=L5 4 6109940 ?>4G5@:=CB>3> 8 6109944 ?>4G5@:=CBK9 12 6109952 ?>4G5@:=CBL 10 6109964 ?>4G8=5= 302 6109974 ?>4G8=5=0 4 6110276 ?>4G8=5=85 80 6110280 ?>4G8=5=85@538AB@0B>@C 13 6110360 ?>4G8=5=88 8 6110373 ?>4G8=5=8O 20 6110381 ?>4G8=5==0O 6 6110401 ?>4G8=5==>3> 125 6110407 ?>4G8=5==>9 49 6110532 ?>4G8=5==><C 25 6110581 ?>4G8=5==>ABL 48 6110606 ?>4G8=5==K5 100 6110654 ?>4G8=5==K5M;5<5=BK 42 6110754 ?>4G8=5==K9 808 6110796 ?>4G8=5==K< 20 6111604 ?>4G8=5==K<8 32 6111624 ?>4G8=5==KE 444 6111656 ?>4G8=5=K 16 6112100 ?>4G8=8BL 4 6112116 ?>4G8=OBLAO 8 6112120 ?>4G8=Q==0O 8 6112128 ?>4G8=Q==>3> 40 6112136 ?>4G8=Q==K5 18 6112176 ?>4G8=Q==K<8 8 6112194 ?>4G8=Q==KE 40 6112202 ?>548=8F0<87<5@5=8O 5 6112242 ?>60;>20BL 13 6112247 ?>7 8 6112260 ?>70 8 6112268 ?>72>;8B 44 6112276 ?>72>;8B8 4 6112320 ?>72>;8BL 48 6112324 ?>72>;O5B 1761 6112372 ?>72>;OBL 1853 6114133 ?>72>;ONB 59 6115986 ?>72>;ONI55 14 6116045 ?>72>;ONI85 5 6116059 ?>72>;ONI89 53 6116064 ?>72>;ONI8< 3 6116117 ?>72>;ONI8E 4 6116120 ?>72>;OO 15 6116124 ?>74=53> 26 6116139 ?>74=59 16 6116165 ?>74=85 30 6116181 ?>74=89 96 6116211 ?>74=8E 23 6116307 ?>74=OO 10 6116330 ?>74@02;5=85 4 6116340 ?>74@02;5=8O 4 6116344 ?>765 13 6116348 ?>78F88 696 6116361 ?>78F8870:070 19 6117057 ?>78F89 238 6117076 ?>78F8>=8@>20= 4 6117314 ?>78F8>=8@>20=0 4 6117318 ?>78F8>=8@>20=85 280 6117322 ?>78F8>=8@>20=88 17 6117602 ?>78F8>=8@>20=8O 127 6117619 ?>78F8>=8@>20==K9 6 6117746 ?>78F8>=8@>20BL 88 6117752 ?>78F8>=8@>20BLAO 47 6117840 ?>78F8>=8@C5B 88 6117887 ?>78F8>=8@C5BAO 47 6117975 ?>78F8>==> 32 6118022 ?>78F8>==K9 32 6118054 ?>78F8N 767 6118086 ?>78F8O 2088 6118853 ?>78F8O21CD5@5 120 6120941 ?>78F8O24>:C<5=B5dom 87 6121061 ?>78F8O2?>B>:5 66 6121148 ?>78F8O< 18 6121214 ?>78F8O=0G0;0 11 6121232 ?>78F8O@538AB@0B>@0 9 6121243 ?>78F8OE 11 6121252 ?>7=0G8<>AB8 9 6121263 ?>8<5=>20==K5 4 6121272 ?>8<5=>20==K9 4 6121276 ?>8=B0E 5 6121280 ?>8A: 4383 6121285 ?>8A:0 2376 6125668 ?>8A:2B01;8F5?@822>45 24 6128044 ?>8A:40==KE 12 6128068 ?>8A:5 695 6128080 ?>8A:>2>3> 13 6128775 ?>8A:>2>5 8 6128788 ?>8A:>2K5 8 6128796 ?>8A:>2K9 31 6128804 ?>8A:>2KE 10 6128835 ?>8A:>< 102 6128845 ?>8A:?>85@0@E88 8 6128947 ?>8A:?>?>;=><C:>4C 6 6128955 ?>8A:?@822>45 13 6128961 ?>8A?>;=8B5;N 14 6128974 ?>945B 10 6128988 ?>9B8 10 6128998 ?>:0 803 6129008 ?>:07 393 6129811 ?>:070 262 6130204 ?>:070= 148 6130466 ?>:070=0 28 6130614 ?>:070=89 28 6130642 ?>:070==K9 332 6130670 ?>:070=> 140 6131002 ?>:070=K 24 6131142 ?>:070B5;59 12 6131166 ?>:070B5;8 5 6131178 ?>:070B5;8>BG5B0 6 6131183 ?>:070B5;L 34 6131189 ?>:070B5;O 5 6131223 ?>:070B8 140 6131228 ?>:070BL 391 6131368 ?>:070BL22>440BK 25 6131759 ?>:070BL22>47=0G5=8O 19 6131784 ?>:070BL22>4>F5=:8?@8;>65=8O 11 6131803 ?>:070BL22>4AB@>:8 19 6131814 ?>:070BL22>4G8A;0 19 6131833 ?>:070BL2845>>1JO2;5=85A2>7=03@0645=85< 28 6131852 ?>:070BL2>?@>A 38 6131880 ?>:070BL2A?8A:5 12 6131918 ?>:070BL2K1>@459AB28O 35 6131930 ?>:070BL2K1>@87<5=N 24 6131965 ?>:070BL2K1>@87A?8A:0 24 6131989 ?>:070BL2K1>@CG0AB=8:>2 20 6132013 ?>:070BL2K1>@M;5<5=B0 24 6132033 ?>:070BL40==K5 12 6132057 ?>:070BL7=0G5=85 28 6132069 ?>:070BL8=D>@<0F8N>1>H81:5 47 6132097 ?>:070BL8=D>@<0F8N>?>;L7>20B5;5 9 6132144 ?>:070BL=0:0@B5 16 6132153 ?>:070BL>?>25I5=85?>;L7>20B5;O 36 6132169 ?>:070BL>B<5B:CM;5<5=B>2 18 6132205 ?>:070BL?0@>;L 12 6132223 ?>:070BL?>;=>M:@0==CN@5:;0<C 22 6132235 ?>:070BL?@54C?@5645=85 30 6132257 ?>:070BL@07;8G8O 10 6132287 ?>:070BL@07;8G8O<>40;L=> 10 6132297 ?>:070BLA:0=8@>20=854>:C<5=B>2 54 6132307 ?>:070BLA:0=8@>20=85HB@8E:>4>2 14 6132361 ?>:070BLA?8A>:A5@B8D8:0B>2 10 6132375 ?>:070BLC@>25=L3@C??8@>2>::>;>=>: 13 6132385 ?>:070BLC@>25=L3@C??8@>2>:AB@>: 15 6132398 ?>:070BLC@>25=LA5@89 10 6132413 ?>:070BLC@>25=LB>G5: 11 6132423 ?>:075 73 6132434 ?>:07>< 18 6132507 ?>:07K205<0O>1;0ABL 10 6132525 ?>:07K205<0O>1;0ABL35>3@0D8G5A:>9AE5<K 39 6132535 ?>:07K205<>5 4 6132574 ?>:07K205<>9 10 6132578 ?>:07K205<K9 14 6132588 ?>:07K205B 369 6132602 ?>:07K205BAO 129 6132971 ?>:07K20BL 573 6133100 ?>:07K20BL2A?8A:52K1>@0 69 6133673 ?>:07K20BLAO 196 6133742 ?>:07K20NBAO 58 6133938 ?>:07K20NI0O 4 6133996 ?>:07K20NI85 10 6134000 ?>:07K20NI89 23 6134010 ?>:07K20NI8E 4 6134033 ?>:07K20O 28 6134037 ?>:840BL 4 6134065 ?>:8=CB8 17 6134069 ?>:8=CBL 17 6134086 ?>:;NGC4;O?>;L7>20B5;O 13 6134103 ?>:>8BL 17 6134116 ?>:>9 17 6134133 ?>:>;8G5AB2CA;CG052 18 6134150 ?>:>;>=:0< 9 6134168 ?>:>O 17 6134177 ?>:@K20BL 29 6134194 ?>:@K20NB 4 6134223 ?>:@KBK5 10 6134227 ?>:@KBK9 10 6134237 ?>:C?0B5;59 25 6134247 ?>:C?0B5;8 35 6134272 ?>:C?0B5;L 216 6134307 ?>:C?0B5;N 4 6134523 ?>:C?:0 278 6134527 ?>:C?:0< 4 6134805 ?>:C?:0<8 9 6134809 ?>:C?:0E 12 6134818 ?>:C?:5 17 6134830 ?>:C?:8 127 6134847 ?>:C?:C 24 6134974 ?>:C?>: 108 6134998 ?>; 5287 6135106 ?>;0 5287 6140393 ?>;5 19146 6145680 ?>;51 46 6164826 ?>;5html4>:C<5=B0 130 6164872 ?>;5html4>:C<5=B01 6 6165002 ?>;5pdf4>:C<5=B0 19 6165008 ?>;5xbase 47 6165027 ?>;50=0;87040==KE 38 6165074 ?>;522>40 500 6165112 ?>;522>401 16 6165612 ?>;522>4020@80=B 10 6165628 ?>;522>402K1@0BL 17 6165638 ?>;522>402K1@0BLB8? 17 6165655 ?>;522>4040BK 6 6165672 ?>;522>40:0;5=40@L 17 6165678 ?>;522>40:0;L:C;OB>@ 17 6165695 ?>;522>40:>=B@035=B0 5 6165712 ?>;522>40>B:@KBL 17 6165717 ?>;522>40>G8AB8BL 17 6165734 ?>;525@A8840==KE 9 6165751 ?>;52840 30 6165760 ?>;52K1>@0 205 6165790 ?>;52K1>@0:><?>=>2:840==KEAE5<K70?@>A0 49 6165995 ?>;535>3@0D8G5A:>9AE5<K 80 6166044 ?>;53@0D8G5A:>9AE5<K 118 6166124 ?>;53@0D8G5A:>9AE5<K1 10 6166242 ?>;53@C??8@>2:8 5 6166252 ?>;53@C??8@>2:8:><?>=>2:840==KE 103 6166257 ?>;545=4@>3@0<<K 13 6166360 ?>;54803@0<<K 13 6166373 ?>;54803@0<<K30=B0 17 6166386 ?>;54>ABC?=> 22 6166403 ?>;575= 30 6166425 ?>;57=0G5=8O 30 6166455 ?>;57=0O 9 6166485 ?>;57=0O=03@C7:0 17 6166494 ?>;57=> 15 6166511 ?>;57=>5 4 6166526 ?>;57=>9 11 6166530 ?>;57=CN 13 6166541 ?>;57=K9 83 6166554 ?>;57=K< 4 6166637 ?>;587>1@065=8O 5 6166641 ?>;58<5=8 21 6166646 ?>;58=45:A0 20 6166667 ?>;58=48:0B>@0 13 6166687 ?>;58A?>;L7>20=8O<=>65AB25==KE7=0G5=89 9 6166700 ?>;58A?>;L7>20=8OE@0=5=8O2E@0=8;8I542>8G=KE40==KE 26 6166709 ?>;58AB>G=8:0 7 6166735 ?>;58B>30AE5<K:><?>=>2:840==KE 57 6166742 ?>;59 3343 6166799 ?>;59n 6 6170142 ?>;5:0;5=40@O 222 6170148 ?>;5:0@B8=:8 176 6170370 ?>;5:;NG0 30 6170546 ?>;5:;NG0<=>65AB25==KE7=0G5=89 9 6170576 ?>;5:><?>=>2:840==KE 137 6170585 ?>;5< 261 6170722 ?>;5=01>@040==KE<0:5B0:><?>=>2:840==KE 58 6170983 ?>;5=01>@040==KEAE5<K:><?>=>2:840==KE 146 6171041 ?>;5=04?8A8 17 6171187 ?>;5=0AB@>9:8 126 6171204 ?>;5>1;0AB8:><?>=>2:840==KE 51 6171330 ?>;5>1J5:B0 30 6171381 ?>;5>B1>@0 5 6171411 ?>;5>B1>@0284>2 9 6171416 ?>;5?5@5:;NG0B5;O 21 6171425 ?>;5?5@8>40 13 6171446 ?>;5?;0=8@>2I8:0 13 6171459 ?>;5?>;>AK@53C;8@>20=8O 17 6171472 ?>;5?>@O4:0<=>65AB25==KE7=0G5=89 9 6171489 ?>;5?>AB@>8B5;O70?@>A0 52 6171498 ?>;5?>AB@>8B5;O>BG5B0 52 6171550 ?>;5?@54AB02;5=8O 18 6171602 ?>;5?@>AB@0=AB201;>:8@>2>: 12 6171620 ?>;5?CB8:40==K< 9 6171632 ?>;5@538AB@0 23 6171641 ?>;5@>48B5;O 9 6171664 ?>;5A25@EC 38 6171673 ?>;5A2>4=>94803@0<<K 88 6171711 ?>;5A2>4=>9B01;8FK 111 6171799 ?>;5A;520 38 6171910 ?>;5A=87C 38 6171948 ?>;5A?8A:0 102 6171986 ?>;5A?8A:01 5 6172088 ?>;5A?@020 38 6172093 ?>;5AE5<K1 16 6172131 ?>;5AG5B0 10 6172147 ?>;5B 4 6172157 ?>;5B0 4 6172161 ?>;5B01;8G=>3>4>:C<5=B0 183 6172165 ?>;5B4 15 6172348 ?>;5B4>: 5 6172363 ?>;5B5:AB0 5 6172368 ?>;5B5:AB>2>3>4>:C<5=B0 81 6172373 ?>;5B8?07=0G5=8O 21 6172454 ?>;5D;06:0 21 6172475 ?>;5D>@<0B8@>20==>3>4>:C<5=B0 17 6172496 ?>;5D>@<K 370 6172513 ?>;5M;5<5=B01;>:8@>2:840==KE 34 6172883 ?>;5M;5<5=B0A>AB020:>?88107K40==KE 41 6172917 ?>;7C=>: 4 6172958 ?>;83>= 22 6172962 ?>;83>=0 4 6172984 ?>;83>=0;L=>3> 12 6172988 ?>;83>=0;L=K9 12 6173000 ?>;83>=0;L=K9>1J5:B35>3@0D8G5A:>9AE5<K 133 6173012 ?>;83>=0<8 4 6173145 ?>;83>=>< 4 6173149 ?>;8;8=59=>3> 8 6173153 ?>;8;8=59=K5 4 6173161 ?>;8;8=59=K9 12 6173165 ?>;8;8=59=K9>1J5:B35>3@0D8G5A:>9AE5<K 132 6173177 ?>;8;8=88 4 6173309 ?>;8;8=8O 4 6173313 ?>;8=>< 4 6173317 ?>;8=><0 4 6173321 ?>;8=><80;L=0O 4 6173325 ?>;8=><80;L=>9 4 6173329 ?>;8=><80;L=K9 14 6173333 ?>;8B8: 166 6173347 ?>;8B8:0 166 6173513 ?>;8B8:0<8 4 6173679 ?>;8B8:0?0@>;59?>;L7>20B5;59 82 6173683 ?>;8B8:5 20 6173765 ?>;8B8:8 90 6173785 ?>;8B8:8?0@>;59?>;L7>20B5;59 9 6173875 ?>;8B8:C 8 6173884 ?>;8BL 3343 6173892 ?>;=0O 13 6177235 ?>;=0OH8@8=0 9 6177248 ?>;=>3> 146 6177257 ?>;=>5 1018 6177403 ?>;=>52=5H=55 9 6178421 ?>;=>58<O 1099 6178430 ?>;=>58<O0B@81CB0 30 6179529 ?>;=>58<O?>;L7>20B5;O 41 6179559 ?>;=>58<OD09;0 40 6179600 ?>;=>5:>;8G5AB2> 10 6179640 ?>;=>5=08<5=>20=85 72 6179650 ?>;=>9 253 6179722 ?>;=>< 13 6179975 ?>;=><C 148 6179988 ?>;=>ABLN 558 6180136 ?>;=>B5:AB>2>3> 320 6180694 ?>;=>B5:AB>2>< 72 6181014 ?>;=>B5:AB>2K9 462 6181086 ?>;=>B5:AB>2K9?>8A: 299 6181548 ?>;=>B5:AB>2K9?>8A:?@822>45?>AB@>:5 219 6181847 ?>;=>B5:AB>2K< 4 6182066 ?>;=>F25B=0O 4 6182070 ?>;=>F25B=K9 4 6182074 ?>;=>F5==>5 5 6182078 ?>;=>F5==K9 5 6182083 ?>;=>G=> 5 6182088 ?>;=>G=>A8=89 12 6182093 ?>;=>GL 5 6182105 ?>;=>M:@0==0O 4 6182110 ?>;=>M:@0==>3> 18 6182114 ?>;=>M:@0==>5 6 6182132 ?>;=>M:@0==>5@01>G55<5AB> 22 6182138 ?>;=>M:@0==>9 8 6182160 ?>;=>M:@0==>< 14 6182168 ?>;=>M:@0==CN 4 6182182 ?>;=>M:@0==K9 52 6182186 ?>;=CN 32 6182238 ?>;=K5 33 6182270 ?>;=K9 1910 6182303 ?>;=K920@80=B 5 6184213 ?>;=K94>ABC?:com>1J5:B0< 47 6184218 ?>;=K94>ABC?:2=5H=8<:><?>=5=B0< 47 6184265 ?>;=K94>ABC?:2=5H=8<<>4C;O< 47 6184312 ?>;=K94>ABC?:2=5H=8<?@8;>65=8O< 47 6184359 ?>;=K94>ABC?:8=B5@=5B@5AC@A0< 47 6184406 ?>;=K94>ABC?:D09;>2>9A8AB5<5 47 6184453 ?>;=K9:>4 26 6184500 ?>;=K9?@828;538@>20==K9@568< 52 6184526 ?>;=K9B5:AB 36 6184578 ?>;=K< 79 6184614 ?>;=K<8 14 6184693 ?>;=KE 111 6184707 ?>;>28=0 32 6184818 ?>;>28=0H8@8=K 9 6184850 ?>;>28==K9 10 6184859 ?>;>28=C 16 6184869 ?>;>28=K 12 6184885 ?>;>65=85 788 6184897 ?>;>65=852:><0=4=>9?0=5;8 13 6185685 ?>;>65=853@0=8FK8=D>@<0F8>==>3>8=B5@20;04803@0<<K 24 6185698 ?>;>65=85459AB28OM;5<5=B0?;0=8@>2I8:0 19 6185722 ?>;>65=85703>;>2:0 85 6185741 ?>;>65=85703>;>2:0M;5<5=B0D>@<K 43 6185826 ?>;>65=858=D>@<0F8>==>9;8=884803@0<<K 24 6185869 ?>;>65=858B>3>2:>;>=>: 15 6185893 ?>;>65=858B>3>2:>;>=>:A2>4=>9B01;8FK 20 6185908 ?>;>65=858B>3>2AB@>: 15 6185928 ?>;>65=858B>3>2AB@>:A2>4=>9B01;8FK 20 6185943 ?>;>65=85:0@B8=:8 132 6185963 ?>;>65=85:0@B8=:8:=>?:8 20 6186095 ?>;>65=85:0@B8=:8:=>?:8D>@<K 24 6186115 ?>;>65=85:0@B8=:8=04?8A8 43 6186139 ?>;>65=85:0@B8=:8?0=5;8 43 6186182 ?>;>65=85:0@B8=:8M;5<5=B03@0D8G5A:>9AE5<K 70 6186225 ?>;>65=85:=>?:82:><0=4=>9?0=5;8 29 6186295 ?>;>65=85:>;>=:8 25 6186324 ?>;>65=85:><0=4=>9?0=5;8 31 6186349 ?>;>65=85:><0=4=>9?0=5;8D>@<K 29 6186380 ?>;>65=85:><0=4=>9?0=5;8M;5<5=B0D>@<K 29 6186409 ?>;>65=85< 8 6186438 ?>;>65=85>:=0 15 6186446 ?>;>65=85>?>@=>9B>G:8 23 6186461 ?>;>65=85>?>@=>9B>G:8>B@8A>2:8 58 6186484 ?>;>65=85>B<5B>:H:0;K 9 6186542 ?>;>65=85>B<5B>:H:0;K4803@0<<K 34 6186551 ?>;>65=85>B=>A8B5;L=>35>7>=K 19 6186585 ?>;>65=85?0=5;885@0@E88 9 6186604 ?>;>65=85?>4?8A59 24 6186613 ?>;>65=85?>4?8A59:4803@0<<5 76 6186637 ?>;>65=85?>4?8A59H:0;K 9 6186713 ?>;>65=85?>4?8A59H:0;K4803@0<<K 29 6186722 ?>;>65=85?>4?8A59H:0;K7=0G5=8987<5@8B5;L=>94803@0<<K 27 6186751 ?>;>65=85?@8:@5?;5==>3>>:=0 15 6186778 ?>;>65=85A>AB>O=8O?@>A<>B@0 48 6186793 ?>;>65=85AB@>:8?>8A:0 49 6186841 ?>;>65=85B01;8FK 21 6186890 ?>;>65=85B01;8FK4803@0<<K30=B0 29 6186911 ?>;>65=85B5:AB0 23 6186940 ?>;>65=85B5:AB0>B=>A8B5;L=>:0@B8=:8 70 6186963 ?>;>65=85B5:AB0A>548=8B5;L=>9;8=88 23 6187033 ?>;>65=85C?@02;5=8O?>8A:>< 34 6187056 ?>;>65=85H:0;K 9 6187090 ?>;>65=85H:0;K2@5<5=8 30 6187099 ?>;>65=85H:0;K4803@0<<K 24 6187129 ?>;>65=88 8 6187153 ?>;>65=89 13 6187161 ?>;>65=8N 19 6187174 ?>;>65=8O 135 6187193 ?>;>65==>3> 46 6187328 ?>;>65==K9 46 6187374 ?>;>65=L5 13 6187420 ?>;>68B5;L=>3> 44 6187433 ?>;>68B5;L=>5 281 6187477 ?>;>68B5;L=>9 8 6187758 ?>;>68B5;L=K5 25 6187766 ?>;>68B5;L=K9 382 6187791 ?>;>68B8 13 6188173 ?>;>A 98 6188186 ?>;>A0 420 6188284 ?>;>A087<5@8B5;L=>94803@0<<K 58 6188704 ?>;>A0?@>:@CB:8 11 6188762 ?>;>A0@53C;8@>20=8O 119 6188773 ?>;>A5 5 6188892 ?>;>A>9 4 6188897 ?>;>AC 25 6188901 ?>;>AK 269 6188926 ?>;>AK87<5@8B5;L=>94803@0<<K 62 6189195 ?>;>B8 5596 6189257 ?>;>BL 12771 6194853 ?>;C3>485 222 6207624 ?>;C3>485>B=0G0;0?5@8>40 9 6207846 ?>;C3>485>B=0G0;0?5@8>40445 9 6207855 ?>;C3>488 4 6207864 ?>;C3>48N 5 6207868 ?>;C3>48O 83 6207873 ?>;C3>48O< 35 6207956 ?>;C68@=K9 27 6207991 ?>;C68@=K< 4 6208018 ?>;C=>G8 5 6208022 ?>;C?@>7@0G=>AB8 12 6208027 ?>;C?@>7@0G=>ABL 21 6208039 ?>;C?@>7@0G=>ABLN 8 6208060 ?>;C@0A:@KB>9 4 6208068 ?>;C@0A:@KBK9 4 6208072 ?>;CB>@=K9 10 6208076 ?>;CG05<0O 58 6208086 ?>;CG05<0O:>=D83C@0F8O 9 6208144 ?>;CG05<>3> 67 6208153 ?>;CG05<>9 18 6208220 ?>;CG05<>< 4 6208238 ?>;CG05<K5 23 6208242 ?>;CG05<K5D09;K 42 6208265 ?>;CG05<K9 256 6208307 ?>;CG05<K< 5 6208563 ?>;CG05<KE 57 6208568 ?>;CG05B 8762 6208625 ?>;CG05BAO 683 6217387 ?>;CG0B 10 6218070 ?>;CG0B5;59 156 6218080 ?>;CG0B5;5< 4 6218236 ?>;CG0B5;8 197 6218240 ?>;CG0B5;L 507 6218437 ?>;CG0B5;LA>>1I5=8O 25 6218944 ?>;CG0B5;N 12 6218969 ?>;CG0B5;O 72 6218981 ?>;CG0B5;O< 12 6219053 ?>;CG0B5;O<8 4 6219065 ?>;CG0BL 8971 6219069 ?>;CG0BL0@E822A5340 25 6228040 ?>;CG0BL0@E82?@8=5>1E>48<>AB8 9 6228065 ?>;CG0BL20@80=BK?@><56CB>G=KE38?>B57 9 6228074 ?>;CG0BL>?8A0=85 11 6228083 ?>;CG0BL?@54AB02;5=85 10 6228094 ?>;CG0BL?@><56CB>G=K5@57C;LB0BK 9 6228104 ?>;CG0BLAO 854 6228113 ?>;CG0NB 4 6228967 ?>;CG0NBAO 137 6228971 ?>;CG0NI53> 5 6229108 ?>;CG0NI89 10 6229113 ?>;CG0O 12 6229123 ?>;CG5= 567 6229135 ?>;CG5=0 657 6229702 ?>;CG5=0A5@25@>< 11 6230359 ?>;CG5=85 3197 6230370 ?>;CG5=85sms 9 6233567 ?>;CG5=85;8F5=789 15 6233576 ?>;CG5=85< 25 6233591 ?>;CG5=85?@54AB02;5=894;O=52848<KE?>;59 9 6233616 ?>;CG5=85M;5<5=B0 12 6233625 ?>;CG5=85M;5<5=B040==KE 30 6233637 ?>;CG5=88 1219 6233667 ?>;CG5=8O 1418 6234886 ?>;CG5==0O 171 6236304 ?>;CG5==0OF5=0 10 6236475 ?>;CG5==>3> 169 6236485 ?>;CG5==>5 132 6236654 ?>;CG5==>57=0G5=85 7 6236786 ?>;CG5==>9 139 6236793 ?>;CG5==>< 38 6236932 ?>;CG5==><C 30 6236970 ?>;CG5==CN 16 6237000 ?>;CG5==K5 117 6237016 ?>;CG5==K5D09;K 17 6237133 ?>;CG5==K9 2664 6237150 ?>;CG5==K9D09; 6 6239814 ?>;CG5==K< 31 6239820 ?>;CG5==K<8 12 6239851 ?>;CG5==KE 141 6239863 ?>;CG5=> 251 6240004 ?>;CG5=K 335 6240255 ?>;CG5B 4 6240590 ?>;CG82H53> 20 6240594 ?>;CG82H53>AO 11 6240614 ?>;CG82H89 30 6240625 ?>;CG82H89AO 11 6240655 ?>;CG8; 4 6240666 ?>;CG8;8 4 6240670 ?>;CG8;8AL 5 6240674 ?>;CG8;> 24 6240679 ?>;CG8;>AL 8 6240703 ?>;CG8;AO 6 6240711 ?>;CG8< 67 6240717 ?>;CG8B 11 6240784 ?>;CG8BAO 16 6240795 ?>;CG8BL 5417 6240811 ?>;CG8BLbase641CD5@42>8G=KE40==KE871CD5@042>8G=KE40==KE 16 6246228 ?>;CG8BLbase6442>8G=K540==K58742>8G=KE40==KE 16 6246244 ?>;CG8BLbase64AB@>:C871CD5@042>8G=KE40==KE 11 6246260 ?>;CG8BLbase64AB@>:C8742>8G=KE40==KE 11 6246271 ?>;CG8BLcom>1J5:B 62 6246282 ?>;CG8BLhex1CD5@42>8G=KE40==KE871CD5@042>8G=KE40==KE 16 6246344 ?>;CG8BLhex42>8G=K540==K58742>8G=KE40==KE 16 6246360 ?>;CG8BLhexAB@>:C871CD5@042>8G=KE40==KE 11 6246376 ?>;CG8BLhexAB@>:C8742>8G=KE40==KE 11 6246387 ?>;CG8BLhtml 12 6246398 ?>;CG8BLhtml4>:C<5=B0 20 6246410 ?>;CG8BLhtmlB5:AB 10 6246430 ?>;CG8BLurl 12 6246440 ?>;CG8BLws>?@545;5=8O 19 6246452 ?>;CG8BLxdto 25 6246471 ?>;CG8BLxmlB8? 41 6246496 ?>;CG8BL01A>;NB=K9 20 6246537 ?>;CG8BL03@530BK 17 6246557 ?>;CG8BL04<8=8AB@0B>@>2 17 6246574 ?>;CG8BL04<8=8AB@0B>@>2:;0AB5@0 12 6246591 ?>;CG8BL04@5A2K3@C7:840==KE 14 6246603 ?>;CG8BL04@5A2K3@C7:840==KE0A8=E 14 6246617 ?>;CG8BL04@5A>1=>2;5=8O 17 6246631 ?>;CG8BL04@5A?><5AB>?>;>65=8N 15 6246648 ?>;CG8BL04@5AA5@25@0A8AB5<K0=0;8B8:8 10 6246663 ?>;CG8BL04@5AB5:CI59>1;0AB8 10 6246673 ?>;CG8BL0:B82=>5>:=> 10 6246683 ?>;CG8BL0:B82=>ABL 15 6246693 ?>;CG8BL0=0;87 14 6246708 ?>;CG8BL0A8=E 18 6246722 ?>;CG8BL0B@81CB 305 6246740 ?>;CG8BL107C 41 6247045 ?>;CG8BL1;>:8@>2:8 27 6247086 ?>;CG8BL1;>:8@>2:CA50=A>2 15 6247113 ?>;CG8BL1>B0 14 6247128 ?>;CG8BL1>B>2 14 6247142 ?>;CG8BL1CD5@42>8G=KE40==KE 23 6247156 ?>;CG8BL1CD5@42>8G=KE40==KE0A8=E 14 6247179 ?>;CG8BL1CD5@42>8G=KE40==KE87base641CD5@042>8G=KE40==KE 16 6247193 ?>;CG8BL1CD5@42>8G=KE40==KE87base64AB@>:8 16 6247209 ?>;CG8BL1CD5@42>8G=KE40==KE87hex1CD5@042>8G=KE40==KE 16 6247225 ?>;CG8BL1CD5@42>8G=KE40==KE87hexAB@>:8 16 6247241 ?>;CG8BL1CD5@42>8G=KE40==KE8742>8G=KE40==KE 16 6247257 ?>;CG8BL1CD5@42>8G=KE40==KE87AB@>:8 16 6247273 ?>;CG8BL25@A8N 12 6247289 ?>;CG8BL25@A8N?>;=>B5:AB>2>3>?>8A:0 11 6247301 ?>;CG8BL25@A8NAB0=40@B=>9@5?;8:0F88 10 6247312 ?>;CG8BL2;>65=8O 18 6247322 ?>;CG8BL2;>65=8O0A8=E 18 6247340 ?>;CG8BL2=5H=NN=02830F8>==CNAAK;:C 11 6247358 ?>;CG8BL2@5<O7025@H5=8OA50=A0?@8157459AB288 11 6247369 ?>;CG8BL2@5<O7025@H5=8OA?OI53>A50=A0 11 6247380 ?>;CG8BL2@5<O70AK?0=8O?0AA82=>3>A50=A0 11 6247391 ?>;CG8BL2@5<O87<5=5=8O 43 6247402 ?>;CG8BL2@5<O87<5=5=8O0A8=E 20 6247445 ?>;CG8BL2@5<O>1=>2;5=8O40==KE 10 6247465 ?>;CG8BL2@5<O>6840=8O1;>:8@>2:840==KE 11 6247475 ?>;CG8BL2@5<O>:>=G0=8O4>ABC?=>AB8>B25B0 10 6247486 ?>;CG8BL2@5<O>:>=G0=8O4>ABC?=>AB8>B25B00A8=E 10 6247496 ?>;CG8BL2@5<O?@54C?@5645=8O>7025@H5=88A50=A0?@8157459AB288 11 6247506 ?>;CG8BL2A5 42 6247517 ?>;CG8BL2A50A8=E 18 6247559 ?>;CG8BL2E>4OI85B>G:8 12 6247577 ?>;CG8BL2K3@C7:840==KE0A8=E 18 6247589 ?>;CG8BL2K3@C7:C40==KE 28 6247607 ?>;CG8BL2K3@C7:C40==KE0A8=E 22 6247635 ?>;CG8BL2K45;5==K5<=>65AB25==K57=0G5=8O 11 6247657 ?>;CG8BL2K45;5==K5>1;0AB8 10 6247668 ?>;CG8BL2K45;5==K5AB@>:8 10 6247678 ?>;CG8BL2K45;5==K5M;5<5=BK 22 6247688 ?>;CG8BL2K45;5==K9B5:AB 13 6247710 ?>;CG8BL2K@065=8545B0;L=KE70?8A59 12 6247723 ?>;CG8BL2K@065=858B>3>2KE70?8A59 12 6247735 ?>;CG8BL3;C18=C3@0D0 10 6247747 ?>;CG8BL3@0=8FC 19 6247757 ?>;CG8BL3@0=8FK 14 6247776 ?>;CG8BL3@0=8FK2K45;5=8O 55 6247790 ?>;CG8BL3@C??K 10 6247845 ?>;CG8BL40==K5 34 6247855 ?>;CG8BL40==K50A8=E 31 6247889 ?>;CG8BL40==K525@A88 16 6247920 ?>;CG8BL40==K52K1>@0 229 6247936 ?>;CG8BL40==K53@0D8:0 41 6248165 ?>;CG8BL40==K570?CA:0 10 6248206 ?>;CG8BL40==K587?>4?8A8 16 6248216 ?>;CG8BL40==K587?>4?8A80A8=E 16 6248232 ?>;CG8BL40==K5:28B0=F892AB@>5==KE?>:C?>: 10 6248248 ?>;CG8BL40==K5@01>BKA@5GLN8=D>@<0F8>==>9107K 10 6248258 ?>;CG8BL40==K5@538AB@0F888=D>@<0F8>==>9107K 10 6248268 ?>;CG8BL40BC=0G0;0 13 6248278 ?>;CG8BL40BC>:>=G0=8O 18 6248291 ?>;CG8BL42>8G=K540==K5 82 6248309 ?>;CG8BL42>8G=K540==K50A8=E 14 6248391 ?>;CG8BL42>8G=K540==K587base6442>8G=KE40==KE 16 6248405 ?>;CG8BL42>8G=K540==K587base64AB@>:8 16 6248421 ?>;CG8BL42>8G=K540==K587hex42>8G=KE40==KE 16 6248437 ?>;CG8BL42>8G=K540==K587hexAB@>:8 16 6248453 ?>;CG8BL42>8G=K540==K5871CD5@042>8G=KE40==KE 16 6248469 ?>;CG8BL42>8G=K540==K587AB@>:8 16 6248485 ?>;CG8BL459AB285 115 6248501 ?>;CG8BL459AB285?@8=5A>>B25BAB288?0@>;59?>;L7>20B5;59B@51>20=8O<?@80CB5=B8D8:0F88 11 6248616 ?>;CG8BL4>:C<5=Bhtml 15 6248627 ?>;CG8BL4>?>;=5=85 20 6248642 ?>;CG8BL4>?>;=8B5;L=K53@0<<0B8:88=D>@<0F8>==>9107K 10 6248662 ?>;CG8BL4>?>;=8B5;L=K53@0<<0B8:8A50=A0 10 6248672 ?>;CG8BL4>?>;=8B5;L=K9?0@0<5B@:;85=B0;8F5=78@>20=8O 12 6248682 ?>;CG8BL4>?CAB8<K5:>4K;>:0;870F88 28 6248694 ?>;CG8BL4>?CAB8<K5AB@0=K 24 6248722 ?>;CG8BL4>?CAB8<K5G0A>2K5?>OA0 70 6248746 ?>;CG8BL4>ABC?=>ABL8A?>;L7>20=8O;8F5=7894;O@07@01>BG8:0 10 6248816 ?>;CG8BL4>ABC?=>ABL?>;CG5=8O;8F5=788 14 6248826 ?>;CG8BL4>ABC?=>ABLE@0=8;8I042>8G=KE40==KE 10 6248840 ?>;CG8BL4>ABC?=>ABLF5=B@0;8F5=78@>20=8O 14 6248850 ?>;CG8BL4>ABC?=K53>;>A0A8=B570 18 6248864 ?>;CG8BL4>ABC?=K57=0G5=8O 33 6248882 ?>;CG8BL4>ABC?=K5:;NG8 15 6248915 ?>;CG8BL4>ABC?=K5?>;O 66 6248930 ?>;CG8BL6C@=0;sms 17 6248996 ?>;CG8BL6C@=0;72>=:>2 17 6249013 ?>;CG8BL703>;>2:8 44 6249030 ?>;CG8BL703>;>2:80A8=E 10 6249074 ?>;CG8BL703>;>2>: 14 6249084 ?>;CG8BL70:;04:C:>=F0 12 6249098 ?>;CG8BL70:;04:C=0G0;0 12 6249110 ?>;CG8BL70:;04:C?>?>78F88 12 6249122 ?>;CG8BL70?@5B70AK?0=8O:><?LNB5@0 11 6249134 ?>;CG8BL70?@>A 25 6249145 ?>;CG8BL7=0G5=85 69 6249170 ?>;CG8BL7=0G5=85xdto 10 6249239 ?>;CG8BL7=0G5=85?>;O 10 6249249 ?>;CG8BL7=0G5=8O 24 6249259 ?>;CG8BL7=0G5=8O>B1>@06C@=0;0@538AB@0F88 17 6249283 ?>;CG8BL845=B8D8:0B>@ 37 6249300 ?>;CG8BL845=B8D8:0B>@:>=D83C@0F88 12 6249337 ?>;CG8BL845=B8D8:0B>@?>4?8AG8:0C254><;5=89 14 6249349 ?>;CG8BL845=B8D8:0B>@?>;=>M:@0==>9@5:;0<K 10 6249363 ?>;CG8BL845=B8D8:0B>@?>;L7>20B5;O 10 6249373 ?>;CG8BL845=B8D8:0B>@?>;L7>20B5;O8=D>@<0F8>==>9107K 10 6249383 ?>;CG8BL845=B8D8:0B>@?>>1J5:BC 266 6249393 ?>;CG8BL845=B8D8:0B>@@5:;0<=>3>10==5@0 10 6249659 ?>;CG8BL845=B8D8:0B>@K 27 6249669 ?>;CG8BL872@5<5==>3>E@0=8;8I0 11 6249696 ?>;CG8BL87<5=O5<K5?>;O 12 6249707 ?>;CG8BL8<5=0?@54>?@545;5==KE 44 6249719 ?>;CG8BL8<5=>20==K9M;5<5=B 57 6249763 ?>;CG8BL8<O2@5<5==>3>D09;0 22 6249820 ?>;CG8BL8<O:;85=B0;8F5=78@>20=8O 12 6249842 ?>;CG8BL8<OD09;0B5;0 30 6249854 ?>;CG8BL8=45=B8D8:0B>@2845>>1JO2;5=8OA2>7=03@0645=85< 10 6249884 ?>;CG8BL8=8F80;870F8N?@54>?@545;5==KE40==KE 48 6249894 ?>;CG8BL8=B53@0F88 10 6249942 ?>;CG8BL8=B53@0F8N 12 6249952 ?>;CG8BL8=D>@<0F8>==K5107K 17 6249964 ?>;CG8BL8=D>@<0F8N 10 6249981 ?>;CG8BL8=D>@<0F8N<>4C;O:@8?B>3@0D88 38 6249991 ?>;CG8BL8=D>@<0F8N<>4C;O:@8?B>3@0D880A8=E 33 6250029 ?>;CG8BL8=D>@<0F8N>18A?>;L7>20=88107K40==KE:>?88 16 6250062 ?>;CG8BL8=D>@<0F8N>:>?88 10 6250078 ?>;CG8BL8=D>@<0F8N>?@>1;5<0E?@8<5=5=8O2A50=A5 10 6250088 ?>;CG8BL8=D>@<0F8N>A5B52KE040?B5@0E0A8=E 16 6250098 ?>;CG8BL8=D>@<0F8NM:@0=>2:;85=B0 11 6250114 ?>;CG8BL8A:;NG5==KE?>;CG0B5;59 10 6250125 ?>;CG8BL8A?>;=O5<CNAE5<C:><?>=>2:840==KE 10 6250135 ?>;CG8BL8A?>;=O5<K5=0AB@>9:8:><?>=>2:840==KE 10 6250145 ?>;CG8BL8A?>;L7>20=85 10 6250155 ?>;CG8BL8A?>;L7>20=8503@530B>2 12 6250165 ?>;CG8BL8A?>;L7>20=854>?>;=8B5;L=KE8=45:A>2 11 6250177 ?>;CG8BL8A?>;L7>20=856C@=0;0@538AB@0F88 15 6250188 ?>;CG8BL8A?>;L7>20=858B>3>2 36 6250203 ?>;CG8BL8A?>;L7>20=85:0:E@0=8;8I0?>C<>;G0=8N 10 6250239 ?>;CG8BL8A?>;L7>20=85@>C<8=30 10 6250249 ?>;CG8BL8A?>;L7>20=85A>1KB8O6C@=0;0@538AB@0F88 15 6250259 ?>;CG8BL8A?>;L7>20=85B5:CI8E8B>3>2 24 6250274 ?>;CG8BL8A?>;L7C5<K9A5@25@ 11 6250298 ?>;CG8BL8AB>@8N?@8>1@5B5=89 10 6250309 ?>;CG8BL8AB>G=8:4>ABC?=KE=0AB@>5: 12 6250319 ?>;CG8BL8AE>4=K540==K5 10 6250331 ?>;CG8BL8AE>4=K9B5:AB 10 6250341 ?>;CG8BL8AE>4OI85B>G:8 12 6250351 ?>;CG8BL8AE>4OICNB>G:C 19 6250363 ?>;CG8BL:0:42>8G=K540==K5 10 6250382 ?>;CG8BL:0:42>8G=K540==K50A8=E 10 6250392 ?>;CG8BL:0:?>B>: 10 6250402 ?>;CG8BL:0:AB@>:C 10 6250412 ?>;CG8BL:0:AB@>:C0A8=E 10 6250422 ?>;CG8BL:0;5=40@L 14 6250432 ?>;CG8BL:0;5=40@LA>1KB8O 10 6250446 ?>;CG8BL:0@B8=:8 10 6250456 ?>;CG8BL:0@B8=:C 80 6250466 ?>;CG8BL:0@B8=:C?@54AB02;5=8OD09;0181;8>B5:8<>18;L=>3>CAB@>9AB20 18 6250546 ?>;CG8BL:0@B8=:C?@54AB02;5=8OD09;0181;8>B5:8<>18;L=>3>CAB@>9AB200A8=E 18 6250564 ?>;CG8BL:0@BC<0@H@CB0 46 6250582 ?>;CG8BL:0B0;>3840==KEA5@28A04;O?5@5=>A0 12 6250628 ?>;CG8BL:28B0=F882AB@>5==KE?>:C?>: 10 6250640 ?>;CG8BL:;0AB5@K 22 6250650 ?>;CG8BL:;85=B>2 10 6250672 ?>;CG8BL:;NG8 10 6250682 ?>;CG8BL:>;8G5AB2>7040=898=45:A8@>20=8O 14 6250692 ?>;CG8BL:>;8G5AB2>7040=89?5@5AG5B08B>3>2 11 6250706 ?>;CG8BL:>;8G5AB2>:04@>2 10 6250717 ?>;CG8BL:>;8G5AB2>:>=B0:B>2 10 6250727 ?>;CG8BL:>;8G5AB2>A>>1I5=89 19 6250737 ?>;CG8BL:>;8G5AB2>A>E@0=O5<KE7=0G5=89?0@>;59 10 6250756 ?>;CG8BL:><0=4=CN?0=5;L 60 6250766 ?>;CG8BL:><0=4=K98=B5@D59A 10 6250826 ?>;CG8BL:><<5=B0@8925@A888AB>@8840==KE 12 6250836 ?>;CG8BL:><?0:B=K94>:C<5=B 22 6250848 ?>;CG8BL:><?>=5=BKA2O7=>AB8 22 6250870 ?>;CG8BL:>=B0:B 15 6250892 ?>;CG8BL:>=B59=5@?>4?8A59:@8?B>3@0D88 29 6250907 ?>;CG8BL:>=B59=5@?>4?8A59:@8?B>3@0D880A8=E 18 6250936 ?>;CG8BL:>=B5:AB=>5<5=N 50 6250954 ?>;CG8BL:>@=52K58AB>G=8:8 9 6251004 ?>;CG8BL:@0B:89703>;>2>: 14 6251013 ?>;CG8BL;8F5=78>==>5A>3;0H5=85@07@01>BG8:0 10 6251027 ?>;CG8BL;8F5=78N02B><0B8G5A:8 10 6251037 ?>;CG8BL;8F5=78N=0=>A8B5;5 10 6251047 ?>;CG8BL;8F5=78N?>B5;5D>=C 10 6251057 ?>;CG8BL;>:0;L=CNCG5B=CN70?8AL:0;5=40@59 10 6251067 ?>;CG8BL;>:0;L=CNCG5B=CN70?8AL:>=B0:B>2 10 6251077 ?>;CG8BL<0:5B 452 6251087 ?>;CG8BL<0:5B>D>@<;5=8O 20 6251539 ?>;CG8BL<0:5B>D>@<;5=8O?>;L7>20B5;O 10 6251559 ?>;CG8BL<0:A8<0;L=>52@5<O2K?>;=5=8O459AB28O 10 6251569 ?>;CG8BL<0:A8<0;L=>5:>;8G5AB2>CG0AB=8:>22845>:>=D5@5=F88 11 6251579 ?>;CG8BL<0:A8<0;L=K9?5@8>4@0AAG8B0==KE8B>3>2 26 6251590 ?>;CG8BL<0:A8<0;L=K9@07<5@8=45:A8@C5<KE40==KE 10 6251616 ?>;CG8BL<0:A8<0;L=K9A@>:459AB28O?0@>;59?>;L7>20B5;59 11 6251626 ?>;CG8BL<0@:5@4>ABC?0 15 6251637 ?>;CG8BL<0A:C2A5D09;K 11 6251652 ?>;CG8BL<0A:C2A5D09;K:;85=B0 11 6251663 ?>;CG8BL<0A:C2A5D09;KA5@25@0 11 6251674 ?>;CG8BL<5=5465@70?8A8 19 6251685 ?>;CG8BL<5=5465@K:;0AB5@0 17 6251704 ?>;CG8BL<5AB>?>;>65=85?>04@5AC 23 6251721 ?>;CG8BL<5B040==K5 15 6251744 ?>;CG8BL<8=8<0;L=CN4;8=C?0@>;59?>;L7>20B5;59 11 6251759 ?>;CG8BL<8=8<0;L=K9?5@8>4@0AAG8B0==KE8B>3>2 32 6251770 ?>;CG8BL<8=8<0;L=K9@07<5@70?8AK205<KE40==KE 10 6251802 ?>;CG8BL<8=8<0;L=K9A@>:459AB28O?0@>;59?>;L7>20B5;59 11 6251812 ?>;CG8BL<>45;L@0A?>7=020=8O2>2@5<5==>5E@0=8;8I5 10 6251823 ?>;CG8BL=02830F8>==CNAAK;:C 116 6251833 ?>;CG8BL=02830F8>==CNAAK;:C2=5H=53>4>ABC?0 15 6251949 ?>;CG8BL=02830F8>==CNAAK;:C70?8A8 20 6251964 ?>;CG8BL=02830F8>==CNAAK;:C8=D>@<0F8>==>9107K 16 6251984 ?>;CG8BL=02830F8>==CNAAK;:C>1@01>B:8 10 6252000 ?>;CG8BL=02830F8>==CNAAK;:C>1J5:B0 70 6252010 ?>;CG8BL=02830F8>==CNAAK;:C>BG5B0 10 6252080 ?>;CG8BL=02830F8>==CNAAK;:C?@83;0H5=8O2>1AC645=85 11 6252090 ?>;CG8BL=02830F8>==CNAAK;:CA>>1I5=8O 9 6252101 ?>;CG8BL=02830F8>==CNAAK;:CA?8A:0 10 6252110 ?>;CG8BL=02830F8>==CNAAK;:CB5:CI53>20@80=B0>BG5B0 10 6252120 ?>;CG8BL=02830F8>==CNAAK;:CB5:CI8E=0AB@>5:>BG5B0 10 6252130 ?>;CG8BL=02830F8>==CNAAK;:CB5:CI8E=0AB@>5:A?8A:0 10 6252140 ?>;CG8BL=08<5=>20=85?@8;>65=8O 10 6252150 ?>;CG8BL=0:;59:C 14 6252160 ?>;CG8BL=0:>?;5==K57=0G5=8O 12 6252174 ?>;CG8BL=0:>?;5==K5?>:070B5;8?@>872>48B5;L=>AB8 10 6252186 ?>;CG8BL=0;>3>2CNAB02:C 6 6252196 ?>;CG8BL=0AB@>9:8 110 6252202 ?>;CG8BL=0AB@>9:802B><0B8G5A:>3>A>E@0=5=8O0CB5=B8D8:0F88 10 6252312 ?>;CG8BL=0AB@>9:802B><0B8G5A:>3>A>E@0=5=8O?0@0<5B@>20CB5=B8D8:0F88 13 6252322 ?>;CG8BL=0AB@>9:80CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 14 6252335 ?>;CG8BL=0AB@>9:82>AAB0=>2;5=8O?0@>;O 14 6252349 ?>;CG8BL=0AB@>9:8>1@01>B:8>H81>:?@870?CA:5 10 6252363 ?>;CG8BL=0AB@>9:8?>;L7>20B5;O 14 6252373 ?>;CG8BL=0AB@>9:8?@>25@:8@0A:@KB8O?0@>;O 14 6252387 ?>;CG8BL=0AB@>9:8A5@28A>2 12 6252401 ?>;CG8BL=0AB@>9:CA5@28A0 13 6252413 ?>;CG8BL=0G0;>AB>;5B8O8=D>@<0F8>==>9107K 11 6252426 ?>;CG8BL=52848<>ABL 31 6252437 ?>;CG8BL=52848<>ABL0A8=E 18 6252468 ?>;CG8BL=>2K9:;NG04<8=8AB@8@>20=8O 11 6252486 ?>;CG8BL=><5@B5:CI53>:04@0 10 6252497 ?>;CG8BL>1;0ABL 66 6252507 ?>;CG8BL>1=>2;5=85:>=D83C@0F88107K40==KE 11 6252573 ?>;CG8BL>1=>2;5=85?@54>?@545;5==KE40==KE 59 6252584 ?>;CG8BL>1=>2;5=85?@54>?@545;5==KE40==KE8=D>@<0F8>==>9107K 21 6252643 ?>;CG8BL>1AC645=85 12 6252664 ?>;CG8BL>1AC645=850A8=E 20 6252676 ?>;CG8BL>1AC645=8O 11 6252696 ?>;CG8BL>1I85=0AB@>9:8 10 6252707 ?>;CG8BL>1I85?0@0<5B@KA>548=5=8O 12 6252717 ?>;CG8BL>1I89<0:5B 25 6252729 ?>;CG8BL>1I89<0:5B>D>@<;5=8O 10 6252754 ?>;CG8BL>1ICND>@<C 31 6252764 ?>;CG8BL>1J5:B 453 6252795 ?>;CG8BL>1J5:B?>845=B8D8:0B>@C 254 6253248 ?>;CG8BL>1O70B5;L=>58A?>;L7>20=85 10 6253502 ?>;CG8BL>3@0=8G5=85?>2B>@5=8O?0@>;59?>;L7>20B5;59A@548?>A;54=8E 11 6253512 ?>;CG8BL>3@0=8G5=8O8A?>;L7>20=8O23@C??8@>2:5 10 6253523 ?>;CG8BL>3@0=8G5=8O8A?>;L7>20=8O2>B1>@5 10 6253533 ?>;CG8BL>3@0=8G5=8O8A?>;L7>20=8O2?>@O4:5 10 6253543 ?>;CG8BL>3@0=8G5=8O?>B@51;5=8O@5AC@A>2 17 6253553 ?>;CG8BL>68405<CNA:>@>ABLA>548=5=8O 10 6253570 ?>;CG8BL>:=0 19 6253580 ?>;CG8BL>?5@0B82=CN>B<5B:C2@5<5=8 11 6253599 ?>;CG8BL>?8A0=85 40 6253610 ?>;CG8BL>?8A0=852=5H=59A8AB5<K 11 6253650 ?>;CG8BL>?8A0=85<>45;59@0A?>7=020=8O 10 6253661 ?>;CG8BL>?8A0=8O?>4?8A59 28 6253671 ?>;CG8BL>?8A0=8O?>4?8A590A8=E 28 6253699 ?>;CG8BL>?>25I5=8OB5:CI53>?>;L7>20B5;O 15 6253727 ?>;CG8BL>A=>2=>9:0;5=40@L 10 6253742 ?>;CG8BL>A=>2=K5=0AB@>9:8?>845=B8D8:0B>@C?>;L7>20B5;LA:>9=0AB@>9:8 12 6253752 ?>;CG8BL>B:;NG5=85157>?0A=>3>@568<0 11 6253764 ?>;CG8BL>B:;NG5=8570I8BK>B>?0A=KE459AB289 18 6253775 ?>;CG8BL>B>1@0605<K9B5:AB 40 6253793 ?>;CG8BL>B>1@065=85 24 6253833 ?>;CG8BL>B>1@065=85703>;>2:0>A 10 6253857 ?>;CG8BL>B>1@065=85>?>25I5=89>1AC645=8O 11 6253867 ?>;CG8BL>B>1@065=85@5:;0<=>3>10==5@0 10 6253878 ?>;CG8BL>B>1@065=85A>AB>O=8O 10 6253888 ?>;CG8BL>BA;568205<CN35>7>=C 10 6253898 ?>;CG8BL>BA;568205<K535>7>=K 10 6253908 ?>;CG8BL?0;8B@C 22 6253918 ?>;CG8BL?0@0<5B@ 30 6253940 ?>;CG8BL?0@0<5B@K 10 6253970 ?>;CG8BL?0@0<5B@K2=5H=53>?>4:;NG5=8O8=D>@<0F8>==>9107K 10 6253980 ?>;CG8BL?0@0<5B@K2=5H=53>?>4:;NG5=8OA50=A0 10 6253990 ?>;CG8BL?0@0<5B@K2K1>@0 28 6254000 ?>;CG8BL?0@0<5B@K<>=>?>;L=>3>@568<0 15 6254028 ?>;CG8BL?0@0<5B@K?@82O7:8::><?LNB5@C 15 6254043 ?>;CG8BL?0@0<5B@KA>548=5=8O?>;L7>20B5;O 12 6254058 ?>;CG8BL?0@0<5B@KA>548=5=8OA50=A0 12 6254070 ?>;CG8BL?0@0<5B@KDC=:F8>=0;L=KE>?F898=B5@D59A0 11 6254082 ?>;CG8BL?0@0<5B@KDC=:F8>=0;L=KE>?F89D>@<K 11 6254093 ?>;CG8BL?5@2>5 14 6254104 ?>;CG8BL?5@2K945=L=545;8 10 6254118 ?>;CG8BL?5@8>46C@=0;0@538AB@0F88 17 6254128 ?>;CG8BL?5@8>4@0745;5=8OE@0=5=8O40==KE6C@=0;0@538AB@0F88 22 6254145 ?>;CG8BL?5@8>4@0AAG8B0==KE8B>3>2 5 6254167 ?>;CG8BL?;0= 14 6254172 ?>;CG8BL?>445@68205<K5@07@5H5=8O:0<5@K 15 6254186 ?>;CG8BL?>4A:07:C22>40 10 6254201 ?>;CG8BL?>4G8=5==K5>1J5:BK 110 6254211 ?>;CG8BL?>78F8N?>70:;04:5 12 6254321 ?>;CG8BL?>;5703>;>2:0 10 6254333 ?>;CG8BL?>;5B5:CI59>1;0AB8 10 6254343 ?>;CG8BL?>;8B8:8 10 6254353 ?>;CG8BL?>;=>58<O?@54>?@545;5==>3>7=0G5=8O 11 6254363 ?>;CG8BL?>;L7>20B5;59 37 6254374 ?>;CG8BL?>;L7>20B5;LA:8540==K5 420 6254411 ?>;CG8BL?>;L7>20B5;O 19 6254831 ?>;CG8BL?>;O 17 6254850 ?>;CG8BL?>@O4>::>40 26 6254867 ?>;CG8BL?>A;54=55 14 6254893 ?>;CG8BL?>A;54=55<5AB>?>;>65=85 10 6254907 ?>;CG8BL?>B>:B>;L:>4;OGB5=8O 30 6254917 ?>;CG8BL?>GB>2K5OI8:8 10 6254947 ?>;CG8BL?>GB>2K5OI8:8?>?>4?8A:5 10 6254957 ?>;CG8BL?@54AB02;5=852K@065=8O45B0;L=KE70?8A59 12 6254967 ?>;CG8BL?@54AB02;5=852K@065=8O8B>3>2KE70?8A59 12 6254979 ?>;CG8BL?@54AB02;5=8540==KE 10 6254991 ?>;CG8BL?@54AB02;5=85A?8A:02K1>@0 40 6255001 ?>;CG8BL?@54AB02;5=85D09;0181;8>B5:8<>18;L=>3>CAB@>9AB20 10 6255041 ?>;CG8BL?@54AB02;5=8O38?5@AAK;>:D>@<0B8@>20==>9AB@>:8 20 6255051 ?>;CG8BL?@54AB02;5=8O=02830F8>==KEAAK;>: 15 6255071 ?>;CG8BL?@58<CI5AB25==>58A?>;L7>20=85>A=>2=>3>A5@25@0 11 6255086 ?>;CG8BL?@82O7:C 16 6255097 ?>;CG8BL?@8;>65=85 11 6255113 ?>;CG8BL?@8;>65=8O01>=5=B0 11 6255124 ?>;CG8BL?@>20945@0 10 6255135 ?>;CG8BL?@>20945@>2 10 6255145 ?>;CG8BL?@>25@:C@0A:@KB8O?0@>;59?>;L7>20B5;59 11 6255155 ?>;CG8BL?@>25@:CA;>6=>AB8?0@>;59?>;L7>20B5;59 16 6255166 ?>;CG8BL?@>4>;68B5;L=>ABL0C48> 10 6255182 ?>;CG8BL?@>D8;8157>?0A=>AB8 17 6255192 ?>;CG8BL@01>G85?@>F5AAK 12 6255209 ?>;CG8BL@01>G85A5@25@K 17 6255221 ?>;CG8BL@0745;8B5;L?CB8 11 6255238 ?>;CG8BL@0745;8B5;L?CB8:;85=B0 11 6255249 ?>;CG8BL@0745;8B5;L?CB8A5@25@0 11 6255260 ?>;CG8BL@07;8G8O25@A89 16 6255271 ?>;CG8BL@07<5@40==KE107K40==KE 13 6255287 ?>;CG8BL@07<5@40==KE107K40==KE8E@0=8;8I042>8G=KE40==KE 13 6255300 ?>;CG8BL@07<5@>1;0AB840==KE4>:C<5=B0?>25@B8:0;8 10 6255313 ?>;CG8BL@07<5@>1;0AB840==KE4>:C<5=B0?>3>@87>=B0;8 10 6255323 ?>;CG8BL@07<5@>1;0AB840==KE?>25@B8:0;8 13 6255333 ?>;CG8BL@07<5@>1;0AB840==KE?>3>@87>=B0;8 13 6255346 ?>;CG8BL@07<5@?>;O?@8=B5@0A25@EC 13 6255359 ?>;CG8BL@07<5@?>;O?@8=B5@0A;520 13 6255372 ?>;CG8BL@07<5@?>;O?@8=B5@0A=87C 13 6255385 ?>;CG8BL@07<5@?>;O?@8=B5@0A?@020 13 6255398 ?>;CG8BL@07@5H5==K5com:;0AAK 17 6255411 ?>;CG8BL@07@5H5==K528@BC0;L=K5:0B0;>38 17 6255428 ?>;CG8BL@07@5H5==K52=5H=85:><?>=5=BK 17 6255445 ?>;CG8BL@07@5H5==K52=5H=85<>4C;8 22 6255462 ?>;CG8BL@07@5H5==K52=5H=85?@8;>65=8O 17 6255484 ?>;CG8BL@07@5H5==K58=B5@=5B@5AC@AK 17 6255501 ?>;CG8BL@538>=0;L=K5=0AB@>9:88=D>@<0F8>==>9107K 29 6255518 ?>;CG8BL@538>=0;L=K5=0AB@>9:8A50=A0 21 6255547 ?>;CG8BL@53;0<5=B=K57040=8O 10 6255568 ?>;CG8BL@568<03@530B>2 12 6255578 ?>;CG8BL@568<2=5H=8E@5AC@A>2 11 6255590 ?>;CG8BL@568<8A?>;L7>20=8OE@0=8;8I042>8G=KE40==KE 10 6255601 ?>;CG8BL@568<=01;N45=8O 11 6255611 ?>;CG8BL@568<>A=>2=>3>>:=0 14 6255622 ?>;CG8BL@568<>B>1@065=8O@57C;LB0B0 14 6255636 ?>;CG8BL@568<?>;=>B5:AB>2>3>?>8A:0 14 6255650 ?>;CG8BL@568<@0745;5=8O8B>3>2 25 6255664 ?>;CG8BL@568<@0745;5=8OA>AB02=KEA;>2 14 6255689 ?>;CG8BL@568<@07<5I5=8O:>?8940==KE2E@0=8;8I542>8G=KE40==KE 10 6255703 ?>;CG8BL@568<GB5=8O70?8A8E@0=8;8I042>8G=KE40==KE 10 6255713 ?>;CG8BL@57C;LB0BK>B;>65==KE@0A?>7=020=89 14 6255723 ?>;CG8BL@5:2878BK 11 6255737 ?>;CG8BL@5:><5=4C5<CNH8@8=CA60B8O 17 6255748 ?>;CG8BL@>48B5;59 24 6255765 ?>;CG8BL@>48B5;O 101 6255789 ?>;CG8BLA0<>3>B>G=>3>?@>20945@0 10 6255890 ?>;CG8BLA0<>3>M=5@3>M:>=><8G=>3>?@>20945@0 10 6255900 ?>;CG8BLA2>9AB2> 10 6255910 ?>;CG8BLA2O70==>5>:=> 10 6255920 ?>;CG8BLA2O78?0@0<5B@>22K1>@0 29 6255930 ?>;CG8BLA50=AK 35 6255959 ?>;CG8BLA50=AK8=D>@<0F8>==>9107K 11 6255994 ?>;CG8BLA5@28AK 17 6256005 ?>;CG8BLA5@B8D8:0B 10 6256022 ?>;CG8BLA5@B8D8:0BK 22 6256032 ?>;CG8BLA5@B8D8:0BK0A8=E 18 6256054 ?>;CG8BLA5@B8D8:0BK87?>4?8A8 18 6256072 ?>;CG8BLA5@B8D8:0BK87?>4?8A80A8=E 20 6256090 ?>;CG8BLA:;>=5=8OAB@>:8 14 6256110 ?>;CG8BLA:;>=5=8OAB@>:8?>G8A;C 15 6256124 ?>;CG8BLA:>@>ABL:;85=BA:>3>A>548=5=8O 15 6256139 ?>;CG8BLA;54CNI89 10 6256154 ?>;CG8BLA>1KB85 10 6256164 ?>;CG8BLA>2<5AB=>58A?>;L7>20=85?@8;>65=8901>=5=B0 11 6256174 ?>;CG8BLA>548=5=85 20 6256185 ?>;CG8BLA>548=5=8O 39 6256205 ?>;CG8BLA>548=5=8O8=D>@<0F8>==>9107K 11 6256244 ?>;CG8BLA>>1I5=85 11 6256255 ?>;CG8BLA>>1I5=850A8=E 10 6256266 ?>;CG8BLA>>1I5=8O 11 6256276 ?>;CG8BLA>>1I5=8O?>;L7>20B5;N 36 6256287 ?>;CG8BLA>>B25BAB285>1J5:B08@5:2878B0D>@<K 23 6256323 ?>;CG8BLA>>B25BAB285>1J5:B08D>@<K 22 6256346 ?>;CG8BLA>>B25BAB28O?@>AB@0=AB28<5= 16 6256368 ?>;CG8BLA>AB02 10 6256384 ?>;CG8BLA>AB02AB0=40@B=>3>8=B5@D59A0odata 17 6256394 ?>;CG8BLA>AB02D>@< 10 6256411 ?>;CG8BLA>AB02E@0=8<KE40==KE 10 6256421 ?>;CG8BLA>AB>O=85 32 6256431 ?>;CG8BLA>AB>O=85A>548=5=8O 10 6256463 ?>;CG8BLA?8A>: 46 6256473 ?>;CG8BLA?8A>:4518B>@>2 5 6256519 ?>;CG8BLA?8A>:A>E@0=O5<KE7=0G5=89?0@>;59 11 6256524 ?>;CG8BLA?>A>1?@>25@:8?>4?8A8<>18;L=>3>:;85=B0 11 6256535 ?>;CG8BLA@57 10 6256546 ?>;CG8BLA@>:?@54C?@5645=8O>18AB5G5=88A@>:0459AB28O?0@>;59?>;L7>20B5;59 11 6256556 ?>;CG8BLAAK;:C 248 6256567 ?>;CG8BLAAK;:C=0=587<5==K9uri 10 6256815 ?>;CG8BLAAK;:C=>2>3> 151 6256825 ?>;CG8BLAB0670?5@8>4 6 6256976 ?>;CG8BLAB0=40@B=>5E@0=8;8I520@80=B>2>BG5B>2 11 6256982 ?>;CG8BLAB0=40@B=>5E@0=8;8I52=5H=8E40==KE=02830F8>==KEAAK;>: 11 6256993 ?>;CG8BLAB0=40@B=>5E@0=8;8I5=0AB@>5:40==KED>@< 11 6257004 ?>;CG8BLAB0=40@B=>5E@0=8;8I5>1I8E=0AB@>5: 11 6257015 ?>;CG8BLAB0=40@B=>5E@0=8;8I5?>;L7>20B5;LA:8E=0AB@>5:48=0<8G5A:8EA?8A:>2 11 6257026 ?>;CG8BLAB0=40@B=>5E@0=8;8I5?>;L7>20B5;LA:8E=0AB@>5:>BG5B>2 11 6257037 ?>;CG8BLAB0BCA@5:;0<K 10 6257048 ?>;CG8BLAB@>:8 14 6257058 ?>;CG8BLAB@>:C 13 6257072 ?>;CG8BLAB@>:Cbase64 12 6257085 ?>;CG8BLAB@>:C871CD5@042>8G=KE40==KE 11 6257097 ?>;CG8BLAB@>:C8742>8G=KE40==KE 11 6257108 ?>;CG8BLAB@C:BC@CE@0=5=8O107K40==KE 18 6257119 ?>;CG8BLAE5<C 41 6257137 ?>;CG8BLAE5<C:><?>=>2:840==KE 5 6257178 ?>;CG8BLAG5BG8:8?>B@51;5=8O@5AC@A>2 17 6257183 ?>;CG8BLAO 35 6257200 ?>;CG8BLB5:AB 94 6257235 ?>;CG8BLB5:AB70?@>A0 19 6257329 ?>;CG8BLB5:AB>1;0AB8 14 6257348 ?>;CG8BLB5:AB>BG5B0 10 6257362 ?>;CG8BLB5:AB?>4A:07:8 50 6257372 ?>;CG8BLB5:AB@540:B8@>20=8O 20 6257422 ?>;CG8BLB5:ABA?>4AB0=>2:0<8 10 6257442 ?>;CG8BLB5:ABB5:CI59>1;0AB8 10 6257452 ?>;CG8BLB5:ABKA>>1I5=89?>;L7>20B5;N 10 6257462 ?>;CG8BLB5:ABKM;5<5=B>2A>AB>O=8O?@>A<>B@0 10 6257472 ?>;CG8BLB5:ABOG59:8 10 6257482 ?>;CG8BLB5:CI558A?>;L7>20=85 10 6257492 ?>;CG8BLB5:CI55A>548=5=85 10 6257502 ?>;CG8BLB5:CI55A>AB>O=85 10 6257512 ?>;CG8BLB5:CI85=0AB@>9:8 12 6257522 ?>;CG8BLB5:CI8904@5A>1=>2;5=8O 12 6257534 ?>;CG8BLB5:CI89@568<>B>1@065=8O@57C;LB0B0 14 6257546 ?>;CG8BLB5:CI89A50=A8=D>@<0F8>==>9107K 11 6257560 ?>;CG8BLB5:CI89M;5<5=B 20 6257571 ?>;CG8BLB5:CICN8=D>@<0F8N>1>H81:5 10 6257591 ?>;CG8BLB5:CICNAB@0=8FC 20 6257601 ?>;CG8BLB5;0B01;8FK 14 6257621 ?>;CG8BLB5;>:0:42>8G=K540==K5 53 6257635 ?>;CG8BLB5;>:0:?>B>: 50 6257688 ?>;CG8BLB5;>:0:AB@>:C 49 6257738 ?>;CG8BLB8?0;3>@8B<0E5H8@>20=8O?0@>;59?>;L7>20B5;59 24 6257787 ?>;CG8BLB8?A>548=5=8O 10 6257811 ?>;CG8BLB8?K2=5H=8EA8AB5< 11 6257821 ?>;CG8BLB>;L:>GB5=85 31 6257832 ?>;CG8BLB>;L:>GB5=850A8=E 18 6257863 ?>;CG8BLB@51>20=8O=07=0G5=8O 12 6257881 ?>;CG8BLC75;0B@81CB0 261 6257893 ?>;CG8BLC=825@A0;L=>52@5<O87<5=5=8O 28 6258154 ?>;CG8BLC=825@A0;L=>52@5<O87<5=5=8O0A8=E 18 6258182 ?>;CG8BLC=825@A0;L=CN40BCA>740=8O@575@2=>9:>?88 10 6258200 ?>;CG8BLC=8:0;L=K9845=B8D8:0B>@A?>445@6:>9A>2<5AB8<>AB8 11 6258210 ?>;CG8BLCG5B=K570?8A8:0;5=40@59 14 6258221 ?>;CG8BLCG5B=K570?8A8:>=B0:B>2 10 6258235 ?>;CG8BLD09; 39 6258245 ?>;CG8BLD09;AA5@25@00A8=E 24 6258284 ?>;CG8BLD09;K 35 6258308 ?>;CG8BLD09;KAA5@25@00A8=E 44 6258343 ?>;CG8BLD0:B8G5A:89?5@8>4459AB28O 13 6258387 ?>;CG8BLD;038A>>1I5=89 10 6258400 ?>;CG8BLD>=>2>57040=85 10 6258410 ?>;CG8BLD>=>2K57040=8O 12 6258420 ?>;CG8BLD>@<0B8@>20==CNAB@>:C 12 6258432 ?>;CG8BLD>@<C 682 6258444 ?>;CG8BLD>@<C2K1>@0 114 6259126 ?>;CG8BLD>@<C2K1>@03@C??K 24 6259240 ?>;CG8BLD>@<C703@C7:8 12 6259264 ?>;CG8BLD>@<C=0AB@>5: 24 6259276 ?>;CG8BLD>@<C=>2>3>187=5A?@>F5AA0 12 6259300 ?>;CG8BLD>@<C=>2>3>2840@0AG5B0 14 6259312 ?>;CG8BLD>@<C=>2>3>4>:C<5=B0 12 6259326 ?>;CG8BLD>@<C=>2>3>AG5B0 12 6259338 ?>;CG8BLD>@<C=>2>3>C7;0 12 6259350 ?>;CG8BLD>@<C=>2>3>M;5<5=B0 28 6259362 ?>;CG8BLD>@<C=>2>93@C??K 28 6259390 ?>;CG8BLD>@<C=>2>97040G8 12 6259418 ?>;CG8BLD>@<C@540:B8@>20=8O70?8A8 12 6259430 ?>;CG8BLD>@<CA>E@0=5=8O 12 6259442 ?>;CG8BLD>@<CA?8A:0 222 6259454 ?>;CG8BLDC=:F8>=0;L=CN>?F8N 11 6259676 ?>;CG8BLDC=:F8>=0;L=CN>?F8N8=B5@D59A0 11 6259687 ?>;CG8BLDC=:F8>=0;L=CN>?F8ND>@<K 11 6259698 ?>;CG8BLE@0=8;8I042>8G=KE40==KE 12 6259709 ?>;CG8BLE@0=8;8I5A5@B8D8:0B>2 29 6259721 ?>;CG8BLE@0=8;8I5A5@B8D8:0B>20A8=E 20 6259750 ?>;CG8BLG0A>2>9?>OA8=D>@<0F8>==>9107K 17 6259770 ?>;CG8BLH01;>=A>>1I5=8O 11 6259787 ?>;CG8BLH01;>=A>>1I5=8O0A8=E 15 6259798 ?>;CG8BLH01;>=K 10 6259813 ?>;CG8BLH01;>=KA>>1I5=8O 15 6259823 ?>;CG8BLH01;>=KA>>1I5=8O0A8=E 15 6259838 ?>;CG8BLM;5<5=B?>845=B8D8:0B>@C 20 6259853 ?>;CG8BLM;5<5=BK 37 6259873 ?>;CG8BLM;5<5=BK?>8<5=8 303 6259910 ?>;K9 6 6260213 ?>;L70 5 6260219 ?>;L7>20B5;5 64 6260224 ?>;L7>20B5;59 838 6260288 ?>;L7>20B5;5< 674 6261126 ?>;L7>20B5;8 224 6261800 ?>;L7>20B5;8windows 11 6262024 ?>;L7>20B5;88=D>@<0F8>==>9107K 28 6262035 ?>;L7>20B5;8>A 16 6262063 ?>;L7>20B5;9 5 6262079 ?>;L7>20B5;< 4 6262084 ?>;L7>20B5;L 5913 6262088 ?>;L7>20B5;L123 4 6268001 ?>;L7>20B5;Limap 9 6268005 ?>;L7>20B5;Lsmtp 72 6268014 ?>;L7>20B5;Lsmtp0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 6268086 ?>;L7>20B5;L107K40==KE 66 6268122 ?>;L7>20B5;L157=5>1E>48<KEA2>9AB2 12 6268188 ?>;L7>20B5;L81 18 6268200 ?>;L7>20B5;L8=B53@0F88A8AB5<K2708<>459AB28O 12 6268218 ?>;L7>20B5;L8=D>@<0F8>==>9107K 322 6268230 ?>;L7>20B5;L>A 120 6268552 ?>;L7>20B5;LA0CB5=B8D8:0F859 12 6268672 ?>;L7>20B5;LA5@25@0>B;04:8 48 6268684 ?>;L7>20B5;LA8AB5<K2708<>459AB28O 110 6268732 ?>;L7>20B5;LA:0O 6 6268842 ?>;L7>20B5;LA:85 1010 6268848 ?>;L7>20B5;LA:85=0AB@>9:8 73 6269858 ?>;L7>20B5;LA:85=0AB@>9:8:><?>=>2:840==KE 154 6269931 ?>;L7>20B5;LA:85=0AB@>9:8<>48D8F8@>20=K 18 6270085 ?>;L7>20B5;LA:85?>;O 28 6270103 ?>;L7>20B5;LA:85?>;O:><?>=>2:840==KE 68 6270131 ?>;L7>20B5;LA:89 2305 6270199 ?>;L7>20B5;LA:89?0@0<5B@ 8 6272504 ?>;L7>20B5;LA:8< 38 6272512 ?>;L7>20B5;LA:8<8 5 6272550 ?>;L7>20B5;LA:8E 1266 6272555 ?>;L7>20B5;LA:>3> 132 6273821 ?>;L7>20B5;LA:>5 71 6273953 ?>;L7>20B5;LA:>5?>;52K1>@:><?>=>2:840==KE 82 6274024 ?>;L7>20B5;LA:>5?>;52K@065=85:><?>=>2:840==KE 125 6274106 ?>;L7>20B5;LA:>5?@54AB02;5=852K@065=8O 12 6274231 ?>;L7>20B5;LA:>9 121 6274243 ?>;L7>20B5;LA:>< 16 6274364 ?>;L7>20B5;LA:><C 37 6274380 ?>;L7>20B5;LA:CN 14 6274417 ?>;L7>20B5;N 903 6274431 ?>;L7>20B5;O 2702 6275334 ?>;L7>20B5;O< 104 6278036 ?>;L7>20B5;O<8 179 6278140 ?>;L7>20B5;OE 10 6278319 ?>;L7>20BL 4 6278329 ?>;L7>20BLAO 20 6278333 ?>;L7C 5 6278353 ?>;L7C5BAO 5 6278358 ?>;L>20B5;59 4 6278363 ?>;LA:89 38 6278367 ?>;LA:>3> 14 6278405 ?>;LH0 12 6278419 ?>;N 548 6278431 ?>;O 19070 6278979 ?>;Ogt 72 6298049 ?>;O0;LB5@=0B82 9 6298121 ?>;O1;>:8@>2:840==KE 81 6298130 ?>;O2K1>@0:><?>=>2:840==KE 9 6298211 ?>;O2K1>@0:><?>=>2:840==KEAE5<K70?@>A0 54 6298220 ?>;O3@C??8@>2:8 62 6298274 ?>;O3@C??8@>2:81 9 6298336 ?>;O3@C??8@>2:82 9 6298345 ?>;O3@C??8@>2:8:><?>=>2:840==KE 82 6298354 ?>;O3@C??8@>2:8:><?>=>2:840==KE=54>ABC?=K5 12 6298436 ?>;O4>ABC?0 25 6298448 ?>;O8B>30 16 6298473 ?>;O8B>30AE5<K:><?>=>2:840==KE 67 6298489 ?>;O:28B0=F88 5 6298556 ?>;O:;NG0 22 6298561 ?>;O:>;>=:8AE5<K70?@>A0 33 6298583 ?>;O< 277 6298616 ?>;O<8 174 6298893 ?>;O=01>@040==KE<0:5B0:><?>=>2:840==KE 92 6299067 ?>;O=01>@040==KEAE5<K:><?>=>2:840==KE 70 6299159 ?>;O=0AB@>9:8 132 6299229 ?>;O?>AB@>8B5;O70?@>A0 65 6299361 ?>;O?>AB@>8B5;O>BG5B0 65 6299426 ?>;O@538AB@0F88 44 6299491 ?>;OAE5<K70?@>A0 49 6299535 ?>;OE 120 6299584 ?>;OM;5<5=B01;>:8@>2:840==KE 28 6299704 ?>;OM;5<5=B0A>AB020:>?88107K40==KE 33 6299732 ?><5AB8< 5 6299765 ?><5AB8BAO 4 6299770 ?><5AB8BL 214 6299774 ?><5AB8BL2>2@5<5==>5E@0=8;8I5 21 6299988 ?><5AB8BL40==K50A8=E 31 6300009 ?><5AB8BL=0 6 6300040 ?><5AB8BLAO 9 6300046 ?><5AB8BLD09; 29 6300055 ?><5AB8BLD09;8=B5@0:B82=> 6 6300084 ?><5AB8BLD09;=0A5@25@0A8=E 38 6300090 ?><5AB8BLD09;=58=B5@0:B82=> 6 6300128 ?><5AB8BLD09;K 29 6300134 ?><5AB8BLD09;K=0A5@25@0A8=E 44 6300163 ?><5AOG=K9 10 6300207 ?><5B8BL 14 6300217 ?><5B8BL=0C40;5=85 12 6300231 ?><5B:0 635 6300243 ?><5B:0C40;5=8O 525 6300878 ?><5B:8 396 6301403 ?><5B:>9 19 6301799 ?><5B:C 79 6301818 ?><5B>: 15 6301897 ?><5G05B 4 6301912 ?><5G05BAO 19 6301916 ?><5G0BL 29 6301935 ?><5G0BLAO 19 6301964 ?><5G0NI89 5 6301983 ?><5G5= 37 6301988 ?><5G5=0 27 6302025 ?><5G5==>3> 9 6302052 ?><5G5==>5 10 6302061 ?><5G5==CN 4 6302071 ?><5G5==K5 37 6302075 ?><5G5==K5>1J5:BK 7 6302112 ?><5G5==K9 209 6302119 ?><5G5==K9M;5<5=B 7 6302328 ?><5G5==K< 9 6302335 ?><5G5==K<8 4 6302344 ?><5G5==KE 88 6302348 ?><5G5=K 35 6302436 ?><5I05<>3> 25 6302471 ?><5I05<>5 4 6302496 ?><5I05<K5 16 6302500 ?><5I05<K5D09;K 43 6302516 ?><5I05<K9 182 6302559 ?><5I05<K9D09; 66 6302741 ?><5I05<K< 5 6302807 ?><5I05<KE 57 6302812 ?><5I05B 114 6302869 ?><5I05BAO 242 6302983 ?><5I0;AO 5 6303225 ?><5I0BL 279 6303230 ?><5I0BLAO 315 6303509 ?><5I0NBAO 64 6303824 ?><5I0NI59AO 13 6303888 ?><5I0NI89AO 21 6303901 ?><5I0O 10 6303922 ?><5I5= 92 6303932 ?><5I5=0 22 6304024 ?><5I5=85 379 6304046 ?><5I5=85< 32 6304425 ?><5I5=85D09;0>B<5=5=> 9 6304457 ?><5I5=88 74 6304466 ?><5I5=89 4 6304540 ?><5I5=8N 56 6304544 ?><5I5=8O 195 6304600 ?><5I5==0O 5 6304795 ?><5I5==>3> 19 6304800 ?><5I5==>5 83 6304819 ?><5I5==>9 50 6304902 ?><5I5==><C 4 6304952 ?><5I5==K5 17 6304956 ?><5I5==K5D09;K 22 6304973 ?><5I5==K9 456 6304995 ?><5I5==KE 44 6305451 ?><5I5=> 218 6305495 ?><5I5=>2A53> 29 6305713 ?><5I5=K 62 6305742 ?><5I5=L5 4 6305804 ?><8<> 108 6305808 ?><=8BL 21 6305916 ?><>305B 19 6305937 ?><>30BL 26 6305956 ?><>30NB 3 6305982 ?><>30NI55 4 6305985 ?><>30NI89 8 6305989 ?><>3CB 5 6305997 ?><>4C;N 9 6306002 ?><>GL 5 6306011 ?><>I8 610 6306016 ?><>I=8: 18 6306626 ?><>I=8:0 8 6306644 ?><>IL 2651 6306652 ?><>ILN 2093 6309303 ?>=04>18BAO 8 6311396 ?>=04>18BLAO 8 6311404 ?>=545;L=8: 49 6311412 ?>=8<05BAO 25 6311461 ?>=8<0=85 16 6311486 ?>=8<0=88 3 6311502 ?>=8<0=8O 13 6311505 ?>=8<0BL 5 6311518 ?>=8<0BLAO 33 6311523 ?>=8<0NBAO 8 6311556 ?>=OB85 81 6311564 ?>=OB85< 4 6311645 ?>=OB89 5 6311649 ?>=OB8O 7 6311654 ?>=OB=K9 4 6311661 ?>=OBBO 4 6311665 ?>=OBL 4 6311669 ?>=OBL5 5 6311673 ?>>G5@54=> 10 6311678 ?>>G5@54=K9 10 6311688 ?>? 687 6311698 ?>?0 687 6312385 ?>?02H85 5 6313072 ?>?02H89 30 6313077 ?>?02H8E 25 6313107 ?>?0405B 40 6313132 ?>?040BL 108 6313172 ?>?040NB 43 6313280 ?>?040NI85 6 6313323 ?>?040NI89 29 6313329 ?>?040NI8< 15 6313358 ?>?040NI8E 8 6313373 ?>?04CB 33 6313381 ?>?0<OB8 9 6313414 ?>?0ABL 78 6313423 ?>?5@2>9AB@0=8F5A5@88 9 6313501 ?>?5@8>4C459AB28O 13 6313510 ?>?5@8>4C@538AB@0F88 13 6313523 ?>?>;=OBLAO 21 6313536 ?>?@02:0 4 6313557 ?>?@02:0<8 4 6313561 ?>?@>872>48B5;L=>AB8 9 6313565 ?>?KB05BAO 5 6313574 ?>?KB0BLAO 15 6313579 ?>?KB:0 1196 6313594 ?>?KB:0E 5 6314790 ?>?KB:5 350 6314795 ?>?KB:8 64 6315145 ?>?KB:>9 4 6315209 ?>?KB:C 54 6315213 ?>?KB>: 24 6315267 ?>@ 143 6315291 ?>@0 143 6315434 ?>@07<5@CH@8DB0 9 6315577 ?>@0A?>;>65=8N4>:C<5=B0 9 6315586 ?>@>2=C 4 6315595 ?>@>3 33 6315599 ?>@>3=5G5B:>AB8 9 6315632 ?>@>3>2>5 8 6315641 ?>@>3>2K9 8 6315649 ?>@>3>< 4 6315657 ?>@>482H53> 15 6315661 ?>@>482H89 40 6315676 ?>@>48BL 25 6315716 ?>@>6405B 6 6315741 ?>@>6405BAO 5 6315747 ?>@>640BL 6 6315752 ?>@>640BLAO 65 6315758 ?>@>640NI53> 5 6315823 ?>@>640NI89 5 6315828 ?>@>645=85 5 6315833 ?>@>645=8O 5 6315838 ?>@>E>2>9 5 6315843 ?>@>E>2K< 5 6315848 ?>@B 535 6315853 ?>@Bimap 9 6316388 ?>@Bpop3 21 6316397 ?>@Bsmtp 75 6316418 ?>@Bsmtp0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 6316493 ?>@B0 153 6316529 ?>@B0; 12 6316682 ?>@B0;0 4 6316694 ?>@B0;5 8 6316698 ?>@B0;@07@01>BG8:>2 14 6316706 ?>@B3;02=>3><5=5465@0 11 6316720 ?>@B>2 114 6316731 ?>@B@5B 18 6316845 ?>@B@5B=0O 12 6316863 ?>@B@5B=K9 12 6316875 ?>@BA5@25@0 11 6316887 ?>@BC 5 6316898 ?>@BC30;8O 12 6316903 ?>@BC30;LA:89 16 6316915 ?>@BK 114 6316931 ?>@F88 23 6317045 ?>@F89 4 6317068 ?>@F8>==>5 22 6317072 ?>@F8>==>< 4 6317094 ?>@F8>==K9 26 6317098 ?>@F8N 16 6317124 ?>@F8O 122 6317140 ?>@F8O<8 82 6317262 ?>@O4:0 473 6317344 ?>@O4:5 883 6317817 ?>@O4:>2 15 6318700 ?>@O4:>289 21 6318715 ?>@O4:>2>3> 17 6318736 ?>@O4:>2>5 21 6318753 ?>@O4:>2><C 4 6318774 ?>@O4:>2K5 8 6318778 ?>@O4:>2K9 183 6318786 ?>@O4:>2K< 18 6318969 ?>@O4:>2K<8 4 6318987 ?>@O4:>2KE 20 6318991 ?>@O4:>< 94 6319011 ?>@O4:C 99 6319105 ?>@O4>: 2831 6319204 ?>@O4>:0??@>:A8<0F88 9 6322035 ?>@O4>:109B>2 235 6322044 ?>@O4>:2KB5A=5=8O 6 6322279 ?>@O4>::=>?>: 15 6322285 ?>@O4>::=>?>::><0=4=>9?0=5;8 31 6322300 ?>@O4>::><?>=>2:840==KE 145 6322331 ?>@O4>::><?>=>2:840==KE=54>ABC?=K9 12 6322476 ?>@O4>:>1E>40 58 6322488 ?>@O4>:>B>1@065=8O 11 6322546 ?>@O4>:>B>1@065=8OB>G5:3>@87>=B0;L=>938AB>3@0<<K 58 6322557 ?>@O4>:A5@892;535=45 33 6322615 ?>@O4>:A5@892;535=454803@0<<K 47 6322648 ?>@V3 4 6322695 ?>A5I5==0OAAK;:0 9 6322699 ?>A5I5==K9 4 6322708 ?>A5I5==KE 4 6322712 ?>A8<2>;L=CN 9 6322716 ?>A8<2>;L=K9 9 6322725 ?>A:>;L:C 89 6322734 ?>A;0==K9 10 6322823 ?>A;0=> 10 6322833 ?>A;0B8 10 6322843 ?>A;0BL 65 6322853 ?>A;0BLsms 23 6322918 ?>A;5 4934 6322941 ?>A;522>4040BK 7 6327875 ?>A;522>407=0G5=8O 7 6327882 ?>A;522>40:>;8G5AB20 7 6327889 ?>A;522>40AB@>:8 7 6327896 ?>A;52>AAB0=>2;5=8O7=0G5=89 24 6327903 ?>A;52A5E?>;59 9 6327927 ?>A;52K1>@087<5=N 6 6327936 ?>A;52K1>@0M;5<5=B0 7 6327942 ?>A;540BK>B?@02;5=8O 10 6327949 ?>A;54=53> 341 6327959 ?>A;54=55 483 6328300 ?>A;54=557040=85 14 6328783 ?>A;54=59 135 6328797 ?>A;54=5< 24 6328932 ?>A;54=5<C 5 6328956 ?>A;54=85 244 6328961 ?>A;54=8574=59 9 6329205 ?>A;54=8525@A888AB>@8840==KE 6 6329214 ?>A;54=89 1204 6329220 ?>A;54=894>G5@=89 388 6330424 ?>A;54=8< 78 6330812 ?>A;54=8<8 4 6330890 ?>A;54=8E 78 6330894 ?>A;54=>3> 8 6330972 ?>A;54=NN 38 6330980 ?>A;54=OO 52 6331018 ?>A;54>20B5;L=> 64 6331070 ?>A;54>20B5;L=>3> 66 6331134 ?>A;54>20B5;L=>5 7 6331200 ?>A;54>20B5;L=>9 20 6331207 ?>A;54>20B5;L=>< 9 6331227 ?>A;54>20B5;L=><C 5 6331236 ?>A;54>20B5;L=>AB59 134 6331241 ?>A;54>20B5;L=>AB8 672 6331375 ?>A;54>20B5;L=>AB8<5=5465@ 30 6332047 ?>A;54>20B5;L=>ABL 1412 6332077 ?>A;54>20B5;L=>ABLxdto 73 6333489 ?>A;54>20B5;L=>ABL70?8AL 67 6333562 ?>A;54>20B5;L=>ABL<5=5465@ 71 6333629 ?>A;54>20B5;L=>ABL=01>@70?8A59 188 6333700 ?>A;54>20B5;L=>ABLN 27 6333888 ?>A;54>20B5;L=>ABO< 5 6333915 ?>A;54>20B5;L=>ABO<8 5 6333920 ?>A;54>20B5;L=K9 196 6333925 ?>A;54>20B5;L=K< 4 6334121 ?>A;54>20B5;L=KE 4 6334125 ?>A;54AB285 4 6334129 ?>A;54AB28O 4 6334133 ?>A;54CNI0O 11 6334137 ?>A;54CNI53> 50 6334148 ?>A;54CNI55 70 6334198 ?>A;54CNI59 98 6334268 ?>A;54CNI85 64 6334366 ?>A;54CNI89 858 6334430 ?>A;54CNI8< 20 6335288 ?>A;54CNI8<8 561 6335308 ?>A;54CNI8E 39 6335869 ?>A;54CNICN 5 6335908 ?>A;570:@KB8O2>?@>A0 7 6335913 ?>A;570?8A8 342 6335920 ?>A;570?8A8=0A5@25@5 126 6336262 ?>A;5>1<5=040==K<8A>A=>2=K<A5@25@>< 11 6336388 ?>A;5>B<5B:8M;5<5=B>2 6 6336399 ?>A;5?>4:;NG5=8O 38 6336405 ?>A;5B5:AB0 13 6336443 ?>A;5B5:CI59AB@>:8 18 6336456 ?>A;5C40;5=8O 24 6336474 ?>A;C68;0 4 6336498 ?>A;C68B8 9 6336502 ?>A;C68BL 9 6336511 ?>A<>B@5BL 14 6336520 ?>A<>B@8< 4 6336534 ?>A>45@68<><C 35 6336538 ?>A@54AB2> 1682 6336573 ?>A@54AB2>< 1682 6338255 ?>AB 75 6339937 ?>AB028B8 4 6340012 ?>AB02:0 6 6340016 ?>AB02:8 5 6340022 ?>AB02;5= 12 6340027 ?>AB02;5==0O 4 6340039 ?>AB02;5==K9 20 6340043 ?>AB02;5=> 4 6340063 ?>AB02I8: 253 6340067 ?>AB02I8:5 5 6340320 ?>AB02I8:8 30 6340325 ?>AB02I8:C 5 6340355 ?>AB5?5==> 6 6340360 ?>AB5?5==K9 6 6340366 ?>AB>@>==89 4 6340372 ?>AB>@>==8< 4 6340376 ?>AB>O==0O 30 6340380 ?>AB>O==> 24 6340410 ?>AB>O==>9 6 6340434 ?>AB>O==K5 4 6340440 ?>AB>O==K9 64 6340444 ?>AB>O==KE 18 6340508 ?>AB@0=8G=> 8 6340526 ?>AB@0=8G=K9 8 6340534 ?>AB@>5= 22 6340542 ?>AB@>5=0 32 6340564 ?>AB@>5=85 520 6340596 ?>AB@>5=85< 9 6341116 ?>AB@>5=88 52 6341125 ?>AB@>5=8O 436 6341177 ?>AB@>5==>3> 4 6341613 ?>AB@>5==>5 4 6341617 ?>AB@>5==>< 8 6341621 ?>AB@>5==K9 124 6341629 ?>AB@>5=> 8 6341753 ?>AB@>5=K 31 6341761 ?>AB@>8B5;5 18 6341792 ?>AB@>8B5;5< 8 6341810 ?>AB@>8B5;L 243 6341818 ?>AB@>8B5;Ldom 54 6342061 ?>AB@>8B5;L70?@>A0 112 6342115 ?>AB@>8B5;L>BG5B0 440 6342227 ?>AB@>8B5;L>BG5B00=0;87040==KE 83 6342667 ?>AB@>8B5;L>BG5B>2 33 6342750 ?>AB@>8B5;LAE5<xml 31 6342783 ?>AB@>8B5;N 4 6342814 ?>AB@>8B5;O 183 6342818 ?>AB@>8BL 56 6343001 ?>AB@>:0< 9 6343057 ?>ABC?;5=85B<F 6 6343066 ?>ABC?;5=85B>20@>2 5 6343072 ?>AG8B05< 6 6343077 ?>AG8B0= 70 6343083 ?>AG8B0=0 5 6343153 ?>AG8B0==K9 115 6343158 ?>AG8B0=K 40 6343273 ?>AG8B0BL 36 6343313 ?>AK;05< 10 6343349 ?>AK;05<K9 14 6343359 ?>AK;05<KE 4 6343373 ?>AK;05B 41 6343377 ?>AK;05BAO 12 6343418 ?>AK;0BL 51 6343430 ?>AK;0BLAO 12 6343481 ?>AK;:0 31 6343493 ?>AK;:5 15 6343524 ?>AK;:8 8 6343539 ?>B 71 6343547 ?>B5=F80;L=> 24 6343618 ?>B5=F80;L=K9 24 6343642 ?>B5@5 12 6343666 ?>B5@59 9 6343678 ?>B5@8 13 6343687 ?>B5@L 5 6343700 ?>B5@O 44 6343705 ?>B5@O2H89 5 6343749 ?>B5@O2H8E 5 6343754 ?>B5@O=0 36 6343759 ?>B5@O=K 4 6343795 ?>B5@OBL 5 6343799 ?>B>: 2395 6343804 ?>B>:0 789 6346199 ?>B>:2?0<OB8 654 6346988 ?>B>:40==KE 15 6347642 ?>B>:40==KE>1<5=0 6 6347657 ?>B>:5 219 6347663 ?>B>:>1<5=040==K<8 29 6347882 ?>B>:>2 31 6347911 ?>B>:>289 34 6347942 ?>B>:>2>3> 34 6347976 ?>B>:>2>5 4 6348010 ?>B>:>2>< 5 6348014 ?>B>:>2K9 43 6348019 ?>B>:>< 34 6348062 ?>B>:C 17 6348096 ?>B>< 67 6348113 ?>B><:0E 60 6348180 ?>B><:8 30 6348240 ?>B><:>2 168 6348270 ?>B><:>< 10 6348438 ?>B><:C 10 6348448 ?>B><>: 272 6348458 ?>B@0G5==0O 4 6348730 ?>B@0G5==K9 4 6348734 ?>B@51;5=85 224 6348738 ?>B@51;5=85?0<OB8 33 6348962 ?>B@51;5=85?0<OB82A53> 11 6348995 ?>B@51;5=85?0<OB8705<8= 11 6349006 ?>B@51;5=85?0<OB8B5:CI55 11 6349017 ?>B@51;5=88 5 6349028 ?>B@51;5=8O 214 6349033 ?>B@51>20;>AL 5 6349247 ?>B@51>20BL 395 6349252 ?>B@51>20BLA<5=C?0@>;O 9 6349647 ?>B@51>20BLAO 53 6349656 ?>B@51C5BAO 28 6349709 ?>BO=CBLA25@EC 18 6349737 ?>BO=CBLA25@EC8;8A=87C 9 6349755 ?>BO=CBLA=87C 9 6349764 ?>BV: 51 6349773 ?>C1K20=8N 9 6349824 ?>C1K20=8N85@0@E88 9 6349833 ?>C<>;G0=8N 64 6349842 ?>E>6 10 6349906 ?>E>65 4 6349916 ?>E>655 4 6349920 ?>E>689 18 6349924 ?>G5ABL 73 6349942 ?>G8=5==>3> 5 6350015 ?>G8=5==K9 5 6350020 ?>GB0 346 6350025 ?>GB5 12 6350371 ?>GB8 11 6350383 ?>GB8BL 73 6350394 ?>GB>2>3> 194 6350467 ?>GB>2>5 39 6350661 ?>GB>2>52;>65=85 39 6350700 ?>GB>2>5A>>1I5=85 82 6350739 ?>GB>2>9 4 6350821 ?>GB>2>< 30 6350825 ?>GB>2><C 30 6350855 ?>GB>2K5 9 6350885 ?>GB>2K504@5A0 48 6350894 ?>GB>2K52;>65=8O 45 6350942 ?>GB>2K9 400 6350987 ?>GB>2K904@5A 56 6351387 ?>GB>2K9?@>D8;L 5 6351443 ?>GB>2K< 28 6351448 ?>GB>2K<8 12 6351476 ?>GB>2KE 84 6351488 ?>GB>9 12 6351572 ?>GBC 62 6351584 ?>GBK 127 6351646 ?>H8@8=5 9 6351773 ?>H8@8=5AB@0=8FK 9 6351782 ?>MB><C 237 6351791 ?>O28;0AL 4 6352028 ?>O28;AO 4 6352032 ?>O28B8AO 23 6352036 ?>O28BAO 8 6352059 ?>O28BLAO 23 6352067 ?>O2;5=85 90 6352090 ?>O2;5=88 35 6352180 ?>O2;5=8N 5 6352215 ?>O2;5=8O 50 6352220 ?>O2;O5BAO 313 6352270 ?>O2;OBLAO 361 6352583 ?>O2;ONBAO 35 6352944 ?>O2;ONI89AO 10 6352979 ?>O2;ONI8EAO 10 6352989 ?>OA 168 6352999 ?>OA0 80 6353167 ?>OA5 56 6353247 ?>OA=5=85 269 6353303 ?>OA=5=85< 6 6353572 ?>OA=5=89 7 6353578 ?>OA=5=8O 13 6353585 ?>OA=5=L5 7 6353598 ?>OA=8B8 7 6353605 ?>OA=O5B 280 6353612 ?>OA=OBL 280 6353892 ?>OA=ONI0O 9 6354172 ?>OA=ONI89 26 6354181 ?>OA=ONI8<8 6 6354207 ?>OA=ONI8E 11 6354213 ?>OA>2 76 6354224 ?>OA>< 10 6354300 ?>OAC 5 6354310 ??4 10 6354315 ?@ 35 6354325 ?@02 419 6354360 ?@020 732 6354779 ?@020< 21 6355511 ?@020<8 215 6355532 ?@020O 21 6355747 ?@020O:>;>=:0 9 6355768 ?@0255 13 6355777 ?@0289 809 6355790 ?@028; 127 6356599 ?@028;0 249 6356726 ?@028;0< 127 6356975 ?@028;0<8 162 6357102 ?@028;0E 20 6357264 ?@028;> 1293 6357284 ?@028;>0AA>F80F88 43 6358577 ?@028;>< 5 6358620 ?@028;C 25 6358625 ?@028;L=89 14 6358650 ?@028;L=> 10 6358664 ?@028;L=>3> 14 6358674 ?@028;L=>5 4 6358688 ?@028;L=>9 20 6358692 ?@028;L=>< 20 6358712 ?@028;L=>AB8 27 6358732 ?@028;L=>ABL 40 6358759 ?@028;L=CN 4 6358799 ?@028;L=K5 13 6358803 ?@028;L=K9 109 6358816 ?@028;L=KE 20 6358925 ?@028B8 1287 6358945 ?@028BL 1003 6360232 ?@02:0 4 6361235 ?@02:>9 4 6361239 ?@02> 1804 6361243 ?@02>25@E 40 6363047 ?@02>3> 23 6363087 ?@02>4>ABC?0 23 6363110 ?@02>5 63 6363133 ?@02>52=5H=55 9 6363196 ?@02>57=0G5=85 20 6363205 ?@02>9 189 6363225 ?@02>< 112 6363414 ?@02><C 33 6363526 ?@02>=87 40 6363559 ?@02>?8A0=85 20 6363599 ?@02>?8A0=8O 20 6363619 ?@02>F5=B@ 9 6363639 ?@02C 5 6363648 ?@02C20B8 15 6363653 ?@02CN 15 6363668 ?@02K9 1926 6363683 ?@09A 6 6365609 ?@0:B8G5A:8 8 6365615 ?@0B8 443 6365623 ?@52KA8; 10 6366066 ?@52KA8;> 4 6366076 ?@52KA8B 10 6366080 ?@52KA8BL 24 6366090 ?@52KH05B 262 6366114 ?@52KH0BL 353 6366376 ?@52KH0NB 8 6366729 ?@52KH0NI0O 90 6366737 ?@52KH0NI55 5 6366827 ?@52KH0NI5< 16 6366832 ?@52KH0NI85 4 6366848 ?@52KH0NI89 123 6366852 ?@52KH0NI8<8 8 6366975 ?@52KH20BL 6 6366983 ?@52KH5= 4 6366989 ?@52KH5=85 171 6366993 ?@52KH5=88 90 6367164 ?@52KH5=8O 42 6367254 ?@52KH5=;8<8B>B?@02:8C254><;5=89 9 6367296 ?@52KH5==K9 12 6367305 ?@52KH5=> 8 6367317 ?@5420@8B5;L=0O 5 6367325 ?@5420@8B5;L=> 439 6367330 ?@5420@8B5;L=>3> 12 6367769 ?@5420@8B5;L=>< 4 6367781 ?@5420@8B5;L=CN 4 6367785 ?@5420@8B5;L=K9 465 6367789 ?@5420@8B5;L=K9?@>A<>B@ 13 6368254 ?@5420@O5BAO 17 6368267 ?@5420@OBLAO 29 6368284 ?@545; 488 6368313 ?@545;0<8 47 6368801 ?@545;0E 372 6368848 ?@545;>< 4 6369220 ?@545;K 48 6369224 ?@545;L=>5 78 6369272 ?@545;L=K9 86 6369350 ?@545;L=KE 8 6369436 ?@548:0B 5 6369444 ?@54:0 5 6369449 ?@54:>2 617 6369454 ?@54:>< 4 6370071 ?@54:C 4 6370075 ?@54;0305<K5 5 6370079 ?@54;0305<K9 5 6370084 ?@54;0305B 5 6370089 ?@54;0305BAO 20 6370094 ?@54;030BL 15 6370114 ?@54;030BLAO 25 6370129 ?@54;030O 10 6370154 ?@54;>65=85 207 6370164 ?@54;>65=88 109 6370371 ?@54;>65=89 10 6370480 ?@54;>65=8O 35 6370490 ?@54;>65=8OE 27 6370525 ?@54;>65==K9 49 6370552 ?@54;>65=> 49 6370601 ?@54;>65=L5 10 6370650 ?@54;>68BL 4 6370660 ?@54;>68BLA<5=C?0@>;O 9 6370664 ?@54;>6=K9 12 6370673 ?@54<5B 186 6370685 ?@54<5B0 73 6370871 ?@54<5B0<8 30 6370944 ?@54<5B>2 8 6370974 ?@54<5BC 11 6370982 ?@54=07=0G5= 1330 6370993 ?@54=07=0G5=0 267 6372323 ?@54=07=0G5==0O 31 6372590 ?@54=07=0G5==>3> 48 6372621 ?@54=07=0G5==>5 15 6372669 ?@54=07=0G5==>9 4 6372684 ?@54=07=0G5==CN 10 6372688 ?@54=07=0G5==K5 65 6372698 ?@54=07=0G5==K9 2304 6372763 ?@54=07=0G5==K< 4 6375067 ?@54=07=0G5==KE 13 6375071 ?@54=07=0G5=> 324 6375084 ?@54=07=0G5=K 94 6375408 ?@54=07=0G5=K5 5 6375502 ?@54=07=0G8BL 112 6375507 ?@54>: 637 6375619 ?@54>?@545;5==0O 70 6376256 ?@54>?@545;5==>3> 186 6376326 ?@54>?@545;5==>5 41 6376512 ?@54>?@545;5==>57=0G5=85 18 6376553 ?@54>?@545;5==>9 85 6376571 ?@54>?@545;5==CN 27 6376656 ?@54>?@545;5==K5 337 6376683 ?@54>?@545;5==K9 1525 6377020 ?@54>?@545;5==K9M;5<5=B 16 6378545 ?@54>?@545;5==K< 141 6378561 ?@54>?@545;5==KE 440 6378702 ?@54>?@545;8BL 543 6379142 ?@54>AB0282H53> 14 6379685 ?@54>AB0282H89 14 6379699 ?@54>AB028;0 5 6379713 ?@54>AB028BL 26 6379718 ?@54>AB02;5= 16 6379744 ?@54>AB02;5=85 18 6379760 ?@54>AB02;5=88 4 6379778 ?@54>AB02;5=8O 14 6379782 ?@54>AB02;5==>3> 4 6379796 ?@54>AB02;5==K9 29 6379800 ?@54>AB02;5==K<8 9 6379829 ?@54>AB02;O5<0O 9 6379838 ?@54>AB02;O5<><C 10 6379847 ?@54>AB02;O5<K5 10 6379857 ?@54>AB02;O5<K9 52 6379867 ?@54>AB02;O5<K< 4 6379919 ?@54>AB02;O5<KE 19 6379923 ?@54>AB02;O5B 1656 6379942 ?@54>AB02;O5BAO 65 6381598 ?@54>AB02;OBL 1693 6381663 ?@54>AB02;OBLAO 84 6383356 ?@54>AB02;ONB 9 6383440 ?@54>AB02;ONBAO 10 6383449 ?@54>AB02;ONI55 15 6383459 ?@54>AB02;ONI85 73 6383474 ?@54>AB02;ONI89 97 6383547 ?@54>AB02;ONI8E 4 6383644 ?@54>B2@0B8BL 15 6383648 ?@54>B2@0I5=85 12 6383663 ?@54>B2@0I5=8O 12 6383675 ?@54?>;0305<>5 15 6383687 ?@54?>;0305<K9 19 6383702 ?@54?>;0305B 28 6383721 ?@54?>;0305BAO 93 6383749 ?@54?>;030;0 4 6383842 ?@54?>;030BL 42 6383846 ?@54?>;030BLAO 93 6383888 ?@54?>;>65=85 5 6383981 ?@54?>;>68< 6 6383986 ?@54?>;>68BL 6 6383992 ?@54?>A;54=89 7 6383998 ?@54?>A;54=OO 7 6384005 ?@54?>AK;:0 14 6384012 ?@54?>AK;:C 4 6384026 ?@54?>GB8B5;L=>3> 4 6384030 ?@54?>GB8B5;L=>8A?>;L7>20BL@01>G89?5@8>4 6 6384034 ?@54?>GB8B5;L=K9 25 6384040 ?@54?@8=8<05B 5 6384065 ?@54?@8=8<05BAO 4 6384070 ?@54?@8=8<0BL 9 6384074 ?@54?@8=8<0BLAO 86 6384083 ?@54?@8=OB> 12 6384169 ?@54?@8=OBK9 12 6384181 ?@54?@8OB85 1229 6384193 ?@54?@8OB85< 36 6385422 ?@54?@8OB88 19 6385458 ?@54?@8OB8N 23 6385477 ?@54?@8OB8O 863 6385500 ?@54?@>A<>B@0 5 6386363 ?@54?@>A<>B@C 4 6386368 ?@54AB0282 4 6386372 ?@54AB028B8 208 6386376 ?@54AB028B8AO 4 6386584 ?@54AB028BL 24 6386588 ?@54AB02;5= 82 6386612 ?@54AB02;5=0 78 6386694 ?@54AB02;5=85 4241 6386772 ?@54AB02;5=850:CAB8:8 15 6391013 ?@54AB02;5=851C;52>8AB8=0 54 6391028 ?@54AB02;5=851C;52>;>6L 54 6391082 ?@54AB02;5=8520@80=B0 9 6391136 ?@54AB02;5=852@5<5=8 10 6391145 ?@54AB02;5=852K@065=8O45B0;L=KE70?8A59 6 6391155 ?@54AB02;5=852K@065=8O8B>3>2KE70?8A59 6 6391161 ?@54AB02;5=853@0<<0B8:8 15 6391167 ?@54AB02;5=8540==KE 47 6391182 ?@54AB02;5=8540BK 10 6391229 ?@54AB02;5=8570?8A8 27 6391239 ?@54AB02;5=857=0G5=8O 8 6391266 ?@54AB02;5=85:;85=BA:>3>?@8;>65=8O 5 6391274 ?@54AB02;5=85:>40;>:0;870F88 24 6391279 ?@54AB02;5=85< 133 6391303 ?@54AB02;5=85<5B040==KE 8 6391436 ?@54AB02;5=85=02830F8>==>9AAK;:8 152 6391444 ?@54AB02;5=85>1J5:B0 90 6391596 ?@54AB02;5=85>B@8F0B5;L=KEG8A5; 54 6391686 ?@54AB02;5=85>H81:84;O?>;L7>20B5;O 10 6391740 ?@54AB02;5=85?5@8>40 17 6391750 ?@54AB02;5=85?>4?8A8 25 6391767 ?@54AB02;5=85?>;L7>20B5;LA:8E=0AB@>5: 9 6391792 ?@54AB02;5=85?>;L7>20B5;LA:>9=0AB@>9:8 187 6391801 ?@54AB02;5=85?@020 11 6391988 ?@54AB02;5=85?@8;>65=8O 19 6391999 ?@54AB02;5=85@0745;5=8O40==KEA50=A0 8 6392018 ?@54AB02;5=85A>1KB8O 8 6392026 ?@54AB02;5=85A>1KB8O6C@=0;0@538AB@0F88 11 6392034 ?@54AB02;5=85A?8A:0 162 6392045 ?@54AB02;5=85AAK;:8 18 6392207 ?@54AB02;5=85B5:CI53>20@80=B0 13 6392225 ?@54AB02;5=85B5:CI8E?>;L7>20B5;LA:8E=0AB@>5: 17 6392238 ?@54AB02;5=85F5=B@0;8F5=78@>20=8O 10 6392255 ?@54AB02;5=85G0A>2>3>?>OA0 16 6392265 ?@54AB02;5=85H01;>=0 10 6392281 ?@54AB02;5=88 67 6392291 ?@54AB02;5=89 103 6392358 ?@54AB02;5=8N 102 6392461 ?@54AB02;5=8O 1102 6392563 ?@54AB02;5=8O< 28 6393665 ?@54AB02;5=8O<8 8 6393693 ?@54AB02;5=8O?>4AB0=>2>: 19 6393701 ?@54AB02;5=8O?>;594>?>;=8B5;L=KE40==KE 9 6393720 ?@54AB02;5=8OE 10 6393729 ?@54AB02;5==>9 8 6393739 ?@54AB02;5==K5 15 6393747 ?@54AB02;5==K9 374 6393762 ?@54AB02;5==KE 20 6394136 ?@54AB02;5=> 37 6394156 ?@54AB02;5=K 137 6394193 ?@54AB02;5=L5 103 6394330 ?@54AB02;O5<>3> 6 6394433 ?@54AB02;O5<K9 6 6394439 ?@54AB02;O5B 1419 6394445 ?@54AB02;O5BAO 115 6395864 ?@54AB02;OBL 1591 6395979 ?@54AB02;OBLAO 128 6397570 ?@54AB02;ONB 77 6397698 ?@54AB02;ONBAO 9 6397775 ?@54AB02;ONI0O 33 6397784 ?@54AB02;ONI53> 33 6397817 ?@54AB02;ONI85 13 6397850 ?@54AB02;ONI89 460 6397863 ?@54AB02;ONI8<8 5 6398323 ?@54AB02;ONI8E 283 6398328 ?@54AB02;ONICN 24 6398611 ?@54C?@5640BL=8652KA>:>3> 9 6398635 ?@54C?@5640BL=865A@54=53> 13 6398644 ?@54C?@5640BL>1>?0A=KE459AB28OE 9 6398657 ?@54C?@5645=85 664 6398666 ?@54C?@5645=850A8=E 11 6399330 ?@54C?@5645=85< 4 6399341 ?@54C?@5645=85?@8@540:B8@>20=88 9 6399345 ?@54C?@5645=89 57 6399354 ?@54C?@5645=8O 179 6399411 ?@54C?@5645=8O< 4 6399590 ?@54C?@5645=L5 57 6399594 ?@54CA<0B@8205B 11 6399651 ?@54CA<0B@820BL 11 6399662 ?@54CA<0B@820NI89 4 6399673 ?@54CA<0B@820NI8E 4 6399677 ?@54CA<>B@5= 27 6399681 ?@54CA<>B@5=0 428 6399708 ?@54CA<>B@5==K5 10 6400136 ?@54CA<>B@5==K9 519 6400146 ?@54CA<>B@5==KE 3 6400665 ?@54CA<>B@5=> 42 6400668 ?@54CA<>B@5=K 9 6400710 ?@54H5AB2>20BL 37 6400719 ?@54H5AB2C5B 10 6400756 ?@54H5AB2CNI89 6 6400766 ?@54H5AB2CNI8E 6 6400772 ?@54JO2;O5<K9 293 6400778 ?@54JO2;O5<K< 293 6401071 ?@54K4CI0O 33 6401364 ?@54K4CI0OG0ABL 18 6401397 ?@54K4CI53> 76 6401415 ?@54K4CI55 149 6401491 ?@54K4CI59 56 6401640 ?@54K4CI5< 19 6401696 ?@54K4CI5<C 31 6401715 ?@54K4CI85 14 6401746 ?@54K4CI89 1147 6401760 ?@54K4CI89A>A54=89 388 6402907 ?@54K4CI89C75; 20 6403295 ?@54K4CI8< 5 6403315 ?@54K4CI8E 34 6403320 ?@54K4CICN 34 6403354 ?@5645 5 6403388 ?@56=53> 556 6403393 ?@56=85 238 6403949 ?@56=89 797 6404187 ?@575=B0F88 4 6404984 ?@575=B0F8O 4 6404988 ?@58<CI5AB20 5 6404992 ?@58<CI5AB25==>3> 5 6404997 ?@58<CI5AB25==K9 5 6405002 ?@58<CI5AB2> 5 6405007 ?@5:@0B8BL@01>BCA8AB5<K 11 6405012 ?@5:@0I05< 16 6405023 ?@5:@0I05<K9 16 6405039 ?@5:@0I05B 25 6405055 ?@5:@0I05BAO 74 6405080 ?@5:@0I0BL 41 6405154 ?@5:@0I0BLAO 74 6405195 ?@5:@0I5= 4 6405269 ?@5:@0I5=85 25 6405273 ?@5:@0I5=85< 6 6405298 ?@5:@0I5=8N 10 6405304 ?@5:@0I5=8O 9 6405314 ?@5:@0I5==K9 4 6405323 ?@5>1@072>0=> 5 6405327 ?@5>1@07>20= 54 6405332 ?@5>1@07>20=0 21 6405386 ?@5>1@07>20=85 449 6405407 ?@5>1@07>20=85xsl 70 6405856 ?@5>1@07>20=85::0=>=8G5A:><Cxml 34 6405926 ?@5>1@07>20=85< 17 6405960 ?@5>1@07>20=88 35 6405977 ?@5>1@07>20=89 4 6406012 ?@5>1@07>20=8N 24 6406016 ?@5>1@07>20=8O 246 6406040 ?@5>1@07>20==0O 10 6406286 ?@5>1@07>20==>5 4 6406296 ?@5>1@07>20==CN 15 6406300 ?@5>1@07>20==K9 209 6406315 ?@5>1@07>20=> 63 6406524 ?@5>1@07>20=K 26 6406587 ?@5>1@07>20=L5 4 6406613 ?@5>1@07>20BL 364 6406617 ?@5>1@07>20BL2:><?0:B=K94>:C<5=B 18 6406981 ?@5>1@07>20BL2>BB5=:8A5@>3> 34 6406999 ?@5>1@07>20BL2>BB5=:8A5@>3>0A8=E 24 6407033 ?@5>1@07>20BL87AB@>:8 16 6407057 ?@5>1@07>20BL87C7;0 10 6407073 ?@5>1@07>20BL87D09;0 11 6407083 ?@5>1@07>20BLAO 118 6407094 ?@5>1@07>2K205B 15 6407212 ?@5>1@07>2K205BAO 6 6407227 ?@5>1@07>2K20BL 15 6407233 ?@5>1@07>2K20BL7=0G5=8O 14 6407248 ?@5>1@07>2K20BLAO 23 6407262 ?@5>1@07>2K20NBAO 22 6407285 ?@5>1@07C5<0O 5 6407307 ?@5>1@07C5<>5 10 6407312 ?@5>1@07C5<K9 19 6407322 ?@5>1@07C5B 274 6407341 ?@5>1@07C5BAO 86 6407615 ?@5>1@07CNBAO 40 6407701 ?@5>4>;5==K9 5 6407741 ?@5>4>;5==K< 5 6407746 ?@5>?@545;5==CN 5 6407751 ?@5>?@545;5==K9 5 6407756 ?@5?@>F5AA>@ 51 6407761 ?@5?@>F5AA>@0 50 6407812 ?@5?@>F5AA>@C 5 6407862 ?@5?OBAB2>20BL 5 6407867 ?@5?OBAB2C5B 5 6407872 ?@5?OBAB2CNI85 6 6407877 ?@5?OBAB2CNI89 11 6407883 ?@5?OBAB2CNI8E 5 6407894 ?@5@20= 10 6407899 ?@5@20==K9 58 6407909 ?@5@20=> 43 6407967 ?@5@20=K 5 6408010 ?@5@20BL 129 6408015 ?@5@20BL70?8AL 35 6408144 ?@5@20BL70?8AL6C@=0;0459AB289?>;L7>20B5;O 10 6408179 ?@5@20BL?>2B>@8BL?@>?CAB8BL 9 6408189 ?@5@20BLB5:CI89A5@25@=K92K7>2 21 6408198 ?@5@20BLGB5=85 38 6408219 ?@5@25B 5 6408257 ?@5@K205B 51 6408262 ?@5@K205BAO 51 6408313 ?@5@K20=85 106 6408364 ?@5@K20=85< 4 6408470 ?@5@K20=88 13 6408474 ?@5@K20=8N 55 6408487 ?@5@K20=8O 25 6408542 ?@5@K20BL 111 6408567 ?@5@K20BLAO 51 6408678 ?@5@K28AB>5 8 6408729 ?@5@K28ABK9 19 6408737 ?@5@K28ABK9=0:;>==K9 14 6408756 ?@5BL 9 6408770 ?@5D5:BC@0 4 6408779 ?@5D8:A 1470 6408783 ?@5D8:A1 13 6410253 ?@5D8:A2 14 6410266 ?@5D8:A0 255 6410280 ?@5D8:A0B@81CB0 30 6410535 ?@5D8:A81 10 6410565 ?@5D8:A8<5= 10 6410575 ?@5D8:A8<5=8 9 6410585 ?@5D8:A:>40 18 6410594 ?@5D8:A=><5@0 18 6410612 ?@5D8:A>2 29 6410630 ?@5D8:A>< 16 6410659 ?@5D8:AAE5<K4;OAE5<Kxml 11 6410675 ?@5D8:AC 82 6410686 ?@5D8:AK 29 6410768 ?@5D8:AK4;O2:;NG5=8O 15 6410797 ?@8 21629 6410812 ?@802B><0B8G5A:><A>740=88=>2>3>C7;0 12 6432441 ?@80:B82870F88 78 6432453 ?@80:B82870F8840BK 22 6432531 ?@80:B82870F887=0G5=8O 20 6432553 ?@80:B82870F888=B5@20;0 20 6432573 ?@80:B82870F88:>;>=:8 24 6432593 ?@80:B82870F88>1;0AB8 12 6432617 ?@80:B82870F88?>;O 24 6432629 ?@80:B82870F88AB@>:8 51 6432653 ?@80:B82870F88OG59:8 39 6432704 ?@80:B82=>AB8 27 6432743 ?@81028B8AO 41 6432770 ?@8102;5=85 10 6432811 ?@8102;5=85< 5 6432821 ?@8102;5=8O 5 6432826 ?@8102;O5BAO 5 6432831 ?@8102;OBLAO 46 6432836 ?@820B=K5 4 6432882 ?@820B=K9 12 6432886 ?@820B=K< 4 6432898 ?@82545< 3 6432902 ?@82545= 70 6432905 ?@82545=0 14 6432975 ?@82545=85 66 6432989 ?@82545=88 5 6433055 ?@82545=89 14 6433060 ?@82545=8O 31 6433074 ?@82545==0O 7 6433105 ?@82545==>< 14 6433112 ?@82545==CN 5 6433126 ?@82545==K5 3 6433131 ?@82545==K9 141 6433134 ?@82545=> 5 6433275 ?@82545=K 17 6433280 ?@82545B 160 6433297 ?@8254Q==>5 4 6433457 ?@825;0 9 6433461 ?@825;> 14 6433470 ?@825AB8 483 6433484 ?@825AB87=0G5=85 12 6433967 ?@825B 19 6433979 ?@828;538@>20==>3> 99 6433998 ?@828;538@>20==>< 69 6434097 ?@828;538@>20==><C 5 6434166 ?@828;538@>20==K9 230 6434171 ?@828;538@>20==K9@568< 17 6434401 ?@828;538@>20==K9@568<?@8>B<5=5?@>2545=8O 9 6434418 ?@828;538@>20==K9@568<?@8?>;CG5=88 9 6434427 ?@828;538@>20==K9@568<?@8?@>2545=88 9 6434436 ?@828;538@>20==K9@568<?@8A>740=887040G 9 6434445 ?@828;538@>20==K< 5 6434454 ?@828;538@>20==KE 5 6434459 ?@82>48B 860 6434464 ?@82>48B8 71 6435324 ?@82>48B8AO 4 6435395 ?@82>48BAO 38 6435399 ?@82>48BL 985 6435437 ?@82>48BLAO 91 6436422 ?@82>4OB 54 6436513 ?@82>4OBAO 52 6436567 ?@82>4OI55 4 6436619 ?@82>4OI89 4 6436623 ?@82AB02:5871CD5@0>1<5=0 22 6436627 ?@82K1>@5459AB28O@57C;LB0B03;>10;L=>3>?>8A:0 20 6436649 ?@82K1>@5459AB28OA>>1I5=8OA8AB5<K2708<>459AB28O 23 6436669 ?@82K1>@5@57C;LB0B03;>10;L=>3>?>8A:0 15 6436692 ?@82K2>45?5@8>40 37 6436707 ?@82K2>45AB@>:8 28 6436744 ?@82K45;5=88=5A:>;L:8EOG55: 9 6436772 ?@82K45;5=88=5A:>;L:8EOG55:?@80:B82=>AB8 9 6436781 ?@82K?>;=5=88 43 6436790 ?@82O70= 45 6436833 ?@82O70=0 31 6436878 ?@82O70==>9 18 6436909 ?@82O70==K5 5 6436927 ?@82O70==K9 130 6436932 ?@82O70=> 15 6437062 ?@82O70=K 16 6437077 ?@82O7:0 90 6437093 ?@82O7:0<8 4 6437183 ?@82O7:5 26 6437187 ?@82O7:8 21 6437213 ?@82O7:>9 12 6437234 ?@82O7:C 10 6437246 ?@82O7>: 10 6437256 ?@82O7K205BAO 5 6437266 ?@82O7K20BLAO 5 6437271 ?@82Q; 5 6437276 ?@83;0A8BL 5 6437281 ?@83;0H5=85 33 6437286 ?@83;0H5=8O 21 6437319 ?@83;>10;L=><?>8A:5 15 6437340 ?@83>4=K5 15 6437355 ?@83>4=K9 15 6437370 ?@83>B>28B8 12 6437385 ?@83>B>28BL 12 6437397 ?@845B 4 6437409 ?@845BAO 5 6437413 ?@84>102;5=882>1AC645=85A8AB5<K2708<>459AB28O 10 6437418 ?@84B8 4 6437428 ?@84B8AL 5 6437432 ?@85< 45 6437437 ?@85<0 16 6437482 ?@85<5 8 6437498 ?@85<;5< 5 6437506 ?@85<;5<K9 5 6437511 ?@85<;N 5 6437516 ?@85<=0@01>BC 4 6437521 ?@85<=8: 268 6437525 ?@85<=8:0 102 6437793 ?@85<=8:40==KE 5 6437895 ?@85<=8:5 127 6437900 ?@85<>2 3 6438027 ?@85<K 4 6438030 ?@860B 20 6438034 ?@860B0 5 6438054 ?@860B89 5 6438059 ?@860BK9 25 6438064 ?@868<05BAO 44 6438089 ?@868<0BLAO 67 6438133 ?@868<0NBAO 10 6438200 ?@87025@H5=88 12 6438210 ?@87025@H5=88@01>BKA8AB5<K 40 6438222 ?@8703@C7:520@80=B0=0A5@25@5 10 6438262 ?@8703@C7:540==KE87=0AB@>5:=0A5@25@5 17 6438272 ?@8703@C7:5?>;L7>20B5;LA:8E=0AB@>5:=0A5@25@5 25 6438289 ?@870: 10 6438314 ?@870:@KB88 40 6438324 ?@870:@KB88A>548=5=8O 10 6438364 ?@870:@KB88D>@<K 5 6438374 ?@870?8A8 528 6438379 ?@870?8A84>:C<5=B0 12 6438907 ?@870?8A8=0A5@25@5 131 6438919 ?@870?8A8?5@5?@>2>48BL 20 6439050 ?@870AK?0=88:;85=BA:>3>?@8;>65=8O 11 6439070 ?@87=020BL 5 6439081 ?@87=020BLAO 5 6439086 ?@87=05B 5 6439091 ?@87=05BAO 5 6439096 ?@87=0: 7596 6439101 ?@87=0:0 7500 6446697 ?@87=0:0< 4 6454197 ?@87=0:8 29 6454201 ?@87=0:8CG5B0 9 6454230 ?@87=0:8CG5B0AC1:>=B> 9 6454239 ?@87=0:>2 42 6454248 ?@87=0:>< 83 6454290 ?@87=0:C 9 6454373 ?@87=0:CG5B0 23 6454382 ?@87=0:CG5B0?;0=0AG5B>2 365 6454405 ?@87=0:CG5B0AC1:>=B> 13 6454770 ?@87=0:CG5B0AC1:>=B>?;0=0AG5B>2 361 6454783 ?@87=0= 4 6455144 ?@87=0=0 4 6455148 ?@87=0=85 5 6455152 ?@87=0=8O 5 6455157 ?@87=0==K5 5 6455162 ?@87=0==K9 9 6455167 ?@87=0=> 12 6455176 ?@87=0B8 12 6455188 ?@87=0BL 5 6455200 ?@87=0BLAO 5 6455205 ?@87=:0: 4 6455210 ?@87@0G=> 5 6455214 ?@87@0G=>15;K9 12 6455219 ?@87@0G=K9 5 6455231 ?@887<5=5=88 127 6455236 ?@887<5=5=8840==KE 96 6455363 ?@887<5=5=884>:C<5=B0 7 6455459 ?@887<5=5=884>ABC?=>AB8>A=>2=>3>A5@25@0 22 6455466 ?@887<5=5=887=0G5=8O 9 6455488 ?@887<5=5=88?0@0<5B@>2M:@0=0 30 6455497 ?@887<5=5=88A>45@68<>3>>1;0AB8 22 6455527 ?@887<5=5=88D;06:0 25 6455549 ?@89B8 4 6455574 ?@89B8AL 5 6455578 ?@8:07 12 6455583 ?@8:;04=89 102 6455595 ?@8:;04=>3> 87 6455697 ?@8:;04=>5 4 6455784 ?@8:;04=>9 343 6455788 ?@8:;04=>< 11 6456131 ?@8:;04=><C 15 6456142 ?@8:;04=CN 5 6456157 ?@8:;04=K5 10 6456162 ?@8:;04=K9 343 6456172 ?@8:;04=K< 26 6456515 ?@8:;04=KE 108 6456541 ?@8:><?>=>2:5@57C;LB0B0 24 6456649 ?@8:>?8@>20=88 138 6456673 ?@8:@5?8BL 13 6456811 ?@8:@5?8BLAO 4 6456824 ?@8:@5?;5=85 4 6456828 ?@8:@5?;5=8O 4 6456832 ?@8:@5?;5==>5 14 6456836 ?@8:@5?;5==>< 5 6456850 ?@8:@5?;5==K9 19 6456855 ?@8:@5?;O5<>5 8 6456874 ?@8:@5?;O5<K5 18 6456882 ?@8:@5?;O5<K540==K5 20 6456900 ?@8:@5?;O5<K540==K570?CA:0?@8;>65=8O<>18;L=>3>CAB@>9AB20 65 6456920 ?@8:@5?;O5<K9 87 6456985 ?@8:@5?;O5<KE 71 6457072 ?@8:@5?;O5<KE40==KE 6 6457143 ?@8:@5?;OBL 20 6457149 ?@8;>65=85 48312 6457169 ?@8;>65=85< 124 6505481 ?@8;>65=85A8AB5<K2708<>459AB28O 23 6505605 ?@8;>65=88 275 6505628 ?@8;>65=89 231 6505903 ?@8;>65=8N 39 6506134 ?@8;>65=8O 3807 6506173 ?@8;>65=8O< 9 6509980 ?@8;>65=8O<8 44 6509989 ?@8;>65=8OE 13 6510033 ?@8;>65==K5 4 6510046 ?@8;>65==K9 4 6510050 ?@8;>65=L5 231 6510054 ?@8;>68B8 4 6510285 ?@8;>68BL 4 6510289 ?@8<5=5=0 30 6510293 ?@8<5=5=85 470 6510323 ?@8<5=5=85< 16 6510793 ?@8<5=5=85@568<0>B>1@065=8O?@8CAB0=>2:5@57C;LB0B0 9 6510809 ?@8<5=5=85@568<0>B>1@065=8O?@8CAB0=>2:5@57C;LB0B0>BG5B0 24 6510818 ?@8<5=5=88 50 6510842 ?@8<5=5=89 36 6510892 ?@8<5=5=8N 4 6510928 ?@8<5=5=8O 277 6510932 ?@8<5=5==K5 4 6511209 ?@8<5=5==K9 97 6511213 ?@8<5=5==K< 10 6511310 ?@8<5=5=> 32 6511320 ?@8<5=5=K 24 6511352 ?@8<5=5=L5 36 6511376 ?@8<5=8< 154 6511412 ?@8<5=8<0 52 6511566 ?@8<5=8<> 425 6511618 ?@8<5=8<>AB8 8 6512043 ?@8<5=8<>ABL 13 6512051 ?@8<5=8<K 32 6512064 ?@8<5=8<K5 112 6512096 ?@8<5=8<K9 772 6512208 ?@8<5=8B5;L=> 9 6512980 ?@8<5=8BL 186 6512989 ?@8<5=8BL=0AB@>9:8 32 6513175 ?@8<5=8BL=0AB@>9:8A5@28A>2 12 6513207 ?@8<5=O5<0O 4 6513219 ?@8<5=O5<>3> 49 6513223 ?@8<5=O5<>5 25 6513272 ?@8<5=O5<K5 44 6513297 ?@8<5=O5<K5=0AB@>9:8 17 6513341 ?@8<5=O5<K9 191 6513358 ?@8<5=O5<KE 10 6513549 ?@8<5=O5B 20 6513559 ?@8<5=O5BAO 664 6513579 ?@8<5=OBL 167 6514243 ?@8<5=OBLAO 818 6514410 ?@8<5=ONBAO 53 6515228 ?@8<5@ 8317 6515281 ?@8<5@1 12 6523598 ?@8<5@2 6 6523610 ?@8<5@0 281 6523616 ?@8<5@0<8 11 6523897 ?@8<5@0E 3 6523908 ?@8<5@5 355 6523911 ?@8<5@5BL 8032 6524266 ?@8<5@>2 14 6532298 ?@8<5@>< 33 6532312 ?@8<5@K 146 6532345 ?@8<5B 4 6532491 ?@8<5B0 4 6532495 ?@8<5G0=85 15849 6532499 ?@8<5G0=89 9 6548348 ?@8<5G0=8O 15 6548357 ?@8<5G0=L5 9 6548372 ?@8<8B82=>3> 87 6548381 ?@8<8B82=>5 4 6548468 ?@8<8B82=><C 5 6548472 ?@8<8B82=K5 9 6548477 ?@8<8B82=K9 159 6548486 ?@8<8B82=KE 53 6548645 ?@8=04;560B 33 6548698 ?@8=04;560BL 835 6548731 ?@8=04;560I53> 10 6549566 ?@8=04;560I55 10 6549576 ?@8=04;560I59 10 6549586 ?@8=04;560I5<C 5 6549596 ?@8=04;560I85 165 6549601 ?@8=04;560I89 311 6549766 ?@8=04;560I8< 40 6550077 ?@8=04;560I8E 61 6550117 ?@8=04;560ICN 10 6550178 ?@8=04;568B 787 6550188 ?@8=04;568BM;5<5=BC 78 6550975 ?@8=04;56=>AB8 31 6551053 ?@8=04;56=>ABL 71 6551084 ?@8=04;56=>ABL>1J5:B0 783 6551155 ?@8=04;56=>ABL?>A;54>20B5;L=>ABO< 22 6551938 ?@8=060B88 16 6551960 ?@8=060B88enter 9 6551976 ?@8=060B88:=>?:8?0=5;8:=>?>:A>>1I5=8OA8AB5<K2708<>459AB28O 20 6551985 ?@8=0G0;5@01>BKA8AB5<K 55 6552005 ?@8=0G0;5@540:B8@>20=8O 33 6552060 ?@8=54>ABC?=>AB8=0AB@>5: 15 6552093 ?@8=8<05<>3> 8 6552108 ?@8=8<05<>5 16 6552116 ?@8=8<05<>< 5 6552132 ?@8=8<05<K9 29 6552137 ?@8=8<05B 178 6552166 ?@8=8<05BAO 28 6552344 ?@8=8<0BL 430 6552372 ?@8=8<0BLAO 28 6552802 ?@8=8<0NB 6 6552830 ?@8=8<0NI89 9 6552836 ?@8=8<0NI8<8 9 6552845 ?@8=B5@ 105 6552854 ?@8=B5@0 77 6552959 ?@8=B5@5 15 6553036 ?@8=B5@>2 4 6553051 ?@8=B5@>< 4 6553055 ?@8=B5@K 4 6553059 ?@8=C48;L=> 4 6553063 ?@8=C48B5;L=0O 4 6553067 ?@8=C48B5;L=> 90 6553071 ?@8=C48B5;L=>3> 45 6553161 ?@8=C48B5;L=>5 67 6553206 ?@8=C48B5;L=>57025@H5=85 9 6553273 ?@8=C48B5;L=>57025@H5=85@01>BK 13 6553282 ?@8=C48B5;L=>7025@H0BL?@>1;5<=K5?@>F5AAK 6 6553295 ?@8=C48B5;L=>9 5 6553301 ?@8=C48B5;L=>< 5 6553306 ?@8=C48B5;L=K9 172 6553311 ?@8=F8? 184 6553483 ?@8=F8?0; 10 6553667 ?@8=F8?0< 10 6553677 ?@8=F8?80;L=> 6 6553687 ?@8=F8?80;L=>9 5 6553693 ?@8=F8?80;L=K9 11 6553698 ?@8=F8?>2 6 6553709 ?@8=O; 4 6553715 ?@8=OB 15 6553719 ?@8=OB85 38 6553734 ?@8=OB85< 4 6553772 ?@8=OB8O 5 6553776 ?@8=OB> 13 6553781 ?@8=OB>3> 46 6553794 ?@8=OB>< 4 6553840 ?@8=OBCN 15 6553844 ?@8=OBK 4 6553859 ?@8=OBK9 144 6553863 ?@8=OBK< 5 6554007 ?@8=OBKE 9 6554012 ?@8=OBL 92 6554021 ?@8=OBLB@51>20=8O=07=0G5=8O 12 6554113 ?@8>1=>2;5=88A>AB020?>;L7>20B5;LA:8E=0AB@>5:=0A5@25@5 30 6554125 ?@8>1@5AB8 8 6554155 ?@8>1@5AB80A8=E 14 6554163 ?@8>1@5B05<0O 9 6554177 ?@8>1@5B05<K9 9 6554186 ?@8>1@5B0;0AL 12 6554195 ?@8>1@5B0BLAO 12 6554207 ?@8>1@5B5=0 31 6554219 ?@8>1@5B5=85 38 6554250 ?@8>1@5B5=88 4 6554288 ?@8>1@5B5=89 4 6554292 ?@8>1@5B5=8O 17 6554296 ?@8>1@5B5==0O 4 6554313 ?@8>1@5B5==K5 4 6554317 ?@8>1@5B5==K9 44 6554321 ?@8>1@5B5==KE 8 6554365 ?@8>1@5B5=L5 4 6554373 ?@8>1@5B5B 4 6554377 ?@8>6840=88 11 6554381 ?@8>:>=G0=88@540:B8@>20=8O 34 6554392 ?@8>:>=G0=88@540:B8@>20=8O8=B5@20;0 29 6554426 ?@8>@8B5B 217 6554455 ?@8>@8B5B0 30 6554672 ?@8>@8B5B=K9 4 6554702 ?@8>@8B5B>< 5 6554706 ?@8>@8B5BC 10 6554711 ?@8>@8B5BF25B0 79 6554721 ?@8>@8B5BK 6 6554800 ?@8>AB0=02;8205B 15 6554806 ?@8>AB0=02;8205BAO 5 6554821 ?@8>AB0=02;820BL 15 6554826 ?@8>AB0=02;820BLAO 5 6554841 ?@8>AB0=>28BL 5 6554846 ?@8>AB0=>28BL70?8AL6C@=0;0459AB289?>;L7>20B5;O 10 6554851 ?@8>AB0=>2:0 46 6554861 ?@8>AB0=>2:8 36 6554907 ?@8>AB0=>2;5=0 5 6554943 ?@8>AB0=>2;5==K9 17 6554948 ?@8>AB0=>2;5=> 12 6554965 ?@8>B:@KB85 63 6554977 ?@8>B:@KB88 63 6555040 ?@8>B:@KB88A>548=5=8O 10 6555103 ?@8>B?@02:540==KE3;02=><C 17 6555113 ?@8>B?@02:540==KE?>4G8=5==><C 18 6555130 ?@8>B?@02:540==KEC7;0?>4G8=5==><C 14 6555148 ?@8>H81:5 10 6555162 ?@8?5@5>B:@KB88A4@C3>3>A5@25@0 11 6555172 ?@8?>2B>@=><>B:@KB88 24 6555183 ?@8?>;CG5=8840==KE 23 6555207 ?@8?>;CG5=8840==KE=0A5@25@5 14 6555230 ?@8?>;CG5=8840==KE>B3;02=>3> 22 6555244 ?@8?>;CG5=8840==KE>B?>4G8=5==>3> 22 6555266 ?@8?>;CG5=8840==KEC7;0>B3;02=>3> 14 6555288 ?@8?>;CG5=88A>>1I5=8O 10 6555302 ?@8?@52KH5=88=5A68<0BL 9 6555312 ?@8?@52KH5=88A68<0BL4><8=8<C<0 13 6555321 ?@8?@>1C645=88:;85=BA:>3>?@8;>65=8O 11 6555334 ?@8@0I5=85 6 6555345 ?@8@0I5=8O 6 6555351 ?@8@540:B8@>20=887=0G5=8O 15 6555357 ?@8A208205<>5 5 6555372 ?@8A208205<>9 10 6555377 ?@8A208205<K9 15 6555387 ?@8A208205BAO 678 6555402 ?@8A20820=85 87 6556080 ?@8A20820=8O 20 6556167 ?@8A20820BL 24 6556187 ?@8A20820BLAO 761 6556211 ?@8A20820NBAO 48 6556972 ?@8A2>5= 26 6557020 ?@8A2>5=85 88 6557046 ?@8A2>5=85< 5 6557134 ?@8A2>5=88 24 6557139 ?@8A2>5=8O 40 6557163 ?@8A2>5==K9 150 6557203 ?@8A2>5=> 42 6557353 ?@8A2>5=K 82 6557395 ?@8A2>8B 12 6557477 ?@8A2>8BL 126 6557489 ?@8A:0 4 6557615 ?@8A<5=5AB@0=8FK 26 6557619 ?@8A<5=5B5:CI53>?5@8>40>B>1@065=8O 10 6557645 ?@8A<5=5B5:CI53>@>48B5;O 24 6557655 ?@8A>548=5=0 56 6557679 ?@8A>548=5=85 14 6557735 ?@8A>548=5=85:3@C??5?>4AB0=>2:8 11 6557749 ?@8A>548=5=8O 8 6557760 ?@8A>548=5==0O 18 6557768 ?@8A>548=5==>9 41 6557786 ?@8A>548=5==CN 20 6557827 ?@8A>548=5==K9 185 6557847 ?@8A>548=5==KE 50 6558032 ?@8A>548=8BL 44 6558082 ?@8A>548=O5<0O 5 6558126 ?@8A>548=O5<>3> 6 6558131 ?@8A>548=O5<K9 11 6558137 ?@8A>548=O5B 5 6558148 ?@8A>548=O5BAO 12 6558153 ?@8A>548=OBL 5 6558165 ?@8A>548=OBLAO 22 6558170 ?@8A>548=ONBAO 4 6558192 ?@8A>548=Q==K<8 4 6558196 ?@8A>740=882;>65==KE187=5A?@>F5AA>2 12 6558200 ?@8A>740=887040G 23 6558212 ?@8A>740=88=0A5@25@5 544 6558235 ?@8A>740=88>1AC645=8OA8AB5<K2708<>459AB28O 10 6558779 ?@8A>E@0=5=8820@80=B0=0A5@25@5 10 6558789 ?@8A>E@0=5=8840==KE2=0AB@>9:0E=0A5@25@5 17 6558799 ?@8A>E@0=5=88?>;L7>20B5;LA:8E=0AB@>5:=0A5@25@5 25 6558816 ?@8A?>A>1;5=0 4 6558841 ?@8A?>A>1;5=85 32 6558845 ?@8A?>A>1;5=8O 32 6558877 ?@8A?>A>1;5==K9 4 6558909 ?@8ABC?0BL 5 6558913 ?@8ACBA82CNI89 5 6558918 ?@8ACBAB285 10 6558923 ?@8ACBAB2>20;0 3 6558933 ?@8ACBAB2>20;8 7 6558936 ?@8ACBAB2>20BL 1035 6558943 ?@8ACBAB2C5B 839 6559978 ?@8ACBAB2CNB 47 6560817 ?@8ACBAB2CNI55 12 6560864 ?@8ACBAB2CNI85 53 6560876 ?@8ACBAB2CNI89 70 6560929 ?@8ACBAB2CNI8< 6 6560999 ?@8ACBAB2CNI8E 38 6561005 ?@8ACI85 15 6561043 ?@8ACI89 15 6561058 ?@8B5=5==K< 225 6561073 ?@8B5=5==K<8 5 6561298 ?@8B5=5=> 5 6561303 ?@8C40;5=8887>1AC645=8OA8AB5<K2708<>459AB28O 10 6561308 ?@8CAB0=>2:5=>2>3>:>40 38 6561318 ?@8CAB0=>2:5=>2>3>=><5@0 52 6561356 ?@8E>4 84 6561408 ?@8E>45 5 6561492 ?@8E>48B 20 6561497 ?@8E>48BL 20 6561517 ?@8E>4=0O=0:;04=0O 20 6561537 ?@8E>4=K5 12 6561557 ?@8E>4=K9 12 6561569 ?@8G5< 53 6561581 ?@8G8= 4 6561634 ?@8G8=0 1015 6561638 ?@8G8=0< 17 6562653 ?@8G8=0>B:;NG5=8O 9 6562670 ?@8G8=0>B:;NG5=8O:>?88107K40==KE 29 6562679 ?@8G8=5 67 6562708 ?@8G8=>9 33 6562775 ?@8G8=C 24 6562808 ?@8G8=K 838 6562832 ?@8GB5=88=0A5@25@5 122 6563670 ?@8H54H85 13 6563792 ?@8H54H89 13 6563805 ?@8OBL 4 6563818 ?@8Q<=8:0 20 6563822 ?@> 31 6563842 ?@>0=0;878@>20= 4 6563873 ?@>0=0;878@>20=0 6 6563877 ?@>0=0;878@>20==K9 10 6563883 ?@>15; 428 6563893 ?@>15;0 20 6564321 ?@>15;0<8 62 6564341 ?@>15;>2 79 6564403 ?@>15;>< 5 6564482 ?@>15;K 66 6564487 ?@>15;K2>@>=:8 10 6564553 ?@>15;L=K5 69 6564563 ?@>15;L=K5A8<2>;K 92 6564632 ?@>15;L=K5A8<2>;Kxml 39 6564724 ?@>15;L=K9 347 6564763 ?@>15;L=K< 7 6565110 ?@>15;L=K<8 16 6565117 ?@>15;L=KE 294 6565133 ?@>1;5< 33 6565427 ?@>1;5<0 102 6565460 ?@>1;5<0< 6 6565562 ?@>1;5<0E 9 6565568 ?@>1;5<5 8 6565577 ?@>1;5<=K5 5 6565585 ?@>1;5<=K9 26 6565590 ?@>1;5<=K< 15 6565616 ?@>1;5<=K<8 5 6565631 ?@>1;5<=KE 16 6565636 ?@>1;5<C 14 6565652 ?@>1;5<K 20 6565666 ?@>1>20BL 3 6565686 ?@>20945@ 288 6565689 ?@>20945@0 164 6565977 ?@>20945@0<8 4 6566141 ?@>20945@0E 4 6566145 ?@>20945@5 58 6566149 ?@>20945@>2 19 6566207 ?@>20945@>< 8 6566226 ?@>20945@C 21 6566234 ?@>20945@K 4 6566255 ?@>2545= 92 6566259 ?@>2545=85 461 6566351 ?@>2545=85< 10 6566812 ?@>2545=85?>?0@B8O< 9 6566822 ?@>2545=88 92 6566831 ?@>2545=8O 255 6566923 ?@>2545==>3> 16 6567178 ?@>2545==>AB8 31 6567194 ?@>2545==K9 109 6567225 ?@>25@5= 12 6567334 ?@>25@5==K9 12 6567346 ?@>25@5=K 4 6567358 ?@>25@8< 95 6567362 ?@>25@8BL 303 6567457 ?@>25@8BL0A8=E 14 6567760 ?@>25@8BL18B 11 6567774 ?@>25@8BL2>7<>6=>ABL4>102;5=8O>BA;568205<KE@538>=>2 10 6567785 ?@>25@8BL2>7<>6=>ABL?@8<5=5=8O 10 6567795 ?@>25@8BL2>7<>6=>ABL?@8<5=5=8O2A5E 10 6567805 ?@>25@8BL2K2>4 19 6567815 ?@>25@8BL2K?>;=5=85 27 6567834 ?@>25@8BL70?>;=5=85 421 6567861 ?@>25@8BL8=45:A 10 6568282 ?@>25@8BL:28B0=F8N2AB@>5==>9?>:C?:8 15 6568292 ?@>25@8BL:28B0=F8N2AB@>5==>9?>:C?:8=0<>18;L=><CAB@>9AB25 10 6568307 ?@>25@8BL<5B:C2@5<5=8 13 6568317 ?@>25@8BL<5B:C2@5<5=80A8=E 10 6568330 ?@>25@8BL=0;8G8540==KE2?>4?8A8 10 6568340 ?@>25@8BL=0;8G8540==KE2?>4?8A80A8=E 14 6568350 ?@>25@8BL?>18B>2>9<0A:5 13 6568364 ?@>25@8BL?>4:;NG5=852=5H=59:><?>=5=BK 11 6568377 ?@>25@8BL?>4?8A8 29 6568388 ?@>25@8BL?>4?8A80A8=E 29 6568417 ?@>25@8BL?>4?8AL 50 6568446 ?@>25@8BL?>4?8AL0A8=E 46 6568496 ?@>25@8BL?>4B25@645=85 10 6568542 ?@>25@8BL?>@0A?>;>65=8N 14 6568552 ?@>25@8BL?@8>1@5B5=85 14 6568566 ?@>25@8BL?@8A>548=5=85 20 6568580 ?@>25@8BL@0A:@KB85?0@>;O 15 6568600 ?@>25@8BLA2>9AB20B>20@0 6 6568615 ?@>25@8BLA5@B8D8:0B 18 6568621 ?@>25@8BLA5@B8D8:0B0A8=E 19 6568639 ?@>25@8BLA>>B25BAB285?0@>;O?>;8B8:5 14 6568658 ?@>25@8BLA>>B25BAB285?0@>;O?>;L7>20B5;OA>E@0=O5<><C7=0G5=8N 11 6568672 ?@>25@8BLAB@>:C 23 6568683 ?@>25@8BLACI5AB2>20=85:0B0;>30 4 6568706 ?@>25@8BLF8:;8G5A:85AAK;:82AB@>5==>3>O7K:0 13 6568710 ?@>25@:0 2495 6568723 ?@>25@:02AB@>5==KE?>:C?>: 10 6571218 ?@>25@:048=0<8G5A:>3>>1=>2;5=8O 6 6571228 ?@>25@:070?>;=5=8O 161 6571234 ?@>25@:0:0G5AB20 9 6571395 ?@>25@:0:0G5AB20A:0=8@>20=8O4>:C<5=B>2 34 6571404 ?@>25@:0>B>1@065=8O=>2>9AB@>:8 209 6571438 ?@>25@:0?5@5B0A:820=8O 136 6571647 ?@>25@:0?5@5B0A:820=8O2=CB@8 10 6571783 ?@>25@:0?@02>?8A0=8O?@822>45B5:AB0 29 6571793 ?@>25@:0@0A:@KB8O?0@>;59 9 6571822 ?@>25@:0@0A:@KB8O?0@>;59?>;L7>20B5;59 6 6571831 ?@>25@:0A;>6=>AB8?0@>;59 63 6571837 ?@>25@:0A;>6=>AB8?0@>;59?>;L7>20B5;59 36 6571900 ?@>25@:0AC<<K 7 6571936 ?@>25@:0CA;>28O 13 6571943 ?@>25@:5 145 6571956 ?@>25@:8 1162 6572101 ?@>25@:>9 23 6573263 ?@>25@:C 534 6573286 ?@>25@>: 9 6573820 ?@>25@>G=K5 10 6573829 ?@>25@>G=K9 20 6573839 ?@>25@>G=KE 10 6573859 ?@>25@O5< 79 6573869 ?@>25@O5<0O 28 6573948 ?@>25@O5<>3> 15 6573976 ?@>25@O5<>5 9 6573991 ?@>25@O5<>9 5 6574000 ?@>25@O5<K5@5:2878BK 226 6574005 ?@>25@O5<K9 257 6574231 ?@>25@O5<K9B8? 7 6574488 ?@>25@O5<KE 131 6574495 ?@>25@O5B 815 6574626 ?@>25@O5BAO 411 6575441 ?@>25@OBL 972 6575852 ?@>25@OBL2>7<>6=>ABL8A?>;L7>20=8O<>18;L=>3>:;85=B0 9 6576824 ?@>25@OBL4>?>;=8B5;L=K50B@81CBK 21 6576833 ?@>25@OBL4>ABC?=>ABL 15 6576854 ?@>25@OBL4>ABC?=>ABL?>;59 12 6576869 ?@>25@OBL70?>;=5=8502B><0B8G5A:8 13 6576881 ?@>25@OBLA;54CNI85 5 6576894 ?@>25@OBLAB@C:BC@C 13 6576899 ?@>25@OBLACI5AB2>20=85D09;0 9 6576912 ?@>25@OBLAO 465 6576921 ?@>25@OBLB>G=>5A>>B25BAB285?>4?8A8:>=D83C@0F88 9 6577386 ?@>25@ONBAO 45 6577395 ?@>25@ONI0O 4 6577440 ?@>25@ONI59 4 6577444 ?@>25@ONI89 9 6577448 ?@>25@OO 4 6577457 ?@>25AB8 95 6577461 ?@>28=F8O 8 6577556 ?@>2>48B8AO 43 6577564 ?@>2>48BAO 40 6577607 ?@>2>48BLAO 79 6577647 ?@>2>4:0 112 6577726 ?@>2>4:5 8 6577838 ?@>2>4:8 22 6577846 ?@>2>4=8: 4 6577868 ?@>2>4=8:0 4 6577872 ?@>2>4>: 112 6577876 ?@>2>4OBAO 5 6577988 ?@>2>4OI53> 4 6577993 ?@>2>4OI89 4 6577997 ?@>2>;>G=0O 4 6578001 ?@>2>;>G=K9 4 6578005 ?@>3=>7 181 6578009 ?@>3=>70 154 6578190 ?@>3=>78@C5<0O 32 6578344 ?@>3=>78@C5<>3> 8 6578376 ?@>3=>78@C5<>5 16 6578384 ?@>3=>78@C5<>9 8 6578400 ?@>3=>78@C5<K5 5 6578408 ?@>3=>78@C5<K9 71 6578413 ?@>3=>78@C5<KE 8 6578484 ?@>3=>78@CNI0O 4 6578492 ?@>3=>78@CNI85 6 6578496 ?@>3=>78@CNI89 10 6578502 ?@>3=>7K 4 6578512 ?@>3@0<< 6 6578516 ?@>3@0<<0 354 6578522 ?@>3@0<<0< 6 6578876 ?@>3@0<<0<8 16 6578882 ?@>3@0<<5 29 6578898 ?@>3@0<<8@>20=85 12 6578927 ?@>3@0<<8@>20=8O 12 6578939 ?@>3@0<<=0O 24 6578951 ?@>3@0<<=0O;8F5=78O 11 6578975 ?@>3@0<<=> 291 6578986 ?@>3@0<<=>3> 84 6579277 ?@>3@0<<=>5 25 6579361 ?@>3@0<<=>9 116 6579386 ?@>3@0<<=>< 56 6579502 ?@>3@0<<=><C 3 6579558 ?@>3@0<<=CN 10 6579561 ?@>3@0<<=K5 9 6579571 ?@>3@0<<=K9 407 6579580 ?@>3@0<<=K< 8 6579987 ?@>3@0<<=KE 66 6579995 ?@>3@0<<>9 44 6580061 ?@>3@0<<K 217 6580105 ?@>3@5AA 83 6580322 ?@>3@5AA0 6 6580405 ?@>3@5AA82=>3> 30 6580411 ?@>3@5AA82=>5 37 6580441 ?@>3@5AA82=>5251?@8;>65=85 10 6580478 ?@>3@5AA82=><C 8 6580488 ?@>3@5AA82=K9 60 6580496 ?@>40205<K5 5 6580556 ?@>40205<K9 5 6580561 ?@>406 17 6580566 ?@>4060 156 6580583 ?@>4065 6 6580739 ?@>4068 127 6580745 ?@>4068?>@538>=0< 15 6580872 ?@>40;8 5 6580887 ?@>40B8 5 6580892 ?@>40BL 5 6580897 ?@>42865=85 5 6580902 ?@>42865=8N 5 6580907 ?@>4;5=85 8 6580912 ?@>4;5=89 4 6580920 ?@>4;5=8O 4 6580924 ?@>4;5=L5 4 6580928 ?@>4>;605B 25 6580932 ?@>4>;605BAO 32 6580957 ?@>4>;60BL 120 6580989 ?@>4>;60BLAO 35 6581109 ?@>4>;60NI0OAO 5 6581144 ?@>4>;60NI89AO 5 6581149 ?@>4>;65= 17 6581154 ?@>4>;65=0 5 6581171 ?@>4>;65=85 187 6581176 ?@>4>;65=85< 18 6581363 ?@>4>;65=8O 123 6581381 ?@>4>;65==K9 41 6581504 ?@>4>;65=> 19 6581545 ?@>4>;68< 4 6581564 ?@>4>;68B5;L=>5 10 6581568 ?@>4>;68B5;L=>ABL 22 6581578 ?@>4>;68B5;L=K9 10 6581600 ?@>4>;68BL 98 6581610 ?@>4>;68BL2K7>2 20 6581708 ?@>4>;68BL70?8AL6C@=0;0459AB289?>;L7>20B5;O 10 6581728 ?@>4>;68BL@0A?>7=020=85 4 6581738 ?@>4C:B 22 6581742 ?@>4C:B0 4 6581764 ?@>4C:B0< 6 6581768 ?@>4C:B0<8 6 6581774 ?@>4C:B>2 14 6581780 ?@>4C:BK 10 6581794 ?@>4C:F8O 6 6581804 ?@>4CBK 4 6581810 ?@>4CBK9 4 6581814 ?@>5:B 21 6581818 ?@>5:B0 16 6581839 ?@>5:B5 4 6581855 ?@>5:B>< 4 6581859 ?@>5:F89 8 6581863 ?@>5:F8O 20 6581871 ?@>728I5 15 6581891 ?@>7@0G=>3> 9 6581906 ?@>7@0G=>9 5 6581915 ?@>7@0G=>AB8 187 6581920 ?@>7@0G=>ABL 233 6582107 ?@>7@0G=>ABLN 22 6582340 ?@>7@0G=K5 9 6582362 ?@>7@0G=K9 247 6582371 ?@>7@0G=K9D>= 569 6582618 ?@>7@0G=K9D>=>1;0AB59?>;59 13 6583187 ?@>7@0G=K9D>=?>4?8A59 22 6583200 ?@>83=>@8@>20= 12 6583222 ?@>83=>@8@>20==K9 65 6583234 ?@>83=>@8@>20==KE 5 6583299 ?@>83=>@8@>20=> 48 6583304 ?@>83=>@8@>20=K 5 6583352 ?@>83=>@8@>20BL 13 6583357 ?@>872545= 121 6583370 ?@>872545=0 207 6583491 ?@>872545==>3> 8 6583698 ?@>872545==K9 564 6583706 ?@>872545=> 221 6584270 ?@>872545=K 13 6584491 ?@>872545B 61 6584504 ?@>8725; 5 6584565 ?@>8725AB8 83 6584570 ?@>872>48;0AL 27 6584653 ?@>872>48;8AL 8 6584680 ?@>872>48;>AL 39 6584688 ?@>872>48;AO 10 6584727 ?@>872>48< 11 6584737 ?@>872>48<>3> 16 6584748 ?@>872>48<>5 12 6584764 ?@>872>48<>9 3 6584776 ?@>872>48<K9 42 6584779 ?@>872>48B 487 6584821 ?@>872>48B5;L=>AB8 111 6585308 ?@>872>48B5;L=>ABL 170 6585419 ?@>872>48B5;L=>ABLN 10 6585589 ?@>872>48BAO 1404 6585599 ?@>872>48BL 575 6587003 ?@>872>48BLAO 2736 6587578 ?@>872>4=0O 9 6590314 ?@>872>4=K9 9 6590323 ?@>872>4=K< 4 6590332 ?@>872>4=KE 5 6590336 ?@>872>4AB25==K9:0;5=40@L 5 6590341 ?@>872>4AB2> 4 6590346 ?@>872>4OB 9 6590350 ?@>872>4OBAO 31 6590359 ?@>872>;L= 23 6590390 ?@>872>;L=0O 327 6590413 ?@>872>;L=0O40B0 15 6590740 ?@>872>;L=>3> 116 6590755 ?@>872>;L=>5 66 6590871 ?@>872>;L=>52K@065=85 12 6590937 ?@>872>;L=>9 67 6590949 ?@>872>;L=>< 22 6591016 ?@>872>;L=><C 4 6591038 ?@>872>;L=CN 26 6591042 ?@>872>;L=K5 56 6591068 ?@>872>;L=K9 5261 6591124 ?@>872>;L=K970?@>A 13 6596385 ?@>872>;L=K98=B5@20; 9 6596398 ?@>872>;L=K9?5@8>4 26 6596407 ?@>872>;L=K9B5:AB 18 6596433 ?@>872>;L=K9B8?B5:AB0 9 6596451 ?@>872>;L=K9C3>;=0:;>=0 17 6596460 ?@>872>;L=K< 27 6596477 ?@>872>;L=KE 405 6596504 ?@>87=5AB8 8 6596909 ?@>87=>H5=85 17 6596917 ?@>87=>H5=858<5=8 14 6596934 ?@>87=>H5=85>BG5AB20 14 6596948 ?@>87=>H5=85D0<8;88 14 6596962 ?@>87=>H5=8O 5 6596976 ?@>87>945B 89 6596981 ?@>87>94CB 10 6597070 ?@>87>9B8 272 6597080 ?@>87>H54H85 10 6597352 ?@>87>H54H89 10 6597362 ?@>87>H;0 124 6597372 ?@>87>H;8 15 6597496 ?@>87>H;> 38 6597511 ?@>8;;NAB@8@>20BL 6 6597549 ?@>8;;NAB@8@C5< 6 6597555 ?@>8=45:A8@>20==K9 12 6597561 ?@>8=45:A8@>20==KE 8 6597573 ?@>8=45:A8@>20=K 4 6597581 ?@>8=8F80;878@>20= 8 6597585 ?@>8=8F80;878@>20==>AB8 40 6597593 ?@>8=8F80;878@>20==K9 16 6597633 ?@>8=8F80;878@>20==KE 8 6597649 ?@>8=D>@<8@>20BL 4 6597657 ?@>8AE>48;> 4 6597661 ?@>8AE>48B 1073 6597665 ?@>8AE>48BL 1116 6598738 ?@>8AE>4B 6 6599854 ?@>8AE>645=85 4 6599860 ?@>8AE>645=8O 4 6599864 ?@>8AH54H85 5 6599868 ?@>8AH54H89 5 6599873 ?@>8B5@8@>20=K 16 6599878 ?@>945==K5 5 6599894 ?@>945==K9 5 6599899 ?@>945B 15 6599904 ?@>9B8 88 6599919 ?@>:@CB:0 338 6600007 ?@>:@CB:5 49 6600345 ?@>:@CB:8 205 6600394 ?@>:@CB:>9 12 6600599 ?@>:@CB:C 8 6600611 ?@>:@CG8205<K9 38 6600619 ?@>:@CG8205<KE 38 6600657 ?@>:@CG820=85 5 6600695 ?@>:A8 191 6600700 ?@>:A8?>C<>;G0=8N 6 6600891 ?@>:A8A5@25@ 16 6600897 ?@>;8ABK20=85 9 6600913 ?@><56CB>: 11 6600922 ?@><56CB>G=>3> 9 6600933 ?@><56CB>G=K5 40 6600942 ?@><56CB>G=K9 55 6600982 ?@><56CB>G=KE 8 6601037 ?@><AB@>910=: 62 6601045 ?@>>1@07 4 6601107 ?@>>1@070<8 4 6601111 ?@>?8A 15 6601115 ?@>?8A0= 4 6601130 ?@>?8A0==K9 4 6601134 ?@>?8A8 15 6601138 ?@>?8A=0O 5 6601153 ?@>?8A=>9 9 6601158 ?@>?8A=K5 4 6601167 ?@>?8AK205BAO 5 6601171 ?@>?8AK20BLAO 5 6601176 ?@>?8AL 38 6601181 ?@>?8ALG8A;0 6 6601219 ?@>?8ALN 30 6601225 ?@>?>@F88 4 6601255 ?@>?>@F89 5 6601259 ?@>?>@F8>=0;L=> 73 6601264 ?@>?>@F8>=0;L=>3> 8 6601337 ?@>?>@F8>=0;L=>5 10 6601345 ?@>?>@F8>=0;L=>9 5 6601355 ?@>?>@F8>=0;L=K 4 6601360 ?@>?>@F8>=0;L=K9 92 6601364 ?@>?>@F8O 9 6601456 ?@>?CA: 72 6601465 ?@>?CA:0 16 6601537 ?@>?CA:05< 6 6601553 ?@>?CA:05<K9 6 6601559 ?@>?CA:05B 42 6601565 ?@>?CA:05BAO 15 6601607 ?@>?CA:0BL 88 6601622 ?@>?CA:0BL107>2>57=0G5=85 33 6601710 ?@>?CA:0BL?@822>45 58 6601743 ?@>?CA:0BLAO 51 6601801 ?@>?CA:0NBAO 35 6601852 ?@>?CA:0O 4 6601887 ?@>?CAB8B8 154 6601891 ?@>?CAB8BL 139 6602045 ?@>?CAB8BL0A8=E 18 6602184 ?@>?CAB8BL4> 28 6602202 ?@>?CAB8BL4>0A8=E 24 6602230 ?@>?CI5= 23 6602254 ?@>?CI5=0 16 6602277 ?@>?CI5==K5 12 6602293 ?@>?CI5==K9 151 6602305 ?@>?CI5==KE 43 6602456 ?@>?CI5=> 30 6602499 ?@>?CI5=K 12 6602529 ?@>@8A>20==K9 4 6602541 ?@>@8A>20==KE 4 6602545 ?@>A83=0;878@>20BL 4 6602549 ?@>A83=0;878@C5B 4 6602553 ?@>A:;>=OBL 12 6602557 ?@>A;CH820=85 4 6602569 ?@>A;CH820=8O 4 6602573 ?@>A<0B@8205<>3> 4 6602577 ?@>A<0B@8205<K9 4 6602581 ?@>A<0B@8205BAO 20 6602585 ?@>A<0B@820BLAO 20 6602605 ?@>A<>B@ 724 6602625 ?@>A<>B@0 419 6603349 ?@>A<>B@3@C??8M;5<5=B>2 27 6603768 ?@>A<>B@5 216 6603795 ?@>A<>B@8AB>@8840==KE 6 6604011 ?@>A<>B@>< 10 6604017 ?@>A<>B@?>2;045;LFC 12 6604027 ?@>A?5:B 4 6604039 ?@>A@>G5=0 7 6604043 ?@>A@>G5==K9 7 6604050 ?@>AB02;5==K9 4 6604057 ?@>AB02;5=K 4 6604061 ?@>AB02;O5BAO 12 6604065 ?@>AB02;OBLAO 12 6604077 ?@>AB0O 15 6604089 ?@>AB59H55 29 6604104 ?@>AB59H5< 29 6604133 ?@>AB59H89 29 6604162 ?@>AB89 138 6604191 ?@>AB> 302 6604329 ?@>AB>3> 123 6604631 ?@>AB>5 5 6604754 ?@>AB>9 564 6604759 ?@>AB>9B5:AB 18 6605323 ?@>AB>OBL 55 6605341 ?@>AB@0=AB2 145 6605396 ?@>AB@0=AB20 1197 6605541 ?@>AB@0=AB20< 18 6606738 ?@>AB@0=AB20<8 13 6606756 ?@>AB@0=AB25 2062 6606769 ?@>AB@0=AB2> 3560 6608831 ?@>AB@0=AB2>1;>:8@>2:8 6 6612391 ?@>AB@0=AB2>8<5= 56 6612397 ?@>AB@0=AB2>8<5=xpath 828 6612453 ?@>AB@0=AB2>8<5=?>C<>;G0=8N 139 6613281 ?@>AB@0=AB2>< 68 6613420 ?@>AB@0=AB2C 78 6613488 ?@>ABK5 15 6613566 ?@>ABKE 49 6613581 ?@>AC<<8@>20BL 11 6613630 ?@>B5AB8@>20BL 4 6613641 ?@>B82 9 6613645 ?@>B82=>< 2605 6613654 ?@>B82=K9 2605 6616259 ?@>B82>?>;>65= 8 6618864 ?@>B82>?>;>65==K9 8 6618872 ?@>B82>?>;>6=> 44 6618880 ?@>B82>?>;>6=>3> 5 6618924 ?@>B82>?>;>6=>5 9 6618929 ?@>B82>?>;>6=>9 10 6618938 ?@>B82>?>;>6=>< 4 6618948 ?@>B82>?>;>6=K9 75 6618952 ?@>B82>@5G0B 5 6619027 ?@>B82>@5G82> 5 6619032 ?@>B82>@5G82K9 5 6619037 ?@>B82>@5G8BL 5 6619042 ?@>B>:>; 404 6619047 ?@>B>:>;0 171 6619451 ?@>B>:>;0< 4 6619622 ?@>B>:>;8=B5@=5B?>GBK 28 6619626 ?@>B>:>;>2 16 6619654 ?@>B>:>;>< 18 6619670 ?@>B>:>;>B?@02:8?>GBK 5 6619688 ?@>B>:>;?>;CG5=8O?>GBK 5 6619693 ?@>B>:>;C 141 6619698 ?@>B>:>;K 12 6619839 ?@>BO65=85 9 6619851 ?@>BO65=88 9 6619860 ?@>BO65==K5 8 6619869 ?@>BO65==K9 8 6619877 ?@>D8;5 28 6619885 ?@>D8;59 11 6619913 ?@>D8;5< 85 6619924 ?@>D8;L 809 6620009 ?@>D8;L157>?0A=>3>@568<0 47 6620818 ?@>D8;L157>?0A=>AB8 173 6620865 ?@>D8;L157>?0A=>AB8157>?0A=>3>@568<0 47 6621038 ?@>D8;N 5 6621085 ?@>D8;O 492 6621090 ?@>E>4 22 6621582 ?@>E>40 5 6621604 ?@>E>45 13 6621609 ?@>E>48B 9 6621622 ?@>E>48B8 4 6621631 ?@>E>48BL 13 6621635 ?@>E>4OI0O 4 6621648 ?@>E>4OI53> 4 6621652 ?@>E>4OI89 8 6621656 ?@>F 5 6621664 ?@>F1 10 6621669 ?@>F54C@ 195 6621679 ?@>F54C@0 4909 6621874 ?@>F54C@01 6 6626783 ?@>F54C@0< 28 6626789 ?@>F54C@0<8 6 6626817 ?@>F54C@0E 14 6626823 ?@>F54C@5 292 6626837 ?@>F54C@>9 38 6627129 ?@>F54C@C 223 6627167 ?@>F54C@K 3812 6627390 ?@>F5=B 367 6631202 ?@>F5=B0 18 6631569 ?@>F5=B0E 99 6631587 ?@>F5=B23@C??5 5 6631686 ?@>F5=B23@C??52:>;>=:58;8B>G:5 6 6631691 ?@>F5=B23@C??52AB@>:58;8A5@88 6 6631697 ?@>F5=B285@0@E88 5 6631703 ?@>F5=B285@0@E882:>;>=:58;8B>G:5 6 6631708 ?@>F5=B285@0@E882AB@>:58;8A5@88 6 6631714 ?@>F5=B2:>;>=:58;8B>G:5 6 6631720 ?@>F5=B2AB@>:58;8A5@88 5 6631726 ?@>F5=B2K2>40 11 6631731 ?@>F5=B70?8A59 70 6631742 ?@>F5=B=>5 5 6631812 ?@>F5=B=>< 9 6631817 ?@>F5=B=K9 14 6631826 ?@>F5=B>1@01>B:8 9 6631840 ?@>F5=B>1I89 5 6631849 ?@>F5=B>2 29 6631854 ?@>F5=B>< 10 6631883 ?@>F5=B?>;C?@>7@0G=>AB8 28 6631893 ?@>F5=B?>;C?@>7@0G=>AB83@0=8FK 9 6631921 ?@>F5=BA;CG052 27 6631930 ?@>F5=BC 4 6631957 ?@>F5=BK 5 6631961 ?@>F5AA 4483 6631966 ?@>F5AA0 2257 6636449 ?@>F5AA0< 36 6638706 ?@>F5AA0<8 86 6638742 ?@>F5AA0E 41 6638828 ?@>F5AA5 690 6638869 ?@>F5AA8=3 25 6639559 ?@>F5AA>2 544 6639584 ?@>F5AA>< 294 6640128 ?@>F5AA>@ 387 6640422 ?@>F5AA>@0 21 6640809 ?@>F5AA>@0<8 4 6640830 ?@>F5AA>@2K2>40@57C;LB0B0:><?>=>2:840==KE2:>;;5:F8N7=0G5=89 59 6640834 ?@>F5AA>@2K2>40@57C;LB0B0:><?>=>2:840==KE2B01;8G=K94>:C<5=B 65 6640893 ?@>F5AA>@5 4 6640958 ?@>F5AA>@:><?>=>2:8 12 6640962 ?@>F5AA>@:><?>=>2:840==KE 51 6640974 ?@>F5AA>@=>52@5<O 22 6641025 ?@>F5AA>@=>52@5<O2A53> 11 6641047 ?@>F5AA>@=>52@5<O705<8= 11 6641058 ?@>F5AA>@=>52@5<OB5:CI55 11 6641069 ?@>F5AA>@>< 213 6641080 ?@>F5AAC 47 6641293 ?@>F5AAK 107 6641340 ?@>G0O>20;L=0O?@>5:F8O>@B5;8CA0 9 6641447 ?@>G0O>H81:0 18 6641456 ?@>G0O?@>5:F8O20=45@3@8=B5=01 9 6641474 ?@>G0O?@>5:F8O20=45@3@8=B5=02 9 6641483 ?@>G0O?@>5:F8O20=45@3@8=B5=03 9 6641492 ?@>G0OA>B>20OH0@>20O1?@>5:F8O 9 6641501 ?@>G0OH0@>20O?@>5:F8O15:>=0 9 6641510 ?@>G0OH0@>20O?@>5:F8O=8:>;>A8 9 6641519 ?@>G0OM?8F8:;>840;L=0O?@>5:F8O023CAB0 9 6641528 ?@>G55 71 6641537 ?@>G5< 6 6641608 ?@>G5ABL 49 6641614 ?@>G85 122 6641663 ?@>G89 193 6641785 ?@>G8B0= 137 6641978 ?@>G8B0=0 5 6642115 ?@>G8B0==0O 9 6642120 ?@>G8B0==>3> 32 6642129 ?@>G8B0==>5 44 6642161 ?@>G8B0==>9 5 6642205 ?@>G8B0==CN 5 6642210 ?@>G8B0==K5 49 6642215 ?@>G8B0==K9 540 6642264 ?@>G8B0==K< 48 6642804 ?@>G8B0==K<8 27 6642852 ?@>G8B0==KE 97 6642879 ?@>G8B0=> 91 6642976 ?@>G8B0=K 88 6643067 ?@>G8B0B8 91 6643155 ?@>G8B0BL 1027 6643246 ?@>G8B0BLjson 33 6644273 ?@>G8B0BLxdto 14 6644306 ?@>G8B0BLxml 44 6644320 ?@>G8B0BL0A8=E 138 6644364 ?@>G8B0BL0B@81CB 45 6644502 ?@>G8B0BL109B 18 6644547 ?@>G8B0BL109B0A8=E 18 6644565 ?@>G8B0BL21CD5@42>8G=KE40==KE 26 6644583 ?@>G8B0BL21CD5@42>8G=KE40==KE0A8=E 16 6644609 ?@>G8B0BL2:>=B5:AB5 24 6644625 ?@>G8B0BL2A>>B25BAB285 6 6644649 ?@>G8B0BL40BCjson 17 6644655 ?@>G8B0BL4> 27 6644672 ?@>G8B0BL4>0A8=E 27 6644699 ?@>G8B0BL7=0G5=85json 11 6644726 ?@>G8B0BL87<5=5=8O 39 6644737 ?@>G8B0BL87<5=5=8O:>=D83C@0F888@0AH8@5=89:>=D83C@0F88 22 6644776 ?@>G8B0BL>?8A0=8587<5=5=89 23 6644798 ?@>G8B0BLA8<2>;K 29 6644821 ?@>G8B0BLA8<2>;K0A8=E 19 6644850 ?@>G8B0BLA>>1I5=85A87<5=5=8O<8 5 6644869 ?@>G8B0BLAB@>:C 46 6644874 ?@>G8B0BLAB@>:C0A8=E 19 6644920 ?@>G8B0BLF5;>516 28 6644939 ?@>G8B0BLF5;>5160A8=E 18 6644967 ?@>G8B0BLF5;>532 28 6644985 ?@>G8B0BLF5;>5320A8=E 18 6645013 ?@>G8B0BLF5;>564 28 6645031 ?@>G8B0BLF5;>5640A8=E 18 6645059 ?@>G8BK205B 5 6645077 ?@>G8BK20BL 5 6645082 ?@>G8E 14 6645087 ?@>GB5=85 83 6645101 ?@>GB5=88 68 6645184 ?@>GB5=8O 15 6645252 ?@>GB5==>3> 5 6645267 ?@>GB5==>5 5 6645272 ?@>GB5==K5 4 6645277 ?@>GB5==K9 14 6645281 ?@>H54H53> 4 6645295 ?@>H54H55 12 6645299 ?@>H54H89 45 6645311 ?@>H54H8E 13 6645356 ?@>H5; 9 6645369 ?@>H;0 9 6645378 ?@>H;0O45:040 9 6645387 ?@>H;0O45:0404>B0:>3>65=><5@04=O 9 6645396 ?@>H;0O=545;O 9 6645405 ?@>H;0O=545;O4>B0:>3>654=O=545;8 9 6645414 ?@>H;> 35 6645423 ?@>H;>3> 55 6645458 ?@>H;>5 55 6645513 ?@>H;>5?>;C3>485 9 6645568 ?@>H;>5?>;C3>4854>B0:>96540BK 9 6645577 ?@>H;>9 25 6645586 ?@>H;K9 86 6645611 ?@>H;K93>4 9 6645697 ?@>H;K93>44>B0:>96540BK 9 6645706 ?@>H;K9:20@B0; 9 6645715 ?@>H;K9:20@B0;4>B0:>96540BK 9 6645724 ?@>H;K9<5AOF 9 6645733 ?@>H;K9<5AOF4>B0:>96540BK 9 6645742 ?@>H;KE 6 6645751 ?@>I0 4 6645757 ?@>I5 4 6645761 ?@>O2;O5BAO 11 6645765 ?@>O2;OBLAO 11 6645776 ?@O 21635 6645787 ?@O<0O 178 6667422 ?@O<89 52 6667600 ?@O<> 4 6667652 ?@O<>3> 8 6667656 ?@O<>9 194 6667664 ?@O<>< 4 6667858 ?@O<>C3>;L=0O 16 6667862 ?@O<>C3>;L=0O>1;0ABLOG55: 6 6667878 ?@O<>C3>;L=8: 82 6667884 ?@O<>C3>;L=8:0 29 6667966 ?@O<>C3>;L=8:0<8 4 6667995 ?@O<>C3>;L=8:35>3@0D8G5A:>9AE5<K 57 6667999 ?@O<>C3>;L=8:>< 4 6668056 ?@O<>C3>;L=>9 17 6668060 ?@O<>C3>;L=CN 17 6668077 ?@O<>C3>;L=K9 86 6668094 ?@O<>C3>;L=K94>:C<5=B 13 6668180 ?@O<>C3>;L=K<8 4 6668193 ?@O<>C3>;L=KE 35 6668197 ?@O<K5 74 6668232 ?@O<K<8 8 6668306 ?@O<KE 4 6668314 ?@OGCI55AO 14 6668318 ?@OGCI5<AO 5 6668332 ?@OGCI89AO 19 6668337 ?A 326 6668356 ?A524>0B@81CB0 4 6668682 ?A524>=8< 267 6668686 ?A524>=8<0 29 6668953 ?A524>=8<0< 6 6668982 ?A524>=8<>2 18 6668988 ?A524>=8<>< 4 6669006 ?A524>=8<C 38 6669010 ?A524>=8<K 47 6669048 ?A524>F8;8=4@8G5A:0O=>@<0;L=0O?@>5:F8O1>33A0 9 6669095 ?A524>F8;8=4@8G5A:0O?;>A:>?>;O@=0O?0@01>;8G5A:0O?@>5:F8O<0:1@0940B><0A0 9 6669104 ?A524>F8;8=4@8G5A:0O?;>A:>?>;O@=0O?@>5:F8OG5B25@B>3>?>@O4:0<0:1@0940B><0A0 9 6669113 ?A524>F8;8=4@8G5A:0O?;>A:>?>;O@=0OA8=CA>840;L=0O?@>5:F8O<0:1@0940B><0A0 9 6669122 ?A524>F8;8=4@8G5A:0O?@>5:F8O28=:5;O1 9 6669131 ?A524>F8;8=4@8G5A:0O?@>5:F8O;>:A8<CB0;0 9 6669140 ?A524>F8;8=4@8G5A:0O?@>5:F8O<>;25940 9 6669149 ?A524>F8;8=4@8G5A:0O?@>5:F8O=5A8<<5B@8G=KE@02=KE>1;0AB59E0B0=> 9 6669158 ?A524>F8;8=4@8G5A:0O?@>5:F8O?CB=8=0p2 9 6669167 ?A524>F8;8=4@8G5A:0O?@>5:F8O?CB=8=0p5 9 6669176 ?A524>F8;8=4@8G5A:0O?@>5:F8O@>18=A>=0 9 6669185 ?A524>F8;8=4@8G5A:0O?@>5:F8OM:5@B01 9 6669194 ?A524>F8;8=4@8G5A:0O?@>5:F8OM:5@B02 9 6669203 ?A524>F8;8=4@8G5A:0O?@>5:F8OM:5@B03 9 6669212 ?A524>F8;8=4@8G5A:0O?@>5:F8OM:5@B04 9 6669221 ?A524>F8;8=4@8G5A:0O?@>5:F8OM:5@B05 9 6669230 ?A524>F8;8=4@8G5A:0O?@>5:F8OM:5@B06 9 6669239 ?A524>F8;8=4@8G5A:0OA8=CA>840;L=0O?@>5:F8O 9 6669248 ?C1;8G=>3> 15 6669257 ?C1;8G=K9 63 6669272 ?C1;8G=K9845=B8D8:0B>@ 319 6669335 ?C1;8G=KE 8 6669654 ?C7K@5: 151 6669662 ?C7K@L:0 113 6669813 ?C7K@L:8 8 6669926 ?C7K@L:>2 47 6669934 ?C7K@L:>20O 37 6669981 ?C7K@L:>2>9 65 6670018 ?C7K@L:>2K9 102 6670083 ?C; 26 6670185 ?C;0 4 6670211 ?C;5 22 6670215 ?C;O 22 6670237 ?C=:B 165 6670259 ?C=:B0 89 6670424 ?C=:B0E 25 6670513 ?C=:B8@ 76 6670538 ?C=:B8@=0O 16 6670614 ?C=:B8@=> 4 6670630 ?C=:B8@=>9 5 6670634 ?C=:B8@=K9 25 6670639 ?C=:B8@B>G:0 36 6670664 ?C=:B8@B>G:0B>G:0 36 6670700 ?C=:BC0F88 4 6670736 ?C=:BC0F8O 4 6670740 ?C=:BK 21 6670744 ?C@?C@=K9 18 6670765 ?CA: 5 6670783 ?CAB 76 6670788 ?CAB0O 2204 6670864 ?CAB0O70?8ALndef 9 6673068 ?CAB0O:0@B8=:0 4 6673077 ?CAB0O>1;0ABLM;5<5=B>2 28 6673081 ?CAB0OAAK;:0 206 6673109 ?CAB0OAAK;:0=0B>G:C<0@H@CB0 12 6673315 ?CAB0OAB@>:0 24 6673327 ?CAB0OB01;8F0 27 6673351 ?CAB89 2278 6673378 ?CAB> 25 6675656 ?CAB>20BL 482 6675681 ?CAB>3> 74 6676163 ?CAB>5 308 6676237 ?CAB>9 4358 6676545 ?CAB>970:07 5 6680903 ?CAB>9:;NG 48 6680908 ?CAB>9@53;0<5=B=K94>:C<5=B 6 6680956 ?CAB>< 4 6680962 ?CABC20B8 482 6680966 ?CABCN 482 6681448 ?CABK5 236 6681930 ?CABK< 169 6682166 ?CABK<8 64 6682335 ?CABKE 25 6682399 ?CABL 10 6682424 ?CB59 226 6682434 ?CB5< 229 6682660 ?CB8 450 6682889 ?CB8:;NG52KE?>;59 5 6683339 ?CB> 86 6683344 ?CBK 86 6683430 ?CBL 1962 6683516 ?CBL1 6 6685478 ?CBL2 6 6685484 ?CBL4>?@>AB@0=AB20 17 6685490 ?CBL:1075 15 6685507 ?CBL:40==K< 334 6685522 ?CBL:40==K<703>;>2:0 22 6685856 ?CBL:40==K<7=0G5=8O<=>65AB25==>3>7=0G5=8O 17 6685878 ?CBL:40==K<:0@B8=:8<=>65AB25==>3>7=0G5=8O 23 6685895 ?CBL:40==K<:0@B8=:8AB@>:8 9 6685918 ?CBL:40==K<?>420;0 9 6685927 ?CBL:40==K<?>;O 6 6685936 ?CBL:40==K<?@54AB02;5=8O<=>65AB25==>3>7=0G5=8O 18 6685942 ?CBL:40==K<H0?:8 9 6685960 ?CBL:8=45:AC 15 6685969 ?CBL:;NG52>3>?>;O 5 6685984 ?CBL:?>;=>9@575@2=>9:>?88 12 6685989 ?CBL:?@>AB@0=AB2C 6 6686001 ?CBL:D09;0< 6 6686007 ?CBL:D09;C 48 6686013 ?CBL<>4C;O:@8?B>3@0D88 33 6686061 ?CBO< 23 6686094 ?CBO<8 21 6686117 ?CBQ< 16 6686138 ?CHB> 14 6686154 ?CI0 37 6686168 ?CM@B> 12 6686205 ?D 31 6686217 ?G 10 6686248 ?H5=8G=K9 13 6686258 ?KB05<AO 5 6686271 ?KB05BAO 58 6686276 ?KB0BLAO 67 6686334 ?OB8 51 6686401 ?OB8BL 25 6686452 ?OB=8F0 44 6686477 ?OB=8FC 8 6686521 ?OB>3> 16 6686529 ?OBK9 16 6686545 ?OBL 60 6686561 ?OBL45AOB 12 6686621 ?V? 687 6686633 ?VB 67 6687320 @01>B 5 6687387 @01>B0 4925 6687392 @01>B05B 1325 6692317 @01>B0;8 5 6693642 @01>B0A@5GLN 14 6693647 @01>B0BL 1467 6693661 @01>B0NB 33 6695128 @01>B0NI53> 6 6695161 @01>B0NI5<C 5 6695167 @01>B0NI89 21 6695172 @01>B0NI8E 10 6695193 @01>B5 827 6695203 @01>B=8: 13 6696030 @01>B=8:0E 7 6696043 @01>B=8:8 6 6696050 @01>B=8:8>@30=870F89 5 6696056 @01>B>9 10 6696061 @01>B>A?>A>1=>ABL 11 6696071 @01>BC 277 6696082 @01>BK 3232 6696359 @01>G0O 4 6699591 @01>G0O40B0 65 6699595 @01>G0O>1;0ABL=0G0;L=>9AB@0=8FK 10 6699660 @01>G0O>1;0ABL?@8;>65=8O 11 6699670 @01>G53> 421 6699681 @01>G55 13 6700102 @01>G55<5AB> 27 6700115 @01>G59 97 6700142 @01>G5< 180 6700239 @01>G5<C 6 6700419 @01>G85 47 6700425 @01>G89 1540 6700472 @01>G89:0B0;>340==KE?>;L7>20B5;O 21 6702012 @01>G89:0B0;>340==KE?>;L7>20B5;O0A8=E 16 6702033 @01>G89<>18;L=K9 9 6702049 @01>G89A5@25@ 29 6702058 @01>G89AB>; 11 6702087 @01>G89D0:A 9 6702098 @01>G8< 285 6702107 @01>G8<8 47 6702392 @01>G8E 196 6702439 @01>GCN 9 6702635 @025= 430 6702644 @025=AB20 9 6703074 @025=AB2> 417 6703083 @025=AB2C 56 6703500 @02=0 265 6703556 @02=0O 8 6703821 @02=> 829 6703829 @02=>3> 5 6704658 @02=>5 81 6704663 @02=>7=0G5= 4 6704744 @02=>7=0G=> 9 6704748 @02=>7=0G=K 9 6704757 @02=>7=0G=K9 22 6704766 @02=>9 48 6704788 @02=>< 350 6704836 @02=><C 5 6705186 @02=>?@02=K 4 6705191 @02=>?@02=K9 4 6705195 @02=>A8;L=> 15 6705199 @02=>A8;L=K 6 6705214 @02=>A8;L=K9 21 6705220 @02=CN 4 6705241 @02=K 552 6705245 @02=K5 201 6705797 @02=K9 2679 6705998 @02=K< 122 6708677 @02=K<8 8 6708799 @02=KE 27 6708807 @02=OBLAO 80 6708834 @040@=>9 20 6708914 @040@=K5 4 6708934 @040@=K9 44 6708938 @040@=K93@0D8: 36 6708982 @040@=K93@0D8:A=0:>?;5=85< 13 6709018 @040@=K93@0D8:A>1;0ABO<8 13 6709031 @040@=K93@0D8:A>1;0ABO<88=0:>?;5=85< 13 6709044 @040@=K93@0D8:A>1;0ABO<8=>@<8@>20==K9 13 6709057 @040@=KE 20 6709070 @0480= 60 6709090 @0480=0E 60 6709150 @048CA 85 6709210 @048CA0 48 6709295 @048CA>< 5 6709343 @04C6=0O 4 6709348 @04C6=>9 4 6709352 @04C6=K9 4 6709356 @07 345 6709360 @070 20 6709705 @0718205BAO 40 6709725 @071820BLAO 44 6709765 @071820NBAO 4 6709809 @07185=85 14 6709813 @07185=88 4 6709827 @07185=8O 5 6709831 @0718@05<>3> 4 6709836 @0718@05<>9 8 6709840 @0718@05<>< 4 6709848 @0718@05<K9 16 6709852 @0718@05BAO 13 6709868 @0718@0BLAO 13 6709881 @0718B> 4 6709894 @0718BK9 19 6709898 @0718BL 22 6709917 @071;>:8@>20= 9 6709939 @071;>:8@>20=0 5 6709948 @071;>:8@>20==K9 10 6709953 @071;>:8@>20BL 148 6709963 @071;>:8@>20BL40==K54;O@540:B8@>20=8O 19 6710111 @071;>:8@>20BL40==K5D>@<K4;O@540:B8@>20=8O 11 6710130 @071;>:8@>2:0 113 6710141 @071;>:8@>2:8 36 6710254 @071;>:8@>2:C 49 6710290 @071;>:8@CNBAO 6 6710339 @071>@ 100 6710345 @071>@0 55 6710445 @071>@5 21 6710500 @071>@?>:>?8O< 29 6710521 @0725@=C2 5 6710550 @0725@=CB 54 6710555 @0725@=CB0 36 6710609 @0725@=CB0A5@8O 10 6710645 @0725@=CB0B>G:0 10 6710655 @0725@=CB> 60 6710665 @0725@=CB>3> 5 6710725 @0725@=CB>< 4 6710730 @0725@=CB>ABL 4 6710734 @0725@=CBK 45 6710738 @0725@=CBK9 229 6710783 @0725@=CBK9>AB0B>:4B 22 6711012 @0725@=CBK9>AB0B>::B 22 6711034 @0725@=CBL 202 6711056 @0725@=CBL02B>?>;O 12 6711258 @0725@=CBL2A5 12 6711270 @0725@=CBLA5@8N 10 6711282 @0725@=CBLB>G:C 10 6711292 @0725@=CBLM;5<5=B87<5@5=8O 10 6711302 @0725@=CBM;5<5=B87<5@5=8O 10 6711312 @0725@BK20=85 8 6711322 @0725@BK20=8N 8 6711330 @0725@BK20BLAO 4 6711338 @072>@0G8205<>5 5 6711342 @072>@0G8205<CN 4 6711347 @072>@0G8205<K9 9 6711351 @072>@0G8205B 29 6711360 @072>@0G8205BAO 15 6711389 @072>@0G820=85 28 6711404 @072>@0G820=85< 12 6711432 @072>@0G820=8O 17 6711444 @072>@0G820BL 158 6711461 @072>@0G820BLAO 15 6711619 @072>@>B 62 6711634 @072>@>B0 6 6711696 @072>@>B>< 6 6711702 @073@C7:0 32 6711708 @073@C??8@>20BL 19 6711740 @073@C??8@>2K205B 5 6711759 @073@C??8@>2K20BL 5 6711764 @0742830BL 17 6711769 @0742830BLAO 4 6711786 @0742865=85 29 6711790 @0742865=8O 25 6711819 @0745; 1020 6711844 @0745;0 24 6712864 @0745;480;>302K1>@0D09;0 34 6712888 @0745;5 849 6712922 @0745;5= 31 6713771 @0745;5=0 5 6713802 @0745;5=85 690 6713807 @0745;5=850CB5=B8D8:0F88 14 6714497 @0745;5=850CB5=B8D8:0F88>1I53>@5:2878B0 29 6714511 @0745;5=8540==KE 578 6714540 @0745;5=8540==KE>1I53>@5:2878B0 29 6715118 @0745;5=8540==KEA50=A0 33 6715147 @0745;5=8540==KEA50=A07=0G5=8O 7 6715180 @0745;5=85< 6 6715187 @0745;5=85?>;L7>20B5;59 14 6715193 @0745;5=85?>;L7>20B5;59>1I53>@5:2878B0 29 6715207 @0745;5=85@0AH8@5=89:>=D83C@0F88 13 6715236 @0745;5=85@0AH8@5=89:>=D83C@0F88>1I53>@5:2878B0 28 6715249 @0745;5=88 76 6715277 @0745;5=8O 516 6715353 @0745;5==>3> 6 6715869 @0745;5==>< 6 6715875 @0745;5==K5 78 6715881 @0745;5==K9 543 6715959 @0745;5==KE 334 6716502 @0745;5=K 80 6716836 @0745;5B5;59 10 6716916 @0745;8B59 5 6716926 @0745;8B5;59 562 6716931 @0745;8B5;595 5 6717493 @0745;8B5;5< 159 6717498 @0745;8B5;8 417 6717657 @0745;8B5;L 1929 6718074 @0745;8B5;L1 12 6720003 @0745;8B5;L2 10 6720015 @0745;8B5;L3 6 6720025 @0745;8B5;L3@C??F8D@G8A5; 45 6720031 @0745;8B5;L3@C??G8A5; 9 6720076 @0745;8B5;L4@>1=>9G0AB8G8A5; 54 6720085 @0745;8B5;L<=>65AB25==KE7=0G5=89 5 6720139 @0745;8B5;L=CN 3 6720144 @0745;8B5;L=K9 3 6720147 @0745;8B5;L?>4?8A59 19 6720150 @0745;8B5;LAB@>: 187 6720169 @0745;8B5;N 54 6720356 @0745;8B5;O 456 6720410 @0745;8B5;O1 5 6720866 @0745;8B5;On 5 6720871 @0745;8B5;O< 70 6720876 @0745;8B5;O<8 314 6720946 @0745;8BL 65 6721260 @0745;8BL0A8=E 24 6721325 @0745;8BL42>8G=K540==K5 16 6721349 @0745;8BL=0G0AB8?> 33 6721365 @0745;8BL=0G0AB8?>0A8=E 18 6721398 @0745;8BLB5:AB 42 6721416 @0745;8BLD09; 17 6721458 @0745;>2 60 6721475 @0745;K 38 6721535 @0745;L=> 10 6721573 @0745;O5<0O 9 6721583 @0745;O5<>3> 39 6721592 @0745;O5<>5 10 6721631 @0745;O5<CN 8 6721641 @0745;O5<K9 176 6721649 @0745;O5<KE 97 6721825 @0745;O5B 136 6721922 @0745;O5BAO 15 6722058 @0745;OBL 553 6722073 @0745;OBLAO 327 6722626 @0745;ONB 6 6722953 @0745;ONBAO 297 6722959 @0745;ONI53> 47 6723256 @0745;ONI85 56 6723303 @0745;ONI89 140 6723359 @0745;ONI8< 6 6723499 @0745;ONI8E 6 6723505 @0745;ONICN 25 6723511 @0745;OO 3 6723536 @0745BL 110 6723539 @07;8G05BAO 24 6723649 @07;8G0BL 18 6723673 @07;8G0BLAO 105 6723691 @07;8G0NBAO 35 6723796 @07;8G5=85 5 6723831 @07;8G5=8O 5 6723836 @07;8G85 74 6723841 @07;8G8570:07>2 6 6723915 @07;8G85< 4 6723921 @07;8G89 58 6723925 @07;8G8<K 5 6723983 @07;8G8<K9 5 6723988 @07;8G8BL 5 6723993 @07;8G8O 24 6723998 @07;8G8O25@A89 9 6724022 @07;8G8OE 4 6724031 @07;8G=>3> 4 6724035 @07;8G=>5 4 6724039 @07;8G=>9 8 6724043 @07;8G=CN 9 6724051 @07;8G=K5 206 6724060 @07;8G=K9 564 6724266 @07;8G=K< 20 6724830 @07;8G=K<8 44 6724850 @07;8G=KE 306 6724894 @07;8GL5 58 6725200 @07<0 11 6725258 @07<1 11 6725269 @07<0E 10 6725280 @07<5@ 2156 6725290 @07<5@0 448 6727446 @07<5@0< 14 6727894 @07<5@0A8=E 72 6727908 @07<5@1CD5@0 71 6727980 @07<5@40==KE 12 6728051 @07<5@5 4 6728063 @07<5@:0@B8=:8 260 6728067 @07<5@:0@B8=:8<=>65AB25==>3>7=0G5=8O 9 6728327 @07<5@:0@B8=:8<=>65AB25==>3>7=0G5=8O?>;O22>40 29 6728336 @07<5@:>;>=B8BC;0A25@EC 17 6728365 @07<5@:>;>=B8BC;0A=87C 17 6728382 @07<5@=5A60B>3> 21 6728399 @07<5@=>AB59 21 6728420 @07<5@=>AB8 28 6728441 @07<5@=>ABL 36 6728469 @07<5@>2 188 6728505 @07<5@>< 118 6728693 @07<5@?;0B560 6 6728811 @07<5@?><5I05<>3>D09;0 6 6728817 @07<5@?><5I05<KED09;>22A53> 6 6728823 @07<5@?>@F88 15 6728829 @07<5@?C7K@L:0?>C<>;G0=8N 33 6728844 @07<5@A60B>3> 21 6728877 @07<5@A=8<:0 9 6728898 @07<5@AB@0=8FK 20 6728907 @07<5@AB@>:8 5 6728927 @07<5@B5;0 9 6728932 @07<5@C 63 6728941 @07<5@D09;0 10 6729004 @07<5@D83C@K 13 6729014 @07<5@E@0=8<KE40==KE 12 6729027 @07<5@G0AB8 27 6729039 @07<5@K 139 6729066 @07<5AB8;8AL 4 6729205 @07<5AB8BL 38 6729209 @07<5AB8BLAO 4 6729247 @07<5B:0 220 6729251 @07<5B:8 188 6729471 @07<5B:C 16 6729659 @07<5G5==K9B5:AB 14 6729675 @07<5I05<>9 12 6729689 @07<5I05<K9 32 6729701 @07<5I05<KE 8 6729733 @07<5I05BAO 112 6729741 @07<5I0BL 47 6729853 @07<5I0BLAO 324 6729900 @07<5I0NBAO 23 6730224 @07<5I5= 50 6730247 @07<5I5=0 17 6730297 @07<5I5=85 352 6730314 @07<5I5=8540==KE2E@0=8;8I582107540==KE?@8=54>ABC?=>AB8E@0=8;8I0 9 6730666 @07<5I5=8540==KEB>;L:>2E@0=8;8I5 13 6730675 @07<5I5=8587<5@5=892:>;>=:0E 25 6730688 @07<5I5=8587<5@5=892AB@>:0E 25 6730713 @07<5I5=858B>3>22:>;>=:0E 13 6730738 @07<5I5=858B>3>22AB@>:0E 13 6730751 @07<5I5=85:>?8940==KE2E@0=8;8I5?@870?8A82107C40==KE 9 6730764 @07<5I5=85:>?8940==KE2E@0=8;8I5?@8GB5=8887107K40==KE 9 6730773 @07<5I5=85< 8 6730782 @07<5I5=85@5:2878B>287<5@5=892:>;>=:0E 25 6730790 @07<5I5=85@5:2878B>287<5@5=892AB@>:0E 25 6730815 @07<5I5=85B5:AB0 37 6730840 @07<5I5=88 59 6730877 @07<5I5=8O 225 6730936 @07<5I5==>3> 23 6731161 @07<5I5==>9 17 6731184 @07<5I5==CN 5 6731201 @07<5I5==K5 9 6731206 @07<5I5==K9 248 6731215 @07<5I5==KE 64 6731463 @07<5I5=> 22 6731527 @07<5I5=K 35 6731549 @07<=>60BLAO 18 6731584 @07=8F0 12 6731602 @07=8FC 5 6731614 @07=8FK 5 6731619 @07=>3> 10 6731624 @07=>5 8 6731634 @07=>9 8 6731642 @07=><C 24 6731650 @07=>AB8 5 6731674 @07=>ABL 10 6731679 @07=>ABL40B 18 6731689 @07=CN 4 6731707 @07=K5 65 6731711 @07=K9 343 6731776 @07=K< 22 6732119 @07=K<8 57 6732141 @07=KE 168 6732198 @07>1@0BL 4 6732366 @07>@20BL 15 6732370 @07>@20BLA>548=5=85 22 6732385 @07>@20BLA>548=5=85A2=5H=8<8AB>G=8:><40==KE 11 6732407 @07>G0@>20=85 6 6732418 @07@010BK20;8AL 10 6732424 @07@010BK20BLAO 10 6732434 @07@01>B0==K5 5 6732444 @07@01>B0==K9 6 6732449 @07@01>B0==K<8 5 6732455 @07@01>B:0 9 6732460 @07@01>B:5 9 6732469 @07@01>BG8: 404 6732478 @07@01>BG8:0 12 6732882 @07@01>BG8:0E 11 6732894 @07@01>BG8:>2 22 6732905 @07@01>BG8:>< 147 6732927 @07@01>BG8:C 119 6733074 @07@565==K9 4 6733193 @07@565==KE 4 6733197 @07@57 329 6733201 @07@570 20 6733530 @07@570<8 6 6733550 @07@570E 15 6733556 @07@575 279 6733571 @07@57K 37 6733850 @07@5H05B 196 6733887 @07@5H05BAO 28 6734083 @07@5H0BL 257 6734111 @07@5H0BLAO 32 6734368 @07@5H0NI5< 12 6734400 @07@5H0NI89 54 6734412 @07@5H5= 68 6734466 @07@5H5=0 105 6734534 @07@5H5=85 424 6734639 @07@5H5=85:0<5@KCAB@>9AB20 29 6735063 @07@5H5=88 4 6735092 @07@5H5=89 8 6735096 @07@5H5=8O 248 6735104 @07@5H5=8O4>ABC?087<5=5=8O 9 6735352 @07@5H5=8O4>ABC?087<5=5=8Opdf 24 6735361 @07@5H5=8O?>;CG5=K 5 6735385 @07@5H5==0O2=5H=OO:><?>=5=B0 46 6735390 @07@5H5==0OAE5<0 41 6735436 @07@5H5==>3> 92 6735477 @07@5H5==>5 24 6735569 @07@5H5==>52=5H=55?@8;>65=85 46 6735593 @07@5H5==>9 15 6735639 @07@5H5==CN 5 6735654 @07@5H5==K5 82 6735659 @07@5H5==K5com:;0AAK 36 6735741 @07@5H5==K528@BC0;L=K5:0B0;>38 36 6735777 @07@5H5==K52=5H=85:><?>=5=BK 36 6735813 @07@5H5==K52=5H=85<>4C;8 36 6735849 @07@5H5==K52=5H=85?@8;>65=8O 36 6735885 @07@5H5==K58=B5@=5B@5AC@AK 36 6735921 @07@5H5==K9 1346 6735957 @07@5H5==K9com:;0AA 58 6737303 @07@5H5==K928@BC0;L=K9:0B0;>3 58 6737361 @07@5H5==K92=5H=89<>4C;L 46 6737419 @07@5H5==K98=B5@=5B@5AC@A 58 6737465 @07@5H5==KE 157 6737523 @07@5H5=> 727 6737680 @07@5H5=A?8A>:?0@0<5B@>2 20 6738407 @07@5H5=K 82 6738427 @07@5H5=L5 8 6738509 @07@5H8BL 226 6738517 @07@5H8BLnull 9 6738743 @07@5H8BL02B>70E20B 9 6738752 @07@5H8BL02B><0B8G5A:>5A>E@0=5=850CB5=B8D8:0F88 36 6738761 @07@5H8BL22>4?CABKE<=>65AB25==KE7=0G5=89 9 6738797 @07@5H8BL2K1>@ 9 6738806 @07@5H8BL2K1>@:>@=O 19 6738815 @07@5H8BL2K40GC;8F5=789 47 6738834 @07@5H8BL2K?>;=5=852=5H=53>:>402=5157>?0A=><@568<5 47 6738881 @07@5H8BL4C1;8@>20=85<=>65AB25==KE7=0G5=89 15 6738928 @07@5H8BL7025@H0BL?@8=0G0;5A50=A0 67 6738943 @07@5H8BL70:@KB85 11 6739010 @07@5H8BL70?8ALA>1KB890C48B0 6 6739021 @07@5H8BL70?8ALA>1KB890C48B0?@024>ABC?0 11 6739027 @07@5H8BL87<5=5=85A>AB020 9 6739038 @07@5H8BL8B>38A@57?5@2KE 9 6739047 @07@5H8BL8B>38A@57?>A;54=8E 9 6739056 @07@5H8BL=0AB@>9:C?5@8>40 88 6739065 @07@5H8BL=0G0;>?5@5B0A:820=8O 104 6739153 @07@5H8BL>1JO2;5=850B@81CB0 12 6739257 @07@5H8BL>1JO2;5=85M;5<5=B0 12 6739269 @07@5H8BL>?@545;5=853@C??K0B@81CB>2 12 6739281 @07@5H8BL>?@545;5=853@C??K<>45;59 12 6739293 @07@5H8BL>?@545;5=85B8?0 12 6739305 @07@5H8BL?5@5B0A:820=85 104 6739317 @07@5H8BL?>;CG0BL=02830F8>==CNAAK;:CB5:CI59AB@>:8 16 6739421 @07@5H8BL@0745;5=858B>3>2 18 6739437 @07@5H8BL@0AH8@5=85?@024>ABC?0 47 6739455 @07@5H8BL@540:B8@>20=85 9 6739502 @07@5H8BL@54CF8@>20=853@0D0 5 6739511 @07@5H8BLA;8O=85 5 6739516 @07@5H8BLA>548=OBL>:=> 11 6739521 @07@5H8BLA>AB02=>9B8? 19 6739532 @07@5H8BLA>AB>O=85>1KG=>5 26 6739551 @07@5H8BLA>AB>O=85?@8:@5?;5==>5 26 6739577 @07@5H8BLA>AB>O=85?@OGCI55AO 26 6739603 @07@5H8BLA>AB>O=85A2>1>4=>5 26 6739629 @07@5H8BLA>E@0=5=85 20 6739655 @07@5H8BLA>E@0=5=850CB5=B8D8:0F884;O?>2B>@=>90CB5=B8D8:0F88 36 6739675 @07@5H8BLAAK;:C 49 6739711 @07@5H8BLB5AB>2K5A5@B8D8:0BK 9 6739760 @07@5H8BLD>=>2>5 12 6739769 @07@CH5=85 8 6739781 @07@CH5=8O 8 6739789 @07@K2 96 6739797 @07@K20 51 6739893 @07@K205B 18 6739944 @07@K20BL 18 6739962 @07@K25 14 6739980 @07@KBL 31 6739994 @07@O4 139 6740025 @07@O40 22 6740164 @07@O4=>3> 13 6740186 @07@O4=>5 4 6740199 @07@O4=>9 10 6740203 @07@O4=>AB8 23 6740213 @07@O4=>ABL 58 6740236 @07@O4=>ABL4@>1=>9G0AB8 9 6740294 @07@O4=K9 31 6740303 @07@O4=KE 8 6740334 @07@O4>2 109 6740342 @07@O4>22A53> 9 6740451 @07@O4>24@>1=>9G0AB8 9 6740460 @07@O4K 34 6740469 @07C 55 6740503 @07C<55BAO 5 6740558 @07C<5BLAO 5 6740563 @07J548=8BL 19 6740568 @07J548=O5B 5 6740587 @07J548=OBL 5 6740592 @07K<5=>20=85 95 6740597 @07K<5=>20=85< 4 6740692 @07K<5=>20=85?@>AB@0=AB28<5= 5 6740696 @07K<5=>20=88 10 6740701 @07K<5=>20=8O 10 6740711 @07K<5=>20==>5 15 6740721 @07K<5=>20==>9 4 6740736 @07K<5=>20==CN 5 6740740 @07K<5=>20=> 8 6740745 @07K<5=>20B5;L 5 6740753 @07K<5=>20B5;L?@>AB@0=AB28<5=dom 47 6740758 @07K<5=>20B5;LAE5< 6 6740805 @07K<5=>20B5;O 4 6740811 @07K<5=>20BL 5 6740815 @07K<5=>2K20BL 8 6740820 @07K<5=>2K20NBAO 4 6740828 @07K<5=>2K20NI89 8 6740832 @07K<5=C5<>3> 5 6740840 @08A0 9 6740845 @09>= 14 6740854 @09>=5 4 6740868 @0:>28=0 52 6740872 @0<0 32 6740924 @0<:0 2193 6740956 @0<:03@C??K 69 6743149 @0<:0>:=0 11 6743218 @0<:0?>4?8A59 10 6743229 @0<:0D@59<0 18 6743239 @0<:0E 776 6743257 @0<:0M;5<5=B0C?@02;5=8O 11 6744033 @0<:5 10 6744044 @0<:8 686 6744054 @0<:8AB8;O 18 6744740 @0<:>9 5 6744758 @0<:C 50 6744763 @0<>: 32 6744813 @0=3 45 6744845 @0=55 490 6744890 @0==53> 11 6745380 @0==59 20 6745391 @0==85 26 6745411 @0==89 76 6745437 @0==8< 4 6745513 @0==8E 18 6745517 @0==OO 6 6745535 @0==V9 6 6745541 @0=LH5 51 6745547 @0A0 173 6745598 @0A:>48@>20==0O 5 6745771 @0A:>48@>20==K5 5 6745776 @0A:>48@>20==K9 14 6745781 @0A:>48@>20=K 4 6745795 @0A:>48@>20BL 13 6745799 @0A:>48@>20BLAB@>:C 26 6745812 @0A:>48@C5B 5 6745838 @0A:@K205<0O 4 6745843 @0A:@K205<K9 8 6745847 @0A:@K205B 17 6745855 @0A:@K20BL 43 6745872 @0A:@K20BL25@E=89C@>25=L 14 6745915 @0A:@K20BL2A5C@>2=8 9 6745929 @0A:@K20BLAAK;:8=0ACI=>AB8 18 6745938 @0A:@KB0 13 6745956 @0A:@KB85 201 6745969 @0A:@KB85< 24 6746170 @0A:@KB8O 170 6746194 @0A:@KB> 4 6746364 @0A:@KB>3> 8 6746368 @0A:@KB>AB8 4 6746376 @0A:@KBK9 26 6746380 @0A:@KBKE 4 6746406 @0A:@KBL 15 6746410 @0A>?>;>65==>9 4 6746425 @0A?0:>20==K5 4 6746429 @0A?0:>20==K9 4 6746433 @0A?0:>20BL 20 6746437 @0A?0:>2K205B 18 6746457 @0A?0:>2K20BL 18 6746475 @0A?5G0B0=0 5 6746493 @0A?5G0B0==K9 5 6746498 @0A?5G0B0BL 4 6746503 @0A?5G0B:0 4 6746507 @0A?5G0B:8 4 6746511 @0A?8A0=85 280 6746515 @0A?8A0=857040=8O 4 6746795 @0A?8A0=85< 8 6746799 @0A?8A0=85?5@570?CA:0 27 6746807 @0A?8A0=85@53;0<5=B=>3>7040=8O 104 6746834 @0A?8A0=85M;5<5=B0?;0=8@>2I8:0 73 6746938 @0A?8A0=88 12 6747011 @0A?8A0=89 4 6747023 @0A?8A0=8N 85 6747027 @0A?8A0=8O 98 6747112 @0A?8A0=L5 4 6747210 @0A?>7=0205<>9 8 6747214 @0A?>7=0205<K9 8 6747222 @0A?>7=020=85 346 6747230 @0A?>7=020=85;8F0 9 6747576 @0A?>7=020=85< 8 6747585 @0A?>7=020=85>B?5G0B:0?0;LF0 9 6747593 @0A?>7=020=85@04C6=>9>1>;>G:83;070 9 6747602 @0A?>7=020=85@5G8 9 6747611 @0A?>7=020=85D@07K7025@H5=> 9 6747620 @0A?>7=020=8O 284 6747629 @0A?>7=020BL 88 6747913 @0A?>7=020BLAO 6 6748001 @0A?>7=05B 8 6748007 @0A?>7=0= 4 6748015 @0A?>7=0=85 4 6748019 @0A?>7=0=8O 4 6748023 @0A?>7=0==K9 4 6748027 @0A?>7=0BL 21 6748031 @0A?>7=0NBAO 5 6748052 @0A?>;0305B 36 6748057 @0A?>;0305BAO 263 6748093 @0A?>;030BL 72 6748356 @0A?>;030BLAO 618 6748428 @0A?>;030NBAO 208 6749046 @0A?>;>65= 131 6749254 @0A?>;>65=0 276 6749385 @0A?>;>65=85 1687 6749661 @0A?>;>65=852;>65==KEM;5<5=B>2 15 6751348 @0A?>;>65=852;>65==KEM;5<5=B>2@57C;LB0B0:><?>=>2:840==KE 20 6751363 @0A?>;>65=853@C??8@>2:8 20 6751383 @0A?>;>65=853@C??8@>2:8:><?>=>2:840==KE 45 6751403 @0A?>;>65=85703>;>2:0 15 6751448 @0A?>;>65=85703>;>2:03@C??8@>2:8B01;8G=>3>4>:C<5=B0 25 6751463 @0A?>;>65=85703>;>2:0H:0;K4803@0<<K 24 6751488 @0A?>;>65=858B>3>2 20 6751512 @0A?>;>65=858B>3>2:>;>=>: 15 6751532 @0A?>;>65=858B>3>2:><?>=>2:840==KE 67 6751547 @0A?>;>65=858B>3>2AB@>: 15 6751614 @0A?>;>65=85:=>?:8 5 6751629 @0A?>;>65=85:=>?:8>AB0=>2:870?8A8<C;LB8<5480 59 6751634 @0A?>;>65=85;535=4K 23 6751693 @0A?>;>65=85;535=4K4803@0<<K 52 6751716 @0A?>;>65=85;535=4K4803@0<<K:><?>=>2:840==KE 53 6751768 @0A?>;>65=85< 10 6751821 @0A?>;>65=85>1;0AB8703>;>2:04803@0<<K 66 6751831 @0A?>;>65=85>1;0AB8?>AB@>5=8O4803@0<<K 36 6751897 @0A?>;>65=85>1I8E8B>3>2 5 6751933 @0A?>;>65=85?>;593@C??8@>2:8 20 6751938 @0A?>;>65=85?>;593@C??8@>2:8:><?>=>2:840==KE 42 6751958 @0A?>;>65=85?>;O:><?>=>2:840==KE 35 6752000 @0A?>;>65=85@5:2878B>2 22 6752035 @0A?>;>65=85@5:2878B>2:><?>=>2:840==KE 47 6752057 @0A?>;>65=85@5AC@A>2 41 6752104 @0A?>;>65=85@5AC@A>224803@0<<5:><?>=>2:840==KE 43 6752145 @0A?>;>65=85@5AC@A>2:><?>=>2:840==KE 37 6752188 @0A?>;>65=85AE5<K 44 6752225 @0A?>;>65=85D09;>2 16 6752269 @0A?>;>65=85E@0=8;8I0 15 6752285 @0A?>;>65=85E@0=8;8I0A5@B8D8:0B>2:@8?B>3@0D88 32 6752300 @0A?>;>65=88 9 6752332 @0A?>;>65=8N 20 6752341 @0A?>;>65=8O 460 6752361 @0A?>;>65==0O 4 6752821 @0A?>;>65==>3> 50 6752825 @0A?>;>65==>9 38 6752875 @0A?>;>65==>< 33 6752913 @0A?>;>65==CN 18 6752946 @0A?>;>65==K5 60 6752964 @0A?>;>65==K9 2063 6753024 @0A?>;>65==K< 852 6755087 @0A?>;>65==K<8 38 6755939 @0A?>;>65==KE 502 6755977 @0A?>;>65=> 58 6756479 @0A?>;>65=K 87 6756537 @0A?>;>682 6 6756624 @0A?>;>68< 6 6756630 @0A?>;>68BL 38 6756636 @0A?>@O65=85 5 6756674 @0A?>@O65=88 5 6756679 @0A?@545;5=85 29 6756684 @0A?@545;5=85>A=>2=KE=0G8A;5=89 11 6756713 @0A?@545;5=88 10 6756724 @0A?@545;5=8O 10 6756734 @0A?@545;5==0O8=D>@<0F8>==0O1070 121 6756744 @0A?@545;5==>9 102 6756865 @0A?@545;5==K9 229 6756967 @0A?@545;5==KE 112 6757196 @0A?@545;5=K 15 6757308 @0A?@545;8BL 5 6757323 @0A?@545;O5B 10 6757328 @0A?@545;OBL 10 6757338 @0A?@545;OBL?>AB@0=8F0< 11 6757348 @0A?@545;OBLAO 10 6757359 @0A?@545;ONBAO 10 6757369 @0A?@>AB@0=5=85 6 6757379 @0A?@>AB@0=5=8O 6 6757385 @0A?@>AB@0=5==K5 4 6757391 @0A?@>AB@0=5==K9 10 6757395 @0A?@>AB@0=5==K< 6 6757405 @0A?@>AB@0=O5B 5 6757411 @0A?@>AB@0=O5BAO 23 6757416 @0A?@>AB@0=OBL 5 6757439 @0A?@>AB@0=OBLAO 37 6757444 @0A?@>AB@0=ONBAO 5 6757481 @0AA;54>20=85 4 6757486 @0AA;54>20=8O 4 6757490 @0AA<0B@8205<>3> 4 6757494 @0AA<0B@8205<K9 4 6757498 @0AA<0B@8205BAO 21 6757502 @0AA<0B@820BL 3 6757523 @0AA<0B@820BLAO 35 6757526 @0AA<0B@820NBAO 14 6757561 @0AA<>B@5= 5 6757575 @0AA<>B@5==K9 9 6757580 @0AA<>B@5=K 4 6757589 @0AA<>B@5BL 8 6757593 @0AA<>B@8< 4 6757601 @0AAB>O=85 75 6757605 @0AAB>O=85<564COG59:0<8 9 6757680 @0AAB>O=88 10 6757689 @0AAB>O=89 4 6757699 @0AAB>O=8O 15 6757703 @0AAB>O=L5 4 6757718 @0AAG8B0= 4 6757722 @0AAG8B0=0 4 6757726 @0AAG8B0==>9 6 6757730 @0AAG8B0==K5 5 6757736 @0AAG8B0==K9 165 6757741 @0AAG8B0==K< 5 6757906 @0AAG8B0==KE 62 6757911 @0AAG8B0=> 5 6757973 @0AAG8B0=K 65 6757978 @0AAG8B0BL 31 6758043 @0AAG8B0BL70?8A8@538AB@0 5 6758074 @0AAG8B0BL@07<5@:>;>=B8BC;0A25@EC 13 6758079 @0AAG8B0BL@07<5@:>;>=B8BC;0A=87C 13 6758092 @0AAG8B0BLA8AB5<K;8=59=KEC@02=5=89 14 6758105 @0AAG8BK205< 5 6758119 @0AAG8BK205<K9 9 6758124 @0AAG8BK205<KE 4 6758133 @0AAG8BK205B 9 6758137 @0AAG8BK205BAO 87 6758146 @0AAG8BK20;8AL 5 6758233 @0AAG8BK20BL 23 6758238 @0AAG8BK20BLAO 135 6758261 @0AAG8BK20NBAO 31 6758396 @0AAK;:0 10 6758427 @0AAK;:8 5 6758437 @0AAK;>: 5 6758442 @0AB@>2K9 29 6758447 @0AB@>2KE 29 6758476 @0ABO38205BAO 8 6758505 @0ABO3820=85 257 6758513 @0ABO3820=85< 8 6758770 @0ABO3820=85?>25@B8:0;8 13 6758778 @0ABO3820=85?>25@B8:0;84803@0<<K30=B0 24 6758791 @0ABO3820=8O 196 6758815 @0ABO3820BL 6 6759011 @0ABO3820BL?>25@B8:0;8 205 6759017 @0ABO3820BL?>3>@87>=B0;8 254 6759222 @0ABO3820BLAB@>:8 9 6759476 @0ABO3820BLAB@>:8840==K5 9 6759485 @0ABO3820BLAO 12 6759494 @0ABO3820NBAO 4 6759506 @0ABO=CBL 20 6759510 @0AE=0:; 74 6759530 @0AE=0:;A>AB02 11 6759604 @0AE>4 127 6759615 @0AE>40 10 6759742 @0AE>40< 4 6759752 @0AE>4=0O 49 6759756 @0AE>4=0O=0:;04=0O 599 6759805 @0AE>4=0O=0:;04=0OA>AB02 5 6760404 @0AE>4=K5=0:;04=K5 5 6760409 @0AE>4=K9 62 6760414 @0AE>4=KE 13 6760476 @0AE>4>2 22 6760489 @0AE>4>20=85 4 6760511 @0AE>4B>20@0 32 6760515 @0AE>4C5<0O 8 6760547 @0AE>4C5<K9 18 6760555 @0AE>4C5<KE 16 6760573 @0AG5B 3730 6760589 @0AG5B0 3557 6764319 @0AG5B5 75 6767876 @0AG5B=K9 5 6767951 @0AG5B>2 70 6767956 @0AG5BA8AB5<;8=59=KEC@02=5=89 97 6768026 @0AG5BA@54=53>70@01>B:0 10 6768123 @0AG5BK 14 6768133 @0AG8B0=K 5 6768147 @0AG8BK205BAO 4 6768152 @0AGQB0 4 6768156 @0AH1 7 6768160 @0AH8@5=85 13503 6768167 @0AH8@5=85:>=D83C@0F88 894 6781670 @0AH8@5=85< 156 6782564 @0AH8@5=85D09;0 18 6782720 @0AH8@5=88 935 6782738 @0AH8@5=89 459 6783673 @0AH8@5=8N 50 6784132 @0AH8@5=8O 2027 6784182 @0AH8@5=8O:>=D83C@0F88 14 6786209 @0AH8@5=8O:>=D83C@0F8887<5=5=K 27 6786223 @0AH8@5=8O<8 342 6786250 @0AH8@5=8OE 20 6786592 @0AH8@5==0O 12 6786612 @0AH8@5==0O?>4A:07:0 55 6786624 @0AH8@5==>3> 39 6786679 @0AH8@5==>5 31 6786718 @0AH8@5==>58<Oxml 134 6786749 @0AH8@5==>5?@54AB02;5=85 36 6786883 @0AH8@5==>5?@54AB02;5=8570?8A8 27 6786919 @0AH8@5==>5?@54AB02;5=85>1J5:B0 90 6786946 @0AH8@5==>5?@54AB02;5=85A?8A:0 162 6787036 @0AH8@5==>5@540:B8@>20=85 111 6787198 @0AH8@5==>5@540:B8@>20=85<=>65AB25==KE7=0G5=89 16 6787309 @0AH8@5==>9 8 6787325 @0AH8@5==><C 9 6787333 @0AH8@5==CN 29 6787342 @0AH8@5==K5 8 6787371 @0AH8@5==K5@568<K70<5I5=8O 28 6787379 @0AH8@5==K5A2>9AB20 9 6787407 @0AH8@5==K9 196 6787416 @0AH8@5==KE 26 6787612 @0AH8@5=L5 459 6787638 @0AH8@8< 5 6788097 @0AH8@8BL 69 6788102 @0AH8@O5<>3> 23 6788171 @0AH8@O5<>9 729 6788194 @0AH8@O5<>< 6 6788923 @0AH8@O5<K9 754 6788929 @0AH8@O5<K< 4 6789683 @0AH8@O5B 6 6789687 @0AH8@O5BAO 37 6789693 @0AH8@OBL 27 6789730 @0AH8@OBLAO 37 6789757 @0AH8@ONB 4 6789794 @0AH8@ONI59 4 6789798 @0AH8@ONI85 9 6789802 @0AH8@ONI89 13 6789811 @0AH8D@>20; 15 6789824 @0AH8D@>20=85 46 6789839 @0AH8D@>20==K5 19 6789885 @0AH8D@>20==K540==K5 4 6789904 @0AH8D@>20==K9 22 6789908 @0AH8D@>20==K<8 11 6789930 @0AH8D@>20BL 110 6789941 @0AH8D@>20BL0A8=E 21 6790051 @0AH8D@>2:0 847 6790072 @0AH8D@>2:5 22 6790919 @0AH8D@>2:8 507 6790941 @0AH8D@>2:>9 41 6791448 @0AH8D@>2:C 77 6791489 @0AH8D@>2K205<>9 5 6791566 @0AH8D@>2K205<K5 4 6791571 @0AH8D@>2K205<K9 9 6791575 @0AH8D@>2K205B 290 6791584 @0AH8D@>2K20BL 290 6791874 @3>2K 5 6792164 @50:F88 25 6792169 @50:F8O 39 6792194 @50; 9 6792233 @50;870F859 5 6792242 @50;870F88 112 6792247 @50;870F8N 4 6792359 @50;870F8O 624 6792363 @50;87>20= 52 6792987 @50;87>20=0 15 6793039 @50;87>20==K9 93 6793054 @50;87>20=> 9 6793147 @50;87>20=K 9 6793156 @50;87>20BL 143 6793165 @50;87>20BLAO 14 6793308 @50;87C5B 14 6793322 @50;87C5BAO 4 6793336 @50;87CNBAO 10 6793340 @50;87CNI59 25 6793350 @50;87CNI89 30 6793375 @50;87CO 5 6793405 @50;L=0O 10 6793410 @50;L=89 30 6793420 @50;L=> 140 6793450 @50;L=>3> 20 6793590 @50;L=>5 17 6793610 @50;L=>5:>;8G5AB2> 4 6793627 @50;L=>< 8 6793631 @50;L=K5 12 6793639 @50;L=K9 223 6793651 @50;L=K9@07<5@ 32 6793874 @50;L=K9@07<5@157CG5B0<0AHB010 19 6793906 @50;L=K< 8 6793925 @50;L=KE 4 6793933 @515=>: 10 6793937 @515@ 8 6793947 @51@0 4 6793955 @51@> 9 6793959 @52 18 6793968 @520 18 6793986 @525@A 18 6794004 @53 113 6794022 @532K@065=85 13 6794135 @532K@065=85=><5@0 7 6794148 @538>= 144 6794155 @538>=0 32 6794299 @538>=0;L=0O 39 6794331 @538>=0;L=K5 39 6794370 @538>=0;L=K5=0AB@>9:8 6 6794409 @538>=0;L=K5=0AB@>9:88=D>@<0F8>==>9107K 93 6794415 @538>=0;L=K5=0AB@>9:8A50=A0 70 6794508 @538>=0;L=K9 190 6794578 @538>=0;L=K<8 9 6794768 @538>=0;L=KE 117 6794777 @538>=0< 4 6794894 @538>=>< 4 6794898 @538AB@ 7035 6794902 @538AB@0 5875 6801937 @538AB@0< 27 6807812 @538AB@0<8 25 6807839 @538AB@0B>@ 1162 6807864 @538AB@0B>@0 76 6809026 @538AB@0B>@0< 11 6809102 @538AB@0B>@0<8 22 6809113 @538AB@0B>@>2 5 6809135 @538AB@0B>@>< 117 6809140 @538AB@0B>@C 264 6809257 @538AB@0E 5 6809521 @538AB@0F859 17 6809526 @538AB@0F88 803 6809543 @538AB@0F8>==>9 5 6810346 @538AB@0F8>==K9 19 6810351 @538AB@0F8>==K9=><5@ 9 6810370 @538AB@0F8N 243 6810379 @538AB@0F8O 1118 6810622 @538AB@0F8O2K?>;=5=0 13 6811740 @538AB@0F8O87<5=5=89 6 6811753 @538AB@0F8O87<5=5=892=5H=8EA2>9AB2:>=D83C@0F88 6 6811759 @538AB@0F8O87<5=5=89:>=AB0=B 6 6811765 @538AB@0F8O87<5=5=89:>=D83C@0F88 6 6811771 @538AB@0F8O8=D>@<0F8>==>9107KA8AB5<K2708<>459AB28O 26 6811777 @538AB@0F8O:>@@5A?>=45=F88 6 6811803 @538AB@1CE30;B5@88 513 6811809 @538AB@1CE30;B5@882K1>@:0 131 6812322 @538AB@1CE30;B5@8870?8AL 173 6812453 @538AB@1CE30;B5@88:;NG70?8A8 39 6812626 @538AB@1CE30;B5@88<5=5465@ 195 6812665 @538AB@1CE30;B5@88=01>@70?8A59 295 6812860 @538AB@1CE30;B5@88A?8A>: 47 6813155 @538AB@1CE30;B5@88AC1:>=B> 74 6813202 @538AB@5 54 6813276 @538AB@8@>2 6 6813330 @538AB@8@>20BL 51 6813336 @538AB@8@>20BLAO 108 6813387 @538AB@8@C5< 6 6813495 @538AB@8@C5<>3> 15 6813501 @538AB@8@C5<>5 5 6813516 @538AB@8@C5<K54>:C<5=BK 9 6813521 @538AB@8@C5<K9 92 6813530 @538AB@8@C5<KE 41 6813622 @538AB@8@C5B 20 6813663 @538AB@8@C5BAO 15 6813683 @538AB@8@CNBAO 11 6813698 @538AB@=0:>?;5=8O 507 6813709 @538AB@=0:>?;5=8O2K1>@:0 87 6814216 @538AB@=0:>?;5=8O70?8AL 133 6814303 @538AB@=0:>?;5=8O:;NG70?8A8 43 6814436 @538AB@=0:>?;5=8O<5=5465@ 260 6814479 @538AB@=0:>?;5=8O=01>@70?8A59 315 6814739 @538AB@=0:>?;5=8OA?8A>: 51 6815054 @538AB@=0G8A;5=8O 8 6815105 @538AB@>2 760 6815113 @538AB@>< 21 6815873 @538AB@>=57028A8<KE 10 6815894 @538AB@>A=>2=>9 5 6815904 @538AB@@0AG5B0 515 6815909 @538AB@@0AG5B02K1>@:0 137 6816424 @538AB@@0AG5B070?8AL 190 6816561 @538AB@@0AG5B0:;NG70?8A8 38 6816751 @538AB@@0AG5B0<5=5465@ 126 6816789 @538AB@@0AG5B0=01>@70?8A59 290 6816915 @538AB@@0AG5B0?5@5@0AG5BK<5=5465@ 18 6817205 @538AB@@0AG5B0A?8A>: 42 6817223 @538AB@A2545=89 558 6817265 @538AB@A2545=892K1>@:0 95 6817823 @538AB@A2545=8970?8AL 124 6817918 @538AB@A2545=89:;NG70?8A8 187 6818042 @538AB@A2545=89<5=5465@ 175 6818229 @538AB@A2545=89<5=5465@70?8A8 168 6818404 @538AB@A2545=89=01>@70?8A59 353 6818572 @538AB@A2545=89A?8A>: 51 6818925 @538AB@A2545=89HB0B=>5@0A?8A0=85 9 6818976 @538AB@C 286 6818985 @538AB@K 190 6819271 @538AB@K1CE30;B5@88 85 6819461 @538AB@K1CE30;B5@88<5=5465@ 22 6819546 @538AB@K=0:>?;5=8O 136 6819568 @538AB@K=0:>?;5=8O<5=5465@ 24 6819704 @538AB@K@0AG5B0 110 6819728 @538AB@K@0AG5B0<5=5465@ 22 6819838 @538AB@KA2545=89 167 6819860 @538AB@KA2545=89<5=5465@ 23 6820027 @53;0<5=B 6 6820050 @53;0<5=B8@>20==>9 5 6820056 @53;0<5=B8@>20==K9 11 6820061 @53;0<5=B8@>20=> 6 6820072 @53;0<5=B8@>20BL 5 6820078 @53;0<5=B8@>20BLAO 20 6820083 @53;0<5=B8@C5B 5 6820103 @53;0<5=B8@C5BAO 20 6820108 @53;0<5=B=89 181 6820128 @53;0<5=B=>3> 174 6820309 @53;0<5=B=>5 113 6820483 @53;0<5=B=>57040=85 422 6820596 @53;0<5=B=><C 10 6821018 @53;0<5=B=K5 74 6821028 @53;0<5=B=K57040=8O 40 6821102 @53;0<5=B=K9 436 6821142 @53;0<5=B=K94>:C<5=B 5 6821578 @53;0<5=B=K< 5 6821583 @53;0<5=B=K<8 8 6821588 @53;0<5=B=KE 121 6821596 @53;0<K 4 6821717 @53=0G8A;5=8O 6 6821721 @53C;8@>20=85 259 6821727 @53C;8@>20=8O 223 6821986 @53C;8@>20BL 9 6822209 @53C;8@>20BLAO 14 6822218 @53C;8@C5B 9 6822232 @53C;8@C5BAO 14 6822241 @53C;O@=89 44 6822255 @53C;O@=> 4 6822299 @53C;O@=>3> 39 6822303 @53C;O@=>5 20 6822342 @53C;O@=>52K@065=85 29 6822362 @53C;O@=>< 5 6822391 @53C;O@=><C 9 6822396 @53C;O@=K9 59 6822405 @53C;O@=KE 6 6822464 @540:B8@>20;AO 4 6822470 @540:B8@>20=85 1866 6822474 @540:B8@>20=85:><<5=B0@8O25@A888AB>@8840==KE 6 6824340 @540:B8@>20=85B5:AB0 21 6824346 @540:B8@>20=88 220 6824367 @540:B8@>20=8O 1198 6824587 @540:B8@>20BL 205 6825785 @540:B8@>20BL0A8=E 18 6825990 @540:B8@>20BL2480;>35 12 6826008 @540:B8@>20BL:0:8=B5@20; 27 6826020 @540:B8@>20BL:0:?5@8>4 27 6826047 @540:B8@>20BLA>>1I5=85 9 6826074 @540:B8@>20BLAO 154 6826083 @540:B8@>20BLM;5<5=B 27 6826237 @540:B8@C5<0O 10 6826264 @540:B8@C5<>3> 75 6826274 @540:B8@C5<>5 13 6826349 @540:B8@C5<>9 9 6826362 @540:B8@C5<CN 215 6826371 @540:B8@C5<K5 9 6826586 @540:B8@C5<K9 430 6826595 @540:B8@C5<KE 35 6827025 @540:B8@C5B 27 6827060 @540:B8@C5BAO 123 6827087 @540:B8@CNBAO 8 6827210 @540:B8@CNI89 13 6827218 @540:B8@CNI8E 13 6827231 @540:B>@ 52 6827244 @540:B>@0 21 6827296 @540:B>@0<8 9 6827317 @540:B>@5 5 6827326 @540:B>@>2 5 6827331 @540:B>@K 4 6827336 @54:89 9 6827340 @54:89?C=:B8@ 9 6827349 @54:8<8 4 6827358 @54:> 5 6827362 @54CF8@>20=85 4 6827367 @54CF8@>20=8O 4 6827371 @55AB@ 68 6827375 @55AB@0 31 6827443 @55AB@5 31 6827474 @55AB@C 8 6827505 @568< 10179 6827513 @568<0 1384 6837692 @568<02B>2@5<O 55 6839076 @568<02B>=C<5@0F88>1J5:B>2 38 6839131 @568<02B>>B>1@065=8O:=>?:8>B:@KB8O 24 6839169 @568<02B>>B>1@065=8O:=>?:8>G8AB:8 20 6839193 @568<02B>>B>1@065=8OA>AB>O=8O 29 6839213 @568<03@530B>2 6 6839242 @568<0< 4 6839248 @568<0<8 45 6839252 @568<0E 71 6839297 @568<10;0=A8@>2:8=03@C7:8 11 6839368 @568<153CI59AB@>:8 40 6839379 @568<1;>:8@>2:840==KE 30 6839419 @568<1;>:8@>2>: 18 6839449 @568<22>40AB@>: 30 6839467 @568<22>40AB@>:B01;8FK 29 6839497 @568<22>40AB@>:B01;8G=>3>?>;O 30 6839526 @568<2:;NG5=8OA5@B8D8:0B>2:@8?B>3@0D88 29 6839556 @568<2>AAB0=>2;5=8O?CB59D09;00@E820 24 6839585 @568<2>AAB0=>2;5=8O?CB59D09;>2zip 23 6839609 @568<2A5DC=:F88 6 6839632 @568<2K1>@0 175 6839638 @568<2K1>@087A?8A:0 26 6839813 @568<2K1>@0=570?>;=5==>3> 40 6839839 @568<2K45;5=8O 99 6839879 @568<2K45;5=8O40BK 29 6839978 @568<2K45;5=8O4803@0<<K 52 6840007 @568<2K45;5=8O7=0G5=89 14 6840059 @568<2K45;5=8O7=0G5=894803@0<<K30=B0 29 6840073 @568<2K45;5=8O8=B5@20;>2 9 6840102 @568<2K45;5=8O8=B5@20;>24803@0<<K30=B0 29 6840111 @568<2K45;5=8OAB@>:8 29 6840140 @568<2K45;5=8OAB@>:8B01;8FK 19 6840169 @568<2K45;5=8OAB@>:8B01;8G=>3>?>;O 20 6840188 @568<2K45;5=8OB01;8FK 19 6840208 @568<2K45;5=8OB01;8G=>3>?>;O 20 6840227 @568<480;>302>?@>A 87 6840247 @568<480;>302K1>@0D09;0 37 6840334 @568<4>ABC?0 15 6840371 @568<5 5099 6840386 @568<70<5I5=8O 40 6845485 @568<70?8A8 67 6845525 @568<70?8A84>:C<5=B0 41 6845592 @568<70?8A8@538AB@0 30 6845633 @568<70?CA:0 73 6845663 @568<70?CA:0:;85=BA:>3>?@8;>65=8O 81 6845736 @568<87<5=5=8O@07<5@0 31 6845817 @568<87<5=5=8O@07<5@0:>;>=:8 26 6845848 @568<87<5=5=8OA2O70==>3>7=0G5=8O 27 6845874 @568<8A?>;L7>20=8O1;>G=>3>E@0=5=8O42>8G=KE40==KE 26 6845901 @568<8A?>;L7>20=8O480;>30?5G0B8 73 6845927 @568<8A?>;L7>20=8O<>40;L=>AB8 153 6846000 @568<8A?>;L7>20=8O?0@0<5B@0 23 6846153 @568<8A?>;L7>20=8O?0@0<5B@0:><0=4K 23 6846176 @568<8A?>;L7>20=8OA8=E@>==KE2K7>2>2@0AH8@5=8982=5H=8E:><?>=5=B 36 6846199 @568<8A?>;L7>20=8OA8=E@>==KE2K7>2>2@0AH8@5=89?;0BD>@<K82=5H=8E:><?>=5=B 49 6846235 @568<8A?>;L7>20=8OB01;8G=KE?@>AB@0=AB2107K40==KE 26 6846284 @568<8A?>;L7>20=8OE@0=8;8I042>8G=KE40==KE 29 6846310 @568<:><?>=>2:8 5 6846339 @568<:><?>=>2:840==KE 19 6846344 @568<:><?>=>2:8@57C;LB0B0 24 6846363 @568<<0AHB018@>20=8O?@>A<>B@0 30 6846387 @568<<5=N 15 6846417 @568<=01;N45=8O 5 6846432 @568<>1@01>B:8?>4:0B0;>3>2zip 19 6846437 @568<>1@01>B:8?>4:0B0;>3>2D09;00@E820 24 6846456 @568<>2 310 6846480 @568<>:@C3;5=8O 23 6846790 @568<>< 267 6846813 @568<>?@545;5=8O2@5<5=8 18 6847080 @568<>?@545;5=8O>@85=B0F88 9 6847098 @568<>?@545;5=8O>@85=B0F88A:0=8@>20=8O4>:C<5=B>2 34 6847107 @568<>A=>2=>3>>:=0 5 6847141 @568<>A=>2=>3>>:=02AB@>5==>5@01>G55<5AB> 6 6847146 @568<>A=>2=>3>>:=0:8>A: 6 6847152 @568<>A=>2=>3>>:=0:;85=BA:>3>?@8;>65=8O 60 6847158 @568<>A=>2=>3>>:=0>1KG=K9 6 6847218 @568<>A=>2=>3>>:=0?>;=>M:@0==>5@01>G55<5AB> 6 6847224 @568<>A=>2=>3>>:=0@01>G55<5AB> 6 6847230 @568<>B:@KB8O 31 6847236 @568<>B:@KB8O>:=0 11 6847267 @568<>B:@KB8O>:=0D>@<K 37 6847278 @568<>B:@KB8OD09;0 58 6847315 @568<>B:@KB8OD>@<?@8;>65=8O 25 6847373 @568<>B>1@065=8O 296 6847398 @568<>B>1@065=8O2K45;5=8O 41 6847694 @568<>B>1@065=8O2K45;5=8O@8AC=:>2 30 6847735 @568<>B>1@065=8O35>3@0D8G5A:>9AE5<K 31 6847765 @568<>B>1@065=8O480;>30?5G0B8 5 6847796 @568<>B>1@065=8O7=0G5=89 13 6847801 @568<>B>1@065=8O7=0G5=89A5@88 19 6847814 @568<>B>1@065=8O=0AB@>5::><?>=>2:840==KE 40 6847833 @568<>B>1@065=8O?>4A:07:87=0G5=89 23 6847873 @568<>B>1@065=8O@57C;LB0B0 15 6847896 @568<>B>1@065=8O@57C;LB0B0<>18;L=>3>:;85=B0 7 6847911 @568<>B>1@065=8O@57C;LB0B0<>18;L=>9?;0BD>@<K 7 6847918 @568<>B>1@065=8O@57C;LB0B0>BG5B0 46 6847925 @568<>B>1@065=8O@57C;LB0B0B>=:>3>:;85=B08251:;85=B0 7 6847971 @568<>B>1@065=8OAB@>:8?>8A:0 9 6847978 @568<>B>1@065=8OAB@>:8?>8A:048=0<8G5A:>3>A?8A:0 29 6847987 @568<>B>1@065=8OM;5<5=B0=0AB@>9:8:><?>=>2:840==KE 130 6848016 @568<>B?@02:88=D>@<0F88>1>H81:5 117 6848146 @568<>B@8A>2:8A5B:8 13 6848263 @568<>B@8A>2:8A5B:83@0D8G5A:>9AE5<K 29 6848276 @568<?0@>;O 120 6848305 @568<?>2B>@=>3>8A?>;L7>20=8OA50=A>2 46 6848425 @568<?>;=>B5:AB>2>3>?>8A:0 30 6848471 @568<?>;C?@>7@0G=>AB8 33 6848501 @568<?>;C?@>7@0G=>AB84803@0<<K 52 6848534 @568<?>;CG5=8O0@E820D09;>2 23 6848586 @568<?>;CG5=8O40==KE2K1>@0 16 6848609 @568<?>;CG5=8O40==KE2K1>@0?@822>45?>AB@>:5 131 6848625 @568<?>;Ohtml4>:C<5=B0 20 6848756 @568<?@>15;>2 24 6848776 @568<?@>15;>24803@0<<K 28 6848800 @568<?@>2545=8O 49 6848828 @568<?@>2545=8O4>:C<5=B0 35 6848877 @568<?@>25@:8 15 6848912 @568<?@>25@:8>B7K20tlsA5@B8D8:0B0A5@25@0 57 6848927 @568<?@>25@:8>B7K20A5@B8D8:0B>2C4>AB>25@ONI8EF5=B@>2 8 6848984 @568<?@>25@:8A5@B8D8:0B0:@8?B>3@0D88 37 6848992 @568<?@>3@5AA82=>3>251?@8;>65=8O 19 6849029 @568<?@>:@CG8205<KEAB@0=8F 16 6849048 @568<?@>A<>B@0A?8A:0 12 6849064 @568<?@>A<>B@0A?8A:045@52> 12 6849076 @568<?@>A<>B@0A?8A:085@0@E8G5A:89A?8A>: 12 6849088 @568<?@>A<>B@0A?8A:0A?8A>: 12 6849100 @568<@01>BK 5 6849112 @568<@01>G53>AB>;0 11 6849117 @568<@01>G5940BK 20 6849128 @568<@0745;5=8OA>AB02=KEA;>2 30 6849148 @568<@07<5I5=8O40==KE 5 6849178 @568<@07<5I5=8O:>?8940==KE2E@0=8;8I542>8G=KE40==KE 37 6849183 @568<@07<5I5=8O=0AB@0=8F5 31 6849220 @568<@07@5H5=8O@540:B8@>20=8O 13 6849251 @568<@07@5H5=8O@540:B8@>20=8OM;5<5=B0?;0=8@>2I8:0 29 6849264 @568<@540:B8@>20=8O 34 6849293 @568<@540:B8@>20=8O7=0G5=89 19 6849327 @568<@540:B8@>20=8O7=0G5=894803@0<<K 32 6849346 @568<@540:B8@>20=8O:>;>=:8 29 6849378 @568<A25@B:8M;5<5=B0C?@02;5=8O 42 6849407 @568<A3;06820=8O 33 6849449 @568<A3;06820=8O4803@0<<K 42 6849482 @568<A3;06820=8O8=48:0B>@0 29 6849524 @568<A>2<5AB8<>AB8 208 6849553 @568<A>2<5AB8<>AB88=B5@D59A0 45 6849761 @568<A>2<5AB8<>AB8@0AH8@5=8O:>=D83C@0F88 10 6849806 @568<A>:@0I5=8OB8?0 54 6849816 @568<A>:@B8?0 7 6849870 @568<A>E@0=5=8O?CB59zip 24 6849877 @568<A>E@0=5=8O?CB59D09;00@E820 29 6849901 @568<A?8A:07040G 20 6849930 @568<B5E=8G5A:>3>A?5F80;8AB0 6 6849950 @568<B@0=70:F88 7 6849956 @568<B@0=70:F8870?8A86C@=0;0@538AB@0F88 21 6849963 @568<C 32 6849984 @568<C40;5=8O8=D>@<0F8>==>9107K 6 6850016 @568<C?@02;5=8O1;>:8@>2:>940==KE 205 6850022 @568<C?@02;5=8O1;>:8@>2:>940==KE?>C<>;G0=8N 107 6850227 @568<E@0=8;8I042>8G=KE40==KE 30 6850334 @568<GB5=8O70?8A8 20 6850364 @568<GB5=8O70?8A8E@0=8;8I042>8G=KE40==KE 32 6850384 @568<K 57 6850416 @57 10 6850473 @571 6 6850483 @572 7 6850489 @575@28@>20=85 41 6850496 @575@28@>20=85@01>G8E?@>F5AA>2 47 6850537 @575@28@>20=8O 41 6850584 @575@28@>20BLAO 6 6850625 @575@28@C5BAO 6 6850631 @575@2=0O 12 6850637 @575@2=89 12 6850649 @575@2=>3> 12 6850661 @575@2=>5 4 6850673 @575@2=>5:>?8@>20=85A@54AB20<8>A 9 6850677 @575@2=>9 94 6850686 @575@2=CN 36 6850780 @575@2=K9 188 6850816 @575@2=K< 7 6851004 @575@2=KE 41 6851011 @57C;LB0B 4464 6851052 @57C;LB0Bxpath 77 6855516 @57C;LB0B0 835 6855593 @57C;LB0B0< 17 6856428 @57C;LB0B0=0;87040==KE45@52>@5H5=89 92 6856445 @57C;LB0B0=0;87040==KE:;0AB5@870F8O 74 6856537 @57C;LB0B0=0;87040==KE>1I0OAB0B8AB8:0 54 6856611 @57C;LB0B0=0;87040==KE?>8A:0AA>F80F89 84 6856665 @57C;LB0B0=0;87040==KE?>8A:?>A;54>20B5;L=>AB59 63 6856749 @57C;LB0B0A8=E2K7>202=5H=59:><?>=5=BK 19 6856812 @57C;LB0B0C48>70?8A8 8 6856831 @57C;LB0B0E 20 6856839 @57C;LB0B2>?@>A0 5 6856859 @57C;LB0B2B01;8G=K94>:C<5=B 5 6856864 @57C;LB0B2K1>@0459AB28O@0AH8D@>2:8:><?>=>2:840==KE 24 6856869 @57C;LB0B2K7>20 4 6856893 @57C;LB0B35=5@0F88 4 6856897 @57C;LB0B3;>10;L=>3>?>8A:0 66 6856901 @57C;LB0B5 468 6856967 @57C;LB0B70:@KB8O 10 6857435 @57C;LB0B70?@>A0 324 6857445 @57C;LB0B70?CA:0?@8;>65=8O<>18;L=>3>CAB@>9AB20 39 6857769 @57C;LB0B>2 235 6857808 @57C;LB0B>< 657 6858043 @57C;LB0B>B;>65==>3>@0A?>7=020=8O@5G8 38 6858700 @57C;LB0B>BG5B0 17 6858738 @57C;LB0B?>4?8A8 19 6858755 @57C;LB0B?>8A:0 9 6858774 @57C;LB0B?>8A:0?>@53C;O@=><C2K@065=8N 36 6858783 @57C;LB0B?@>25@:8A>>B25BAB28O?0@>;O?>;8B8:5 29 6858819 @57C;LB0B@0A?>7=020=8O 4 6858848 @57C;LB0B@0A?>7=020=8O@5G8 24 6858852 @57C;LB0B@538AB@0F88 4 6858876 @57C;LB0B@538AB@0F888=D>@<0F8>==>9107KA8AB5<K2708<>459AB28O 27 6858880 @57C;LB0BC 10 6858907 @57C;LB0BGB5=8O40==KE 164 6858917 @57C;LB0BK 157 6859081 @57C;LB0BK?>8A:0 8 6859238 @57C;LB8@>20BL 70 6859246 @57C;LB8@CNI0O 57 6859316 @57C;LB8@CNI53> 27 6859373 @57C;LB8@CNI55 30 6859400 @57C;LB8@CNI59 55 6859430 @57C;LB8@CNI5< 21 6859485 @57C;LB8@CNI5<C 27 6859506 @57C;LB8@CNI89 346 6859533 @57C;LB8@CNI8< 4 6859879 @57C;LB8@CNI8E 15 6859883 @57C;LB8@CNICN 55 6859898 @59B8=3 6 6859953 @59B8=30 6 6859959 @5:2878B 6432 6859965 @5:2878B1 30 6866397 @5:2878B0 2563 6866427 @5:2878B04@5A0F88 406 6868990 @5:2878B0< 299 6869396 @5:2878B0<8 57 6869695 @5:2878B0E 812 6869752 @5:2878B5 19 6870564 @5:2878B87<5@5=8O 10 6870583 @5:2878B>2 1878 6870593 @5:2878B>< 256 6872471 @5:2878BC 306 6872727 @5:2878BD>@<K 44 6873033 @5:2878BD>@<K27=0G5=85 27 6873077 @5:2878BK 1034 6873104 @5:2878BK04@5A0F88 9 6874138 @5:;0<0 130 6874147 @5:;0<=89 57 6874277 @5:;0<=>3> 57 6874334 @5:;0<=>9 4 6874391 @5:;0<=K9 83 6874395 @5:;0<>9 4 6874478 @5:;0<C 8 6874482 @5:;0<K 86 6874490 @5:><5=40F88 75 6874576 @5:><5=40F8O 81 6874651 @5:><5=4>20BL 64 6874732 @5:><5=4>20BLAO 2608 6874796 @5:><5=4C5<>5 8 6877404 @5:><5=4C5<K5 4 6877412 @5:><5=4C5<K9 55 6877416 @5:><5=4C5B 17 6877471 @5:><5=4C5BAO 2608 6877488 @5:AB@C:BC@870F88 6 6880096 @5:C@A82=0O>1@01>B:0?>4?0?>: 11 6880102 @5:C@A82=89 160 6880113 @5:C@A82=> 388 6880273 @5:C@A82=>3> 160 6880661 @5:C@A82=>5 5 6880821 @5:C@A82=K9 425 6880826 @5:C@A88 6 6881251 @5:C@A8O 6 6881257 @5;87 6 6881263 @5;870 5 6881269 @5< 5 6881274 @5<0 5 6881279 @5>@30=870F8O 4 6881284 @5?;8:0F859 6 6881288 @5?;8:0F88 43 6881294 @5?;8:0F8O 51 6881337 @5?>@B 351 6881388 @5?@575=B0F859 4 6881739 @5?@575=B0F8N 4 6881743 @5?@575=B0F8O 8 6881747 @5A?C1;8:0 20 6881755 @5AB@C:BC@870F88 30 6881775 @5AB@C:BC@870F8N 6 6881805 @5AB@C:BC@870F8O 47 6881811 @5AC@A 2835 6881858 @5AC@A0 1291 6884693 @5AC@A0< 100 6885984 @5AC@A0<8 38 6886084 @5AC@A0E 22 6886122 @5AC@A5 4 6886144 @5AC@A8=B5@=5B 6 6886148 @5AC@A=0A5@25@5 12 6886154 @5AC@A>2 804 6886166 @5AC@A>5<:89 4 6886970 @5AC@A>5<:>9 4 6886974 @5AC@A>< 33 6886978 @5AC@AC 73 6887011 @5AC@AK 1098 6887084 @5AC@AK45B0;L=KE70?8A59 6 6888182 @5AC@AK703>;>2:03@C??8@>2:8 6 6888188 @5AC@AK703>;>2:085@0@E8G5A:>93@C??8@>2:8 6 6888194 @5AC@AK?>420;03@C??8@>2:8 6 6888200 @5AC@AK?>420;085@0@E8G5A:>93@C??8@>2:8 6 6888206 @5F8?85=B 11 6888212 @5G0 262 6888223 @5G8 262 6888485 @5GL 330 6888747 @5GLN 62 6889077 @5H05<K5 5 6889139 @5H05<K9 5 6889144 @5H05B 21 6889149 @5H05BAO 4 6889170 @5H0BL 22 6889174 @5H0BLAO 4 6889196 @5H5=85 202 6889200 @5H5=851 4 6889402 @5H5=850=0;87040==KE 32 6889406 @5H5=85: 4 6889438 @5H5=85A;C 5 6889442 @5H5=88 15 6889447 @5H5=89 54 6889462 @5H5=8O 93 6889516 @5H5=8O<8 4 6889609 @5H5=L5 54 6889613 @5H8BL 23 6889667 @81 36 6889690 @810 36 6889726 @8:0 12 6889762 @8:> 12 6889774 @8A 6 6889786 @8A0 6 6889792 @8A: 4 6889798 @8A:>2 4 6889802 @8A>20=85 4 6889806 @8A>20=88 4 6889810 @8A>20BL 24 6889814 @8A>20BLAO 263 6889838 @8AC5BAO 246 6890101 @8AC=:0 299 6890347 @8AC=:5 70 6890646 @8AC=:8 70 6890716 @8AC=:>2 285 6890786 @8AC=:C 10 6891071 @8AC=>: 603 6891081 @8AC=>:B01;8G=>3>4>:C<5=B0 486 6891684 @8ACNBAO 13 6892170 @=: 50 6892183 @>1>B 5 6892233 @>1>B0 5 6892238 @>1>B0<8 5 6892243 @>2=> 20 6892248 @>2=K9 24 6892268 @>2=K< 4 6892292 @>4 39 6892296 @>40 9 6892335 @>48B5;59 10 6892344 @>48B5;5< 28 6892354 @>48B5;8 39 6892382 @>48B5;L 2516 6892421 @>48B5;L25@E=53>C@>2=O 42 6894937 @>48B5;L=K9 25 6894979 @>48B5;LA:0O 42 6895004 @>48B5;LA:0O3@C??8@>2:0 10 6895046 @>48B5;LA:85 31 6895056 @>48B5;LA:85:>=D83C@0F88 10 6895087 @>48B5;LA:89 912 6895097 @>48B5;LA:89C75; 388 6896009 @>48B5;LA:8< 25 6896397 @>48B5;LA:8<8 6 6896422 @>48B5;LA:8E 80 6896428 @>48B5;LA:>3> 128 6896508 @>48B5;LA:>5 15 6896636 @>48B5;LA:>587<5@5=85 10 6896651 @>48B5;LA:>9 74 6896661 @>48B5;LA:>< 7 6896735 @>48B5;LA:><C 8 6896742 @>48B5;LC7;0 210 6896750 @>48B5;N 64 6896960 @>48B5;O 722 6897024 @>48B5;O< 15 6897746 @>48B5;O<8 4 6897761 @>48B5;OE 6 6897765 @>4AB25==8: 10 6897771 @>4AB25==K9 4 6897781 @>4AB25==KE 4 6897785 @>645=85 4 6897789 @>645=8O 4 6897793 @>7= 12 6897797 @>7=8G=CN 6 6897809 @>7=8G=K9 6 6897815 @>7>2> 5 6897821 @>7>2>:>@8G=52K9 12 6897826 @>7>2K9 38 6897838 @>; 90 6897876 @>;520O 4 6897966 @>;52>9 9 6897970 @>;52K9 9 6897979 @>;59 220 6897988 @>;8 274 6898208 @>;8>3@0=8G5=8O02B>=><=>9:>=D83C@0F88 10 6898482 @>;8>3@0=8G820NI85@0AH8@5=85?@024>ABC?0 47 6898492 @>;8?>;L7>20B5;O 35 6898539 @>;8?@828;538@>20==>3>@568<0 47 6898574 @>;L 784 6898621 @>;L4>ABC?=0 12 6899405 @>;L?>;O=01>@040==KE:><?>=>2:840==KE 110 6899417 @>;L?>;OAE5<K70?@>A0 19 6899527 @>;LN 4 6899546 @>;O 816 6899550 @><0= 4 6900366 @><0=0 4 6900370 @><1 19 6900374 @><18G5A:89 4 6900393 @>A0 13 6900397 @>AA88 24 6900410 @>AA89A:0O 16 6900434 @>AA89A:89 24 6900450 @>AA89A:>9 8 6900474 @>AA8O 61 6900482 @>B0B89 18 6900543 @>C88=30 4 6900561 @>C<8=3 16 6900565 @>C<8=30 12 6900581 @>C<8=3>2>9 8 6900593 @C1 34 6900601 @C10H:0 58 6900635 @C1;59 14 6900693 @C1;8 5 6900707 @C1;L 60 6900712 @C1;O 8 6900772 @C:>2>48B5;L 10 6900780 @C:>2>4AB2> 4 6900790 @C<K=8O 12 6900794 @C<K=A:89 38 6900806 @C<K=A:>3> 14 6900844 @C=0 9 6900858 @C=> 9 6900867 @C=K 9 6900876 @CAA:0O 18 6900885 @CAA:85 18 6900903 @CAA:89 136 6900921 @CAA:>3> 44 6901057 @CAA:>5 12 6901101 @CAA:>< 18 6901113 @CG=>5 5 6901131 @CG=>9 57 6901136 @CG=>< 36 6901193 @CG=KE 12 6901229 @D 4 6901241 @K6520B> 5 6901245 @K6520B>:>@8G=52K9 12 6901250 @K6520BK9 5 6901262 @K=:5 51 6901267 @K=>: 51 6901318 @O4 141 6901369 @O40 12 6901510 @O4:=>?>: 5 6901522 @O4:=>?>:?0=5;8:=>?>:A>>1I5=8OA8AB5<K2708<>459AB28O 69 6901527 @O4>2 16 6901596 @O4>< 67 6901612 @O4><A>ALN 9 6901679 @O4C 8 6901688 @O4K 4 6901696 @O4K:=>?>: 9 6901700 @O4K:=>?>:?0=5;8:=>?>:A>>1I5=8OA8AB5<K2708<>459AB28O 49 6901709 A 140528 6901758 A1 8 7042286 A2 8 7042294 Aps 4 7042302 A020 67 7042306 A030 8 7042373 A09B 98 7042381 A09B0 52 7042479 A09B5 15 7042531 A09BC 18 7042546 A09BK 6 7042564 A0;L204>@ 12 7042570 A0< 2237 7042582 A0<0 205 7044819 A0<8 213 7045024 A0<89 1800 7045237 A0<8< 22 7047037 A0<8E 10 7047059 A0<> 96 7047069 A0<>3> 235 7047165 A0<>5 18 7047400 A0<>9 173 7047418 A0<>< 39 7047591 A0<><C 55 7047630 A0<>?>4?8A0==K< 4 7047685 A0<>AB>OB5;L=> 222 7047689 A0<>AB>OB5;L=>3> 8 7047911 A0<>AB>OB5;L=K9 239 7047919 A0<>AB>OB5;L=K< 5 7048158 A0<>AB>OB5;L=K<8 8 7048163 A0<C 6 7048171 A0<CN 15 7048177 A0<K5 25 7048192 A0<K9 627 7048217 A0<K< 27 7048844 A0<KE 11 7048871 A0=B5E=8: 33 7048882 A0=B5E=8:0 33 7048915 A0? 106 7048948 A0?0 106 7049054 A0C4>2A:0O 12 7049160 A0C4>2A:89 12 7049172 A1>9 4 7049184 A1>@ 14 7049188 A1>@0 9 7049202 A1>@:0 5 7049211 A1>@:8 5 7049216 A1>@I8: 23 7049221 A1>@I8:5 23 7049244 A1@0AK205<K5 9 7049267 A1@0AK205<K5?0@0<5B@K 11 7049276 A1@0AK205<K9 9 7049287 A1@0AK205B 36 7049296 A1@0AK205BAO 64 7049332 A1@0AK20BL 57 7049396 A1@0AK20BLAO 73 7049453 A1@0AK20NBAO 9 7049526 A1@>A 9 7049535 A1@>A8BL 86 7049544 A1@>A8BL1CD5@K 87 7049630 A1@>A8BL1CD5@K0A8=E 72 7049717 A1@>H5==K9 8 7049789 A1@>H5=> 4 7049797 A1@>H5=K 4 7049801 A2455=89 4 7049805 A2545=85 1875 7049809 A2545=89 1818 7051684 A2545=8O 73 7053502 A2545=8O>HB0B=KE548=8F0E 5 7053575 A2545=L5 1818 7053580 A25@=CB0 26 7055398 A25@=CB> 14 7055424 A25@=CB>9 6 7055438 A25@=CB>< 28 7055444 A25@=CBK9 70 7055472 A25@=CBL 170 7055542 A25@=CBL2A5 12 7055712 A25@=CBLA5@8N 10 7055724 A25@=CBLB>G:C 10 7055734 A25@=CBLM;5<5=B87<5@5=8O 10 7055744 A25@B:0 60 7055754 A25@B:8 8 7055814 A25@B:C 30 7055822 A25@B>: 60 7055852 A25@BK205<0O 35 7055912 A25@BK205<>9 8 7055947 A25@BK205BAO 16 7055955 A25@BK20=85 8 7055971 A25@BK20=8N 8 7055979 A25@BK20BLAO 20 7055987 A25@EC 193 7056007 A25@EC2=87 13 7056200 A25@EC8;8A;520 9 7056213 A25@EC<=>3>AB@>G=K9 9 7056222 A25@EC<=>3>AB@>G=K9A?5@5AB0=>2:>9 9 7056231 A25@ECA?@>:@CB:>9 9 7056240 A25B 19 7056249 A25B0 19 7056268 A25B;> 75 7056287 A25B;>3@8D5;L=>A5@K9 12 7056362 A25B;>3@8D5;L=>A8=89 12 7056374 A25B;>65;BK9 12 7056386 A25B;>65;BK97>;>B8ABK9 12 7056398 A25B;>75;5=K9 12 7056410 A25B;>7>;>B8ABK9 12 7056422 A25B;>9 5 7056434 A25B;>:>@0;;>2K9 12 7056439 A25B;>:>@8G=52K9 12 7056451 A25B;>=515A=>3>;C1>9 12 7056463 A25B;>@>7>2K9 12 7056475 A25B;>A5@K9 12 7056487 A25B;K9 100 7056499 A25G0 8 7056599 A2845B5;LAB2>20BL 5 7056607 A28B5@ 31 7056612 A2>1>4=> 16 7056643 A2>1>4=>3> 22 7056659 A2>1>4=>5 48 7056681 A2>1>4=>5<5AB> 26 7056729 A2>1>4=>< 13 7056755 A2>1>4=K5 8 7056768 A2>1>4=K9 108 7056776 A2>1>4=KE 8 7056884 A2>4:0 13 7056892 A2>4=0O 56 7056905 A2>4=0O4803@0<<0 305 7056961 A2>4=0OA5@8O 21 7057266 A2>4=0OB01;8F0 241 7057287 A2>4=>9 489 7057528 A2>4=CN 49 7058017 A2>4=K5 9 7058066 A2>4=K9 489 7058075 A2>4=KE 29 7058564 A2>4B01 11 7058593 A2>5 89 7058604 A2>53> 21 7058693 A2>59 30 7058714 A2>5< 29 7058744 A2>5<C 20 7058773 A2>8 50 7058793 A2>8< 13 7058843 A2>8E 42 7058856 A2>9 314 7058898 A2>9AB2 3694 7059212 A2>9AB20 13672 7062906 A2>9AB20< 515 7076578 A2>9AB20<8 136 7077093 A2>9AB20>1J5:B>2 67 7077229 A2>9AB20E 76 7077296 A2>9AB25 762 7077372 A2>9AB2> 27928 7078134 A2>9AB2>xdto 134 7106062 A2>9AB2>< 484 7106196 A2>9AB2>>1J5:B00=0;87040==KE 39 7106680 A2>9AB2C 811 7106719 A2>@0G8205<0O 4 7107530 A2>@0G8205<>9 8 7107534 A2>@0G8205<CN 4 7107542 A2>@0G8205<K9 22 7107546 A2>@0G8205<KE 6 7107568 A2>@0G8205B 33 7107574 A2>@0G8205BAO 5 7107607 A2>@0G820=85 49 7107612 A2>@0G820=85< 12 7107661 A2>@0G820=85M;5<5=B>2?>206=>AB8 9 7107673 A2>@0G820=85M;5<5=B>2D>@<K?>206=>AB8 24 7107682 A2>@0G820=88 10 7107706 A2>@0G820=8O 21 7107716 A2>@0G820BL 48 7107737 A2>@0G820BLAO 61 7107785 A2>@0G820BLM;5<5=BK 13 7107846 A2>@0G820NBAO 56 7107859 A2>@0G820NI89 10 7107915 A2>@0G820NI8E 10 7107925 A2>@0G820O 5 7107935 A2>N 80 7107940 A2O70= 133 7108020 A2O70=0 150 7108153 A2O70==0O 23 7108303 A2O70==>3> 176 7108326 A2O70==>5 57 7108502 A2O70==>9 72 7108559 A2O70==>< 17 7108631 A2O70==><C 26 7108648 A2O70==CN 33 7108674 A2O70==K5 200 7108707 A2O70==K9 914 7108907 A2O70==K< 4 7109821 A2O70==K<8 18 7109825 A2O70==KE 159 7109843 A2O70=> 183 7110002 A2O70=>5 8 7110185 A2O70=K 84 7110193 A2O70BL 76 7110277 A2O759 79 7110353 A2O78 279 7110432 A2O7845=4@>3@0<<K 59 7110711 A2O78=01>@>240==KE 41 7110770 A2O78=01>@>240==KE<0:5B0:><?>=>2:840==KE 69 7110811 A2O78=01>@>240==KEAE5<K:><?>=>2:840==KE 59 7110880 A2O78?0@0<5B@>22K1>@0 93 7110939 A2O78?0@0<5B@>22K1>@0:><?>=>2:840==KE 83 7111032 A2O7:0 10 7111115 A2O7=>AB8 23 7111125 A2O7=>ABL 23 7111148 A2O7K205B 14 7111171 A2O7K205BAO 6 7111185 A2O7K20=85 4 7111191 A2O7K20=8O 4 7111195 A2O7K20BL 14 7111199 A2O7K20BLAO 6 7111213 A2O7L 639 7111219 A2O7L45=4@>3@0<<K 62 7111858 A2O7L4803@0<<K30=B0 43 7111920 A2O7L=01>@>240==KE<0:5B0:><?>=>2:840==KE 99 7111963 A2O7L=01>@>240==KEAE5<K:><?>=>2:840==KE 78 7112062 A2O7L?0@0<5B@02K1>@0 65 7112140 A2O7L?0@0<5B@02K1>@0:><?>=>2:840==KE 61 7112205 A2O7L?>B8?C 128 7112266 A2O7L?>B8?C:><?>=>2:840==KE 37 7112394 A2O7O< 37 7112431 A2Q@=CB0 4 7112468 A2V9 80 7112472 A35=5=8@>20=> 32 7112552 A35=5@8@>20= 33 7112584 A35=5@8@>20=0 49 7112617 A35=5@8@>20==>3> 4 7112666 A35=5@8@>20==>9 4 7112670 A35=5@8@>20==K5 172 7112674 A35=5@8@>20==K9 227 7112846 A35=5@8@>20=> 656 7113073 A35=5@8@>20=K 22 7113729 A35=5@8@>20BL 22 7113751 A35=5@8@>20BLAO 8 7113773 A35=5@8@C5BAO 8 7113781 A3;06820=85 39 7113789 A3;06820=8O 39 7113828 A3@C??8@>20==CN 4 7113867 A3@C??8@>20==K5 5 7113871 A3@C??8@>20==K9 75 7113876 A3@C??8@>20==KE 22 7113951 A3@C??8@>20=> 6 7113973 A3@C??8@>20=>?> 21 7113979 A3@C??8@>20=K 55 7114000 A3@C??8@>20BL 179 7114055 A3C??8@>20BL 5 7114234 A4283 165 7114239 A42830 20 7114404 A428305< 10 7114424 A428305<0O 50 7114434 A428305<>3> 64 7114484 A428305<>5 17 7114548 A428305<>9 43 7114565 A428305<K9 182 7114608 A428305B 353 7114790 A428305BAO 36 7115143 A42830BL 359 7115179 A42830BLAO 60 7115538 A42830NBAO 24 7115598 A428=5< 12 7115622 A428=CBL 1751 7115634 A45;05B 4 7117385 A45;0= 22 7117389 A45;0=0 96 7117411 A45;0==>9 4 7117507 A45;0==K5 9 7117511 A45;0==K9 268 7117520 A45;0==KE 127 7117788 A45;0=> 14 7117915 A45;0BL 59 7117929 A45;0BL0C48>70?8AL 18 7117988 A45;0BL2845>70?8AL 23 7118006 A45;0BLD>B>A=8<>: 26 7118029 A45@60BL 4 7118055 A45@68B 4 7118059 A50=0A0 5 7118063 A50=A 3002 7118068 A50=A0 1311 7121070 A50=A0:B82=K5 9 7122381 A50=A0< 6 7122390 A50=A0<8 122 7122396 A50=A0E 10 7122518 A50=A5 668 7122528 A50=A8=D>@<0F8>==>9107K 65 7123196 A50=A>2 437 7123261 A50=A>2K9 40 7123698 A50=A>2KE 40 7123738 A50=A>< 154 7123778 A50=A>B:;NG5==K5 9 7123932 A50=AC 31 7123941 A50=AK 29 7123972 A515 94 7124001 A51O 689 7124095 A525@=>9 9 7124784 A525@=K9 9 7124793 A53<5=B 81 7124802 A53<5=B0 28 7124883 A53<5=B0<8 4 7124911 A53<5=B5 8 7124915 A53<5=B>2 29 7124923 A53<5=B?>;8;8=59=>3>>1J5:B035>3@0D8G5A:>9AE5<K 56 7124952 A53<5=BK 13 7125008 A53<5=BK?>;8;8=59=>3>>1J5:B035>3@0D8G5A:>9AE5<K 41 7125021 A53>4=O 34 7125062 A53>4=OH=53> 12 7125096 A53>4=OH=89 12 7125108 A59 4 7125120 A59G0A 52 7125124 A5: 17 7125176 A5:@5B=K9 13 7125193 A5:@5B=K9:;NG 32 7125206 A5:B>@ 58 7125238 A5:B>@0 8 7125296 A5:B>@>2 43 7125304 A5:C=4 174 7125347 A5:C=40 1050 7125521 A5:C=40< 35 7126571 A5:C=40E 702 7126606 A5:C=4C 30 7127308 A5:C=4K 95 7127338 A5:F88 133 7127433 A5:F88cdata:0:B5:AB 15 7127566 A5:F89 48 7127581 A5:F8N 64 7127629 A5:F8O 317 7127693 A5:F8Ocdata 226 7128010 A5:F8Ocdatadom 903 7128236 A5;5:B>@ 26 7129139 A5<0=B8:0 5 7129165 A5<0=B8:C 5 7129170 A5<0=B8G5A:8 4 7129175 A5<0=B8G5A:89 15 7129179 A5<59AB20 9 7129194 A5<59AB2> 9 7129203 A5=530; 12 7129212 A5?0@0B>@ 15 7129224 A5@ 4 7129239 A5@0O 34 7129243 A5@18O 22 7129277 A5@1A:89 40 7129299 A5@25@ 95576 7129339 A5@25@0 2027 7224915 A5@25@0< 54 7226942 A5@25@0<8 16 7226996 A5@25@0E 4 7227012 A5@25@10740==KE 47 7227016 A5@25@107K40==KE 29 7227063 A5@25@5 1481 7227092 A5@25@8AB>G=8: 10 7228573 A5@25@=0O 33 7228583 A5@25@=0OAB>@>=0D09;>2>3>20@80=B0 48 7228616 A5@25@=>3> 91 7228664 A5@25@=>9 43 7228755 A5@25@=>< 171 7228798 A5@25@=><C 212 7228969 A5@25@=CN 12 7229181 A5@25@=K5 235 7229193 A5@25@=K9 766 7229428 A5@25@=KE 154 7230194 A5@25@>2 703 7230348 A5@25@>< 1536 7231051 A5@25@C 2311 7232587 A5@25@K 16 7234898 A5@28A 1768 7234914 A5@28A0 917 7236682 A5@28A0< 9 7237599 A5@28A0<8 21 7237608 A5@28A0E 15 7237629 A5@28A2AB@>5==KE?>:C?>: 38 7237644 A5@28A5 80 7237682 A5@28A8=B53@0F88 262 7237762 A5@28A8=B53@0F88<5=5465@ 45 7238024 A5@28A=K5 5 7238069 A5@28A=K9 14 7238074 A5@28A=KE 5 7238088 A5@28A>2 273 7238093 A5@28A>< 88 7238366 A5@28AC 63 7238454 A5@28AK 107 7238517 A5@28AK8=B53@0F88 20 7238624 A5@28AK8=B53@0F88<5=5465@ 25 7238644 A5@2=>9 6 7238669 A5@359 6 7238675 A5@51@8AB> 5 7238681 A5@51@8AB>A5@K9 12 7238686 A5@51@8ABK9 5 7238698 A5@51@> 10 7238703 A5@51@O=K9 13 7238713 A5@548=0 29 7238726 A5@548=0;8=88 9 7238755 A5@548=5 16 7238764 A5@548=K 12 7238780 A5@8 4 7238792 A5@80;870B>@ 17 7238796 A5@80;870B>@xdto 157 7238813 A5@80;870F88 80 7238970 A5@80;870F8N 60 7239050 A5@80;870F8O 21 7239110 A5@80;87>20= 2274 7239131 A5@80;87>20==>5 4 7241405 A5@80;87>20==>< 4 7241409 A5@80;87>20==KE 4 7241413 A5@80;87>20BL 5 7241417 A5@80;87>2K20BL<0AA82K:0:>1J5:BK 9 7241422 A5@80;87C5<>5 11 7241431 A5@80;87C5<K5 13 7241442 A5@80;87C5BAO 1404 7241455 A5@80;87CNBAO 5 7242859 A5@859 13 7242864 A5@88 862 7242877 A5@882AB@>:0E 15 7243739 A5@884803@0<<K 60 7243754 A5@884803@0<<K30=B0 62 7243814 A5@88:>4>2 27 7243876 A5@88:>4>2?;0=0284>2E0@0:B5@8AB8: 38 7243903 A5@88:>4>2?;0=0AG5B>2 38 7243941 A5@88:>4>2A?@02>G=8:0 43 7243979 A5@88A;>O35>3@0D8G5A:>9AE5<K 56 7244022 A5@89 357 7244078 A5@89=>3> 4 7244435 A5@89=>9 8 7244439 A5@89=><C 12 7244447 A5@89=K9 31 7244459 A5@89=K9=><5@ 24 7244490 A5@8BL 4 7244514 A5@8N 101 7244518 A5@8O 1485 7244619 A5@8O1 9 7246104 A5@8O2 9 7246113 A5@8On 8 7246122 A5@8O40==KEA;>O35>3@0D8G5A:>9AE5<K 109 7246130 A5@8O4803@0<<K 216 7246239 A5@8O4803@0<<K30=B0 131 7246455 A5@8O7=0G5=85 9 7246586 A5@8O7=0G5=85?@>F5=B 9 7246595 A5@8O7=0G5=85@07<5@ 9 7246604 A5@8O:;NG0 20 7246613 A5@8O< 51 7246633 A5@8O<8 24 7246684 A5@8O=0720=89 4 7246708 A5@8O=0>A8B>G5: 37 7246712 A5@8O?@>F5=B 9 7246749 A5@8O@07<5@ 9 7246758 A5@8OA;>O 4 7246767 A5@8OAC<<0>1>@>B0?>@538>=0< 13 7246771 A5@8OB>G:0 9 7246784 A5@8OB>G:07=0G5=85 9 7246793 A5@8OB>G:07=0G5=85?@>F5=B 9 7246802 A5@8OB>G:07=0G5=85@07<5@ 9 7246811 A5@8OB>G:0?@>F5=B 9 7246820 A5@8OB>G:0@07<5@ 9 7246829 A5@8OE 12 7246838 A5@> 5 7246850 A5@>3> 29 7246855 A5@>A8=89 12 7246884 A5@B8D8:0B 1137 7246896 A5@B8D8:0B0 332 7248033 A5@B8D8:0B0<8 25 7248365 A5@B8D8:0B5 4 7248390 A5@B8D8:0B:;85=B0 29 7248394 A5@B8D8:0B:;85=B0linux 15 7248423 A5@B8D8:0B:;85=B0macos 26 7248438 A5@B8D8:0B:;85=B0windows 39 7248464 A5@B8D8:0B:;85=B0>A 58 7248503 A5@B8D8:0B:;85=B0D09; 42 7248561 A5@B8D8:0B:@8?B>3@0D88 396 7248603 A5@B8D8:0B>2 478 7248999 A5@B8D8:0B>< 11 7249477 A5@B8D8:0B?>4?8A8 16 7249488 A5@B8D8:0BC 12 7249504 A5@B8D8:0BK 186 7249516 A5@B8D8:0BK4;O?@>25@:8?>4?8A8 4 7249702 A5@B8D8:0BK?>;CG0B5;59 9 7249706 A5@B8D8:0BK?@>25@:8?>4?8A8 9 7249715 A5@B8D8:0BKC4>AB>25@ONI8EF5=B@>2 44 7249724 A5@B8D8:0BKC4>AB>25@ONI8EF5=B@>2linux 18 7249768 A5@B8D8:0BKC4>AB>25@ONI8EF5=B@>2macos 11 7249786 A5@B8D8:0BKC4>AB>25@ONI8EF5=B@>2windows 20 7249797 A5@B8D8:0BKC4>AB>25@ONI8EF5=B@>2>A 38 7249817 A5@B8D8:0BKC4>AB>25@ONI8EF5=B@>2D09; 44 7249855 A5@B8D8F8@CNI0O 17 7249899 A5@B8D8F8@CNI59 4 7249916 A5@B8D8F8@CNI89 21 7249920 A5@BD8:0B>2 4 7249941 A5@K9 143 7249945 A5@K< 15 7250088 A5@L 4 7250103 A5AA88 87 7250107 A5AA8N 13 7250194 A5AA8O 111 7250207 A5AA8O<8 10 7250318 A5AA8OE 5 7250328 A5AB@0 10 7250333 A5B 453 7250343 A5B52>3> 10 7250796 A5B52>5 6 7250806 A5B52>58<O:><?LNB5@0 5 7250812 A5B52>9 55 7250817 A5B52>9:;NG 20 7250872 A5B52>< 8 7250892 A5B52K5 8 7250900 A5B52K< 10 7250908 A5B52KE 5 7250918 A5B8 238 7250923 A5B:0 72 7251161 A5B:8 56 7251233 A5B:C 16 7251289 A5BB5<0 10 7251305 A5BL 268 7251315 A5BLN 8 7251583 A5GL 17 7251591 A60B 5 7251608 A60B85 178 7251613 A60B8540==KE 21 7251791 A60B88 4 7251812 A60B8O 125 7251816 A60BK9 10 7251941 A60BL 24 7251951 A68<05BAO 4 7251975 A68<0BL2A5340 9 7251979 A68<0BLAO 55 7251988 A68<0NBAO 28 7252043 A8289 536 7252071 A82B5<0 10 7252607 A83 5 7252617 A83=0; 24 7252622 A83=0;0 5 7252646 A83=0;878@>20BL 14 7252651 A83=0;878@>20BL8:>=:>9 4 7252665 A83=0;878@CNB 4 7252669 A83=0BC@0 51 7252673 A83=0BC@5 14 7252724 A83=0BC@>9 19 7252738 A83=0BC@C 6 7252757 A84>@ 18 7252763 A84>@>2 16 7252781 A84>@>28G 5 7252797 A8789 166 7252802 A8;0 16 7252968 A8;C 16 7252984 A8;L=>5 4 7253000 A8;L=>52K45;5=85 13 7253004 A8;L=>9 5 7253017 A8;L=K9 9 7253022 A8< 4 7253031 A8<2>; 4386 7253035 A8<2>;0 369 7257421 A8<2>;0< 55 7257790 A8<2>;0<8 92 7257845 A8<2>;0E 418 7257937 A8<2>;878@>20BL 4 7258355 A8<2>;878@CNI89 4 7258359 A8<2>;8G5A:89 57 7258363 A8<2>;8G5A:>5 36 7258420 A8<2>;>2 1937 7258456 A8<2>;>< 332 7260393 A8<2>;@0745;8B5;L 25 7260725 A8<2>;C 37 7260750 A8<2>;K 1009 7260787 A8<2>;K2=5ascii 9 7261796 A8<2>;K2=5bmp 9 7261805 A8<2>;K>BABC?0 28 7261814 A8<2>;L=K5 89 7261842 A8<2>;L=K9 242 7261931 A8<2>;L=K< 25 7262173 A8<2>;L=KE 170 7262198 A8= 43 7262368 A8=0 10 7262411 A8=30?C@ 18 7262421 A8=5 10 7262439 A8=53> 13 7262449 A8=59 8 7262462 A8=5A5@K9 12 7262470 A8=5BL 8 7262482 A8=5D8>;5B>2K9 12 7262490 A8=89 118 7262502 A8=89A>AB0;L=K<>BB5=:>< 12 7262620 A8=89A?>@>E>2K<>BB5=:>< 12 7262632 A8=>=8< 1203 7262644 A8=>=8<>2 10 7263847 A8=>=8<K 21 7263857 A8=B0:A 8 7263878 A8=B0:A8A 38110 7263886 A8=B0:A8A0 1521 7301996 A8=B0:A8A5 24 7303517 A8=B0:A8A>< 8 7303541 A8=B0:A8G5A:0O 21 7303549 A8=B0:A8G5A:8 12 7303570 A8=B0:A8G5A:89 45 7303582 A8=B0:A8G5A:89:>=B@>;L 12 7303627 A8=B0:A8G5A:8E 3 7303639 A8=B0:A8G5A:>3> 8 7303642 A8=B0:A8G5A:>< 8 7303650 A8=B57 41 7303658 A8=B570 36 7303699 A8=B570B>@ 5 7303735 A8=B570B>@0 5 7303740 A8=B578@>20==>9 6 7303745 A8=B578@>20==K9 6 7303751 A8=B578@>20BL 19 7303757 A8=B578@>20BLAO 9 7303776 A8=B578@C5B 4 7303785 A8=B578@C5BAO 9 7303789 A8=B57@5G8 9 7303798 A8=CA 11 7303807 A8=CA0 5 7303818 A8=E@>=870F88 20 7303823 A8=E@>=870F8N 160 7303843 A8=E@>=870F8O 340 7304003 A8=E@>=878@>20==K9 4 7304343 A8=E@>=878@>20=K 4 7304347 A8=E@>==89 6 7304351 A8=E@>==> 14 7304357 A8=E@>==>3> 6 7304371 A8=E@>==>9 4 7304377 A8=E@>==K5 26 7304381 A8=E@>==K9 171 7304407 A8=E@>==KE 133 7304578 A8=NN 4 7304711 A8=OO 9 7304715 A8=V9 9 7304724 A8@5=52K9 5 7304733 A8@8O 12 7304738 A8A8=D> 5 7304750 A8AB0<0 10 7304755 A8AB5< 107 7304765 A8AB5<0 4403 7304872 A8AB5<00=0;8B8:8 10 7309275 A8AB5<02708<>459AB28O 15 7309285 A8AB5<0<8 8 7309300 A8AB5<0E 39 7309308 A8AB5<5 493 7309347 A8AB5<=0O 84 7309840 A8AB5<=0O8=D>@<0F8O 65 7309924 A8AB5<=89 260 7309989 A8AB5<=> 7 7310249 A8AB5<=>3> 246 7310256 A8AB5<=>5 73 7310502 A8AB5<=>9 1069 7310575 A8AB5<=>< 102 7311644 A8AB5<=><C 14 7311746 A8AB5<=CN 10 7311760 A8AB5<=K5 282 7311770 A8AB5<=K5?>;O 5 7312052 A8AB5<=K9 2107 7312057 A8AB5<=K9845=B8D8:0B>@ 325 7314164 A8AB5<=K9H@8DB 11 7314489 A8AB5<=K< 42 7314500 A8AB5<=K<8 3 7314542 A8AB5<=KE 147 7314545 A8AB5<>9 1082 7314692 A8AB5<C 66 7315774 A8AB5<K 1896 7315840 A8AB5<KE 5 7317736 A8BB0<0 10 7317741 A8BC0F88 67 7317751 A8BC0F89 22 7317818 A8BC0F8N 31 7317840 A8BC0F8O 277 7317871 A8BC0F8OE 18 7318148 A:070==K9 8 7318166 A:070=> 8 7318174 A:070B8 8 7318182 A:070BLAO 10 7318190 A:0=5@ 7 7318200 A:0=5@0 7 7318207 A:0=8@>20=85 221 7318214 A:0=8@>20=854>:C<5=B>2 9 7318435 A:0=8@>20=85A5@8O<8 9 7318444 A:0=8@>20=85HB@8E:>4>2 9 7318453 A:0=8@>20=88 16 7318462 A:0=8@>20=8O 168 7318478 A:0=8@>20==K9 4 7318646 A:0=8@>20BL 4 7318650 A:0=8@>20BL4>:C<5=BK0A8=E 46 7318654 A:0G0BL 5 7318700 A:0G5==0O 5 7318705 A:0G820=85 79 7318710 A:0G820=85< 57 7318789 A:0G820=8O 13 7318846 A:2>7=>5 4 7318859 A:2>7=>52K@02=820=85 30 7318863 A:2>7=>9 9 7318893 A:84:0 6 7318902 A:84:8 6 7318908 A:8? 63 7318914 A:;04 206 7318977 A:;040< 11 7319183 A:;045 22 7319194 A:;04>2 6 7319216 A:;04?>C<>;G0=8N 5 7319222 A:;04C 12 7319227 A:;04K 43 7319239 A:;04K205BAO 5 7319282 A:;04K20BLAO 28 7319287 A:;04K20NBAO 23 7319315 A:;0AB8 34 7319338 A:;>=5=85 15 7319372 A:;>=5=88 5 7319387 A:;>=5=8O 7 7319392 A:;>=O5<0OAB@>:0 12 7319399 A:;>=O5<K5548=8FK87<5@5=8O 6 7319411 A:;>=O5B 12 7319417 A:;>=OBL 12 7319429 A:>1:0 213 7319441 A:>1:0E 60 7319654 A:>1:8 125 7319714 A:>1:825@B8:0;L=K5 9 7319839 A:>1:83>@87>=B0;L=K5 9 7319848 A:>1>: 34 7319857 A:>;L:> 146 7319891 A:><?8;8@>20= 4 7320037 A:><?8;8@>20==>5 4 7320041 A:><?8;8@>20==K9 14 7320045 A:><?8;8@>20BL 8 7320059 A:><?>=>20==K9 45 7320067 A:><?>=>20BL 45 7320112 A:><?>=>20BL@57C;LB0B 44 7320157 A:><?@><5B8@>20==K9 5 7320201 A:><?@><5B8@>20==KE 5 7320206 A:>=AB@C8@>20= 4 7320211 A:>=AB@C8@>20==K9 8 7320215 A:>=AB@C8@>20BL 4 7320223 A:>=F0 19 7320227 A:>?8@>20= 16 7320246 A:>?8@>20=0 27 7320262 A:>?8@>20==><C 10 7320289 A:>?8@>20==K9 177 7320299 A:>?8@>20==K9D09; 5 7320476 A:>?8@>20==KE 44 7320481 A:>?8@>20=> 13 7320525 A:>?8@>20=K 100 7320538 A:>?8@>20BL 411 7320638 A:>?8@>20BL6C@=0;@538AB@0F88 11 7321049 A:>?8@>20BL:>;>=:8 12 7321060 A:>?8@>20BL>1J5:B 12 7321072 A:>?8@>20BL>B1>@ 5 7321084 A:>?8@>20BLAB@>:C 35 7321089 A:>?8@>20BLM;5<5=BA?8A:0 12 7321124 A:>?8@C5< 5 7321136 A:>@55 9 7321141 A:>@>AB8 33 7321150 A:>@>ABL 126 7321183 A:>@>ABL:;85=BA:>3>A>548=5=8O 30 7321309 A:>@>ABL:>48@>20=8O 14 7321339 A:>@K9 9 7321353 A:@8?B 29 7321362 A:@8?B0 12 7321391 A:@8?B5 4 7321403 A:@8?B>< 4 7321407 A:@8?BK 5 7321411 A:@>;;8@>20=85 12 7321416 A:@C3;5==0O 10 7321428 A:@C3;5==K9 10 7321438 A:@K205B 14 7321448 A:@K205BAO 53 7321462 A:@K20BL 23 7321515 A:@K20BLAB@0=8FC 9 7321538 A:@K20BLAO 69 7321547 A:@K20BLM;5<5=BK?>206=>AB8 13 7321616 A:@K20NBAO 25 7321629 A:@K20NI55AO 4 7321654 A:@K20NI89AO 4 7321658 A:@KB 13 7321662 A:@KB0 22 7321675 A:@KB> 4 7321697 A:@KBK 4 7321701 A:@KBK9 93 7321705 A:@KBKE 12 7321798 A:@KBL 88 7321810 A:@KBL?0@>;L 12 7321898 A:@KBL?@82K1>@5 9 7321910 A;010O 10 7321919 A;0189 10 7321929 A;01>5 4 7321939 A;01>52K45;5=85 9 7321943 A;01>9 5 7321952 A;01K9 19 7321957 A;0305<>5 6 7321976 A;0305<K9 6 7321982 A;0C 6 7321988 A;520 371 7321994 A;52025@B8:0;L=> 9 7322365 A;5203>@87>=B0;L=> 9 7322374 A;520=0?@02> 15 7322383 A;54 15 7322398 A;54>20=85 179 7322413 A;54>20=8O 179 7322592 A;54>20B5;L=> 10 7322771 A;54>20BL 3043 7322781 A;54>< 5 7325824 A;54AB285 19 7325829 A;54C5B 2160 7325848 A;54CI85 4 7328008 A;54CNB 18 7328012 A;54CNI0O 136 7328030 A;54CNI0O45:040 9 7328166 A;54CNI0O45:0404>B0:>3>65=><5@04=O 9 7328175 A;54CNI0O=545;O 9 7328184 A;54CNI0O=545;O4>B0:>3>654=O=545;8 9 7328193 A;54CNI0OA5@8O 9 7328202 A;54CNI0OG0ABL 18 7328211 A;54CNI53> 168 7328229 A;54CNI55 1058 7328397 A;54CNI55>1JO2;5=85 30 7329455 A;54CNI55?>;C3>485 9 7329485 A;54CNI55?>;C3>4854>B0:>96540BK 9 7329494 A;54CNI59 121 7329503 A;54CNI5< 122 7329624 A;54CNI5<C 161 7329746 A;54CNI85 1197 7329907 A;54CNI8574=59 9 7331104 A;54CNI89 4918 7331113 A;54CNI890B@81CB 30 7336031 A;54CNI893>4 9 7336061 A;54CNI893>44>B0:>96540BK 9 7336070 A;54CNI89:20@B0; 9 7336079 A;54CNI89:20@B0;4>B0:>96540BK 9 7336088 A;54CNI89<5AOF 9 7336097 A;54CNI89<5AOF4>B0:>96540BK 9 7336106 A;54CNI89?>7=0G5=8N?>;O 28 7336115 A;54CNI89A>A54=89 388 7336143 A;54CNI89C75; 20 7336531 A;54CNI8< 594 7336551 A;54CNI8<8 1065 7337145 A;54CNI8E 855 7338210 A;54CNICN 93 7339065 A;5?>9 8 7339158 A;5?K5 4 7339166 A;5?K5:>?88 37 7339170 A;5?KE 4 7339207 A;5H 82 7339211 A;5H8 73 7339293 A;82>2K9 13 7339366 A;82H89AO 4 7339379 A;82H8<8AO 4 7339383 A;8B=> 12 7339387 A;8B=K9 12 7339399 A;8BL 12 7339411 A;8H:>< 56 7339423 A;8H:><<=>3>@57C;LB0B>2 10 7339479 A;8O=85 49 7339489 A;8O=85< 8 7339538 A;8O=8O 10 7339546 A;>2 180 7339556 A;>20 583 7339736 A;>20:8O 12 7340319 A;>20< 34 7340331 A;>20<8 93 7340365 A;>20@59 4 7340458 A;>20@L 4 7340462 A;>20D@07 9 7340466 A;>20E 10 7340475 A;>20F:89 14 7340485 A;>25 13 7340499 A;>25=8O 12 7340512 A;>25=A:89 14 7340524 A;>25A=>5 18 7340538 A;>25A=K9 18 7340556 A;>2> 1164 7340574 A;>2>< 94 7341738 A;>2>A>G5B0=85 12 7341832 A;>2>A>G5B0=8O 5 7341844 A;>2>D@07K@0A?>7=020=8O@5G8 29 7341849 A;>2C 76 7341878 A;>2CN 4 7341954 A;>5 24 7341958 A;>52 12 7341982 A;>65=85 21 7341994 A;>65=8O 4 7342015 A;>68;AO 15 7342019 A;>68BLAO 15 7342034 A;>6=>5 10 7342049 A;>6=><C 10 7342059 A;>6=>AB8 27 7342069 A;>6=>ABL 37 7342096 A;>6=CN 4 7342133 A;>6=K5 5 7342137 A;>6=K9 123 7342142 A;>6=K9?0@>;L 6 7342265 A;>6=KE 85 7342271 A;>8 19 7342356 A;>835>3@0D8G5A:>9AE5<K 68 7342375 A;>8BL 102 7342443 A;>9 209 7342545 A;>935>3@0D8G5A:>9AE5<K 160 7342754 A;>9@538>=>2 8 7342914 A;>< 4 7342922 A;><>2 4 7342926 A;>=>20O 5 7342930 A;>=>20O:>ABL 12 7342935 A;>=>2K9 5 7342947 A;>O 86 7342952 A;C 5 7343038 A;C60B 29 7343043 A;C61 19 7343072 A;C610 49 7343091 A;C610E 5 7343140 A;C615 16 7343145 A;C61K 8 7343161 A;C651=0O 4 7343169 A;C651=>5 72 7343173 A;C651=>9 21 7343245 A;C651=>< 4 7343266 A;C651=CN 8 7343270 A;C651=K5 13 7343278 A;C651=K9 129 7343291 A;C651=K<8 5 7343420 A;C651=KE 4 7343425 A;C68B 70 7343429 A;C68B8 27 7343499 A;C68BL 122 7343526 A;CG05 6897 7343648 A;CG052 110 7350545 A;CG05< 9 7350655 A;CG05<K9 9 7350664 A;CG09 8559 7350673 A;CG09=>5 4 7359232 A;CG09=>5G8A;> 11 7359236 A;CG09=K9 31 7359247 A;CG09=K9?0@>;L 10 7359278 A;CG09=KE 23 7359288 A;CG0BL 112 7359311 A;CG0O 58 7359423 A;CG0OE 1681 7359481 A< 12009 7361162 A<0@BD>= 17 7373171 A<0@BD>=0 12 7373188 A<0@BD>=0E 5 7373200 A<56=K5 184 7373205 A<56=K9 208 7373389 A<56=KE 36 7373597 A<5=0 259 7373633 A<5=5 210 7373892 A<5=>9 4 7374102 A<5=K 79 7374106 A<5A8B5;L 78 7374185 A<5AB8BL 8 7374263 A<5H0==>3> 41 7374271 A<5H0==>9 5 7374312 A<5H0==K9 85 7374317 A<5H0==KE 33 7374402 A<5H0BL 21 7374435 A<5H820BL 3 7374456 A<5I05BAO 36 7374459 A<5I0BL 18 7374495 A<5I0BLAO 36 7374513 A<5I5=85 1328 7374549 A<5I5=8540B 47 7375877 A<5I5=8540BK>B?@02;5=8O 11 7375924 A<5I5=854>;3>BK 9 7375935 A<5I5=85;5B=53>2@5<5=8 16 7375944 A<5I5=85< 55 7375960 A<5I5=85=0G0;0 11 7376015 A<5I5=85>:>=G0=8O 11 7376026 A<5I5=85>B?@028B5;O 9 7376037 A<5I5=85?>;CG0B5;O 7 7376046 A<5I5=85AB0=40@B=>3>2@5<5=8 16 7376053 A<5I5=85H8@>BK 9 7376069 A<5I5=8N 130 7376078 A<5I5=8O 47 7376208 A<>3 5 7376255 A<>3;8 10 7376260 A<>3CB 21 7376270 A<>65B 34 7376291 A<>B@5BL 5 7376325 A<>B@8B5 5 7376330 A<>GL 70 7376335 A<A 11 7376405 A<KA; 1377 7376416 A<KA;0 270 7377793 A<KA;5 4 7378063 A<KA;>2>9 5 7378067 A<KA;>< 16 7378072 A<KA;C 19 7378088 A=0:>?;5=85< 9 7378107 A=0:>?;5=85<=>@<8@>20==0O 9 7378116 A=0@C68 49 7378125 A=0G0;0 826 7378174 A=0G0;0MB>3>3>40 9 7379000 A=0G0;0MB>3>:20@B0;0 9 7379009 A=0G0;0MB>3><5AOF0 9 7379018 A=0G0;0MB>3>?>;C3>48O 9 7379027 A=0G0;0MB>945:04K 9 7379036 A=0G0;0MB>9=545;8 9 7379045 A=8605B 9 7379054 A=860BL 9 7379063 A=865=85 43 7379072 A=865=8N 35 7379115 A=87C 176 7379150 A=87C225@E 13 7379326 A=87C8;8A?@020 9 7379339 A=87C<=>3>AB@>G=K9 9 7379348 A=87C<=>3>AB@>G=K9A?5@5AB0=>2:>9 9 7379357 A=87CA?@>:@CB:>9 9 7379366 A=8<05B 66 7379375 A=8<05BAO 35 7379441 A=8<0BL 66 7379476 A=8<0BLAO 39 7379542 A=8<0NBAO 4 7379581 A=8<5B 25 7379585 A=8<:0 39 7379610 A=8<:5 8 7379649 A=8<:8 8 7379657 A=8<>: 39 7379665 A=8B8 51 7379704 A=>20 8 7379755 A=OB 45 7379763 A=OB0 42 7379808 A=OB85 137 7379850 A=OB88 9 7379987 A=OB8N 5 7379996 A=OB8O 60 7380001 A=OB>9 4 7380061 A=OBK9 91 7380065 A=OBL 76 7380156 A=OBLD;06:8 12 7380232 A> 2877 7380244 A>18@05B 5 7383121 A>18@05BAO 10 7383126 A>18@0BL 5 7383136 A>18@0BLAO 10 7383141 A>1;N405BAO 5 7383151 A>1;N40BL 15 7383156 A>1;N40BLAO 5 7383171 A>1;N45==K9 10 7383176 A>1;N45=> 5 7383186 A>1;N45=K 5 7383191 A>1>8EAB>@>= 9 7383196 A>1>9 1301 7383205 A>1@0==0O 5 7384506 A>1@0==>9 14 7384511 A>1@0==>< 5 7384525 A>1@0==K5 11 7384530 A>1@0==K9 35 7384541 A>1@0=K 28 7384576 A>1AB25==> 147 7384604 A>1AB25==>3> 35 7384751 A>1AB25==>5 9 7384786 A>1AB25==>9 4 7384795 A>1AB25==>< 5 7384799 A>1AB25==CN 5 7384804 A>1AB25==K5 37 7384809 A>1AB25==K9 136 7384846 A>1AB25==K< 8 7384982 A>1AB25==K<8 4 7384990 A>1AB25==KE 23 7384994 A>1KB85 5921 7385017 A>1KB85< 38 7390938 A>1KB85@538AB@8@C5BAO 36 7390976 A>1KB88 13 7391012 A>1KB89 1537 7391025 A>1KB89=K9 9 7392562 A>1KB8N 201 7392571 A>1KB8O 4031 7392772 A>1KB8O< 79 7396803 A>1KB8O<8 61 7396882 A>1KB8OE 4 7396943 A>1KBL5 1537 7396947 A>25@H05<K9 5 7398484 A>25@H05<KE 5 7398489 A>25@H05BAO 4 7398494 A>25@H0BL 14 7398498 A>25@H0BLAO 9 7398512 A>25@H5==> 5 7398521 A>25@H5==>9 4 7398526 A>25@H5==K9 9 7398530 A>25@H8BL 5 7398539 A>2<5AB8<> 32 7398544 A>2<5AB8<>9 5 7398576 A>2<5AB8<>AB8 1484 7398581 A>2<5AB8<>ABL 1491 7400065 A>2<5AB8<CN 5 7401556 A>2<5AB8<K 23 7401561 A>2<5AB8<K9 65 7401584 A>2<5AB=> 62 7401649 A>2<5AB=>3> 8 7401711 A>2<5AB=>5 25 7401719 A>2<5AB=>58A?>;L7>20=85 5 7401744 A>2<5AB=>58A?>;L7>20=85?@8;>65=89A8AB5<K2708<>459AB28O 35 7401749 A>2<5AB=CN 12 7401784 A>2<5AB=K5 6 7401796 A>2<5AB=K9 106 7401802 A>2<5AB=KE 6 7401908 A>2<5I0BLAO 14 7401914 A>2<5I0NBAO 14 7401928 A>2>:C?=>AB8 597 7401942 A>2>:C?=>ABL 638 7402539 A>2>:C?=>ABLN 16 7403177 A>2>:C?=K5 5 7403193 A>2>:C?=K9 5 7403198 A>2?0405B 465 7403203 A>2?040;0 8 7403668 A>2?040;> 6 7403676 A>2?040BL 1350 7403682 A>2?040NB 651 7405032 A>2?040NI53> 16 7405683 A>2?040NI55 10 7405699 A>2?040NI59 45 7405709 A>2?040NI85 65 7405754 A>2?040NI89 207 7405819 A>2?040NI8< 24 7406026 A>2?040NI8<8 30 7406050 A>2?040NI8E 12 7406080 A>2?045=85 491 7406092 A>2?045=88 12 7406583 A>2?045=8N 420 7406595 A>2?045=8O 44 7407015 A>2?0;8 30 7407059 A>2?0ABL 30 7407089 A>2@5<5==K5 6 7407119 A>2@5<5==K9 18 7407125 A>2A5< 26 7407143 A>3;0A85 4 7407169 A>3;0A8;AO 23 7407173 A>3;0A8BLAO 23 7407196 A>3;0A8O 4 7407219 A>3;0A=> 110 7407223 A>3;0A=>9 6 7407333 A>3;0A=K9 116 7407339 A>3;0A>20= 14 7407455 A>3;0A>20=0 8 7407469 A>3;0A>20=85 20 7407477 A>3;0A>20=854>:C<5=B0 15 7407497 A>3;0A>20=85?@>4068 9 7407512 A>3;0A>20=88 6 7407521 A>3;0A>20=8O 5 7407527 A>3;0A>20==K9 26 7407532 A>3;0A>20==KE 12 7407558 A>3;0A>20BL 13 7407570 A>3;0H5=85 7 7407583 A>3;0H5=8O 7 7407590 A>4568B 4 7407597 A>45@60; 8 7407601 A>45@60;0 5 7407609 A>45@60;8 5 7407614 A>45@60;8AL 4 7407619 A>45@60;>AL 5 7407623 A>45@60=85 139 7407628 A>45@60=85< 9 7407767 A>45@60=88 10 7407776 A>45@60=8O 66 7407786 A>45@60B 560 7407852 A>45@60B5;L=>5 4 7408412 A>45@60B5;L=K9 4 7408416 A>45@60BAO 173 7408420 A>45@60BL 32328 7408593 A>45@60BLAO 1147 7440921 A>45@60I0O 920 7442068 A>45@60I0OAO 27 7442988 A>45@60I53> 86 7443015 A>45@60I53>AO 110 7443101 A>45@60I55 285 7443211 A>45@60I55AO 15 7443496 A>45@60I59 110 7443511 A>45@60I59AO 93 7443621 A>45@60I5< 21 7443714 A>45@60I5<AO 4 7443735 A>45@60I5<C 34 7443739 A>45@60I5<CAO 5 7443773 A>45@60I85 154 7443778 A>45@60I85AO 283 7443932 A>45@60I89 762 7444215 A>45@60I89AO 1257 7444977 A>45@60I8< 37 7446234 A>45@60I8<8 6 7446271 A>45@60I8<8AO 17 7446277 A>45@60I8<AO 4 7446294 A>45@60I8E 84 7446298 A>45@60I8EAO 478 7446382 A>45@60ICN 71 7446860 A>45@60ICNAO 28 7446931 A>45@68 5 7446959 A>45@68<>3> 465 7446964 A>45@68<>5 1242 7447429 A>45@68<>51 5 7448671 A>45@68<>5n 5 7448676 A>45@68<>540==KE 7 7448681 A>45@68<>5C40;5=> 9 7448688 A>45@68<>< 168 7448697 A>45@68<><C 59 7448865 A>45@68<K9 1242 7448924 A>45@68<K< 56 7450166 A>45@68B 29424 7450222 A>45@68B03@530B=CNDC=:F8N 10 7479646 A>45@68B40==K50A8=E 11 7479656 A>45@68B7=0G5=85 62 7479667 A>45@68B:;NG 10 7479729 A>45@68BAO 716 7479739 A>45@68BB8? 26 7480455 A>548=5= 4 7480481 A>548=5=85 66053 7480485 A>548=5=857=0G5=89?>A5@8O< 33 7546538 A>548=5=858=D>@<0F8>==>9107K 55 7546571 A>548=5=858AB>G=8:070?@>A0AE5<K70?@>A0 50 7546626 A>548=5=85:@052 9 7546676 A>548=5=85< 25 7546685 A>548=5=85=5?@>?CI5==KE 9 7546710 A>548=5=85A035=B><A5@25@0 5 7546719 A>548=5=85A107>2K<7=0G5=85< 9 7546724 A>548=5=85A@01>G8<?@>F5AA>< 5 7546733 A>548=5=85AA5@25@><A8AB5<K0=0;8B8:8 24 7546738 A>548=5=85AC14 11 7546762 A>548=5=85B>G5: 33 7546773 A>548=5=85B>G5:?@8?@>?CI5==KE7=0G5=8OE 33 7546806 A>548=5=88 124 7546839 A>548=5=89 406 7546963 A>548=5=8N 37 7547369 A>548=5=8O 1299 7547406 A>548=5=8O8AB>G=8:070?@>A0AE5<K70?@>A0 49 7548705 A>548=5=8O< 4 7548754 A>548=5=8OE 9 7548758 A>548=5==K5 24 7548767 A>548=5==K9 24 7548791 A>548=5=K 19 7548815 A>548=5=L5 406 7548834 A>548=8B5;L 21 7549240 A>548=8B5;L=0O 4 7549261 A>548=8B5;L=>9 68 7549265 A>548=8B5;L=K9 76 7549333 A>548=8B5;L=KE 4 7549409 A>548=8B5;O 5 7549413 A>548=8BL 16 7549418 A>548=8BL1CD5@K42>8G=KE40==KE 16 7549434 A>548=8BL42>8G=K540==K5 22 7549450 A>548=O5<>5>:=> 11 7549472 A>548=O5<K5 6 7549483 A>548=O5<K9 11 7549489 A>548=O5<KE 5 7549500 A>548=O5B 10 7549505 A>548=OBL 50 7549515 A>548=OBLAO 57 7549565 A>548=ONBAO 47 7549622 A>548=ONI0O 4 7549669 A>548=ONI89AO 5 7549673 A>548=ONI8<8AO 5 7549678 A>740205<0O 5 7549683 A>740205<>3> 154 7549688 A>740205<>5 5 7549842 A>740205<>9 29 7549847 A>740205<><C 16 7549876 A>740205<K5 23 7549892 A>740205<K9 322 7549915 A>740205<K< 15 7550237 A>740205<KE 61 7550252 A>74020;8AL 5 7550313 A>74020;AO 16 7550318 A>74020BL 2488 7550334 A>74020BL<5=5465@?>4:064K9A5@28A 11 7552822 A>74020BLAO 761 7552833 A>7402H53> 659 7553594 A>7402H89 659 7554253 A>74048< 22 7554912 A>7405B 2316 7554934 A>7405BAO 538 7557250 A>740= 1602 7557788 A>740=0 165 7559390 A>740=85 3144 7559555 A>740=85=0G0;L=>3>>1@070 7 7562699 A>740=85>1J5:B0 5 7562706 A>740=85?@822>45 232 7562711 A>740=88 1515 7562943 A>740=89 6 7564458 A>740=8N 24 7564464 A>740=8O 1367 7564488 A>740==0O 29 7565855 A>740==>3> 255 7565884 A>740==>5 42 7566139 A>740==>9 32 7566181 A>740==>< 5 7566213 A>740==><C 15 7566218 A>740==CN 36 7566233 A>740==K5 141 7566269 A>740==K9 2687 7566410 A>740==K< 9 7569097 A>740==K<8 6 7569106 A>740==KE 168 7569112 A>740=> 108 7569280 A>740=K 66 7569388 A>740B5;52 5 7569454 A>740BL 676 7569459 A>740BLws?@>:A8 16 7570135 A>740BL04<8=8AB@0B>@0 17 7570151 A>740BL04<8=8AB@0B>@0:;0AB5@0 12 7570168 A>740BL0A8=E 23 7570180 A>740BL0B@81CB 30 7570203 A>740BL107C40==KE 25 7570233 A>740BL187=5A?@>F5AA 23 7570258 A>740BL1>B0 15 7570281 A>740BL284@0AG5B0 26 7570296 A>740BL2@5<5==K9D09; 20 7570322 A>740BL2@5<5==K9D09;0A8=E 20 7570342 A>740BL2K@065=85xpath 18 7570362 A>740BL3@C??C 61 7570380 A>740BL42>8G=K540==K587D09;00A8=E 21 7570441 A>740BL48DD5@5=F80;L=CN@575@2=CN:>?8N 22 7570462 A>740BL4>:C<5=B 35 7570484 A>740BL703>;>2>: 131 7570519 A>740BL703>;>2>:B01;8FK 128 7570650 A>740BL7040GC 20 7570778 A>740BL70?8ALA>>1I5=8O 40 7570798 A>740BL70?@>A=0?>;CG5=85;8F5=788=0=>A8B5;5 10 7570838 A>740BL70?@>A=0?>;CG5=85;8F5=788?>B5;5D>=C 10 7570848 A>740BL8=45:A=K9D09; 11 7570858 A>740BL8=AB@C:F8N>1@01>B:8 14 7570869 A>740BL8=B53@0F8N 11 7570883 A>740BL8=D>@<0F8>==CN107C 17 7570894 A>740BL8B5@0B>@C7;>2 29 7570911 A>740BL:0B0;>3 43 7570940 A>740BL:0B0;>30A8=E 28 7570983 A>740BL:;0AB5@ 17 7571011 A>740BL:;85=B0 10 7571028 A>740BL:;NG70?8A8 105 7571038 A>740BL:;NG7=0G5=8O 12 7571143 A>740BL:>;>=:8 19 7571155 A>740BL:><<5=B0@89 29 7571174 A>740BL:><?>=5=BCxs 17 7571203 A>740BL<5=5465@70?8A8 55 7571220 A>740BL<5=5465@7=0G5=8O 19 7571275 A>740BL<>45;L?@>3=>70 56 7571294 A>740BL=01>@ 28 7571350 A>740BL=01>@70?8A59 240 7571378 A>740BL=0AB@>9:CA5@28A0 12 7571618 A>740BL=0G0;L=K9>1@07 32 7571630 A>740BL=>2K9 9 7571662 A>740BL>1AC645=85 11 7571671 A>740BL>1E>445@520 29 7571682 A>740BL>1J5:B 12 7571711 A>740BL>1J5:B2=5H=59:><?>=5=BK0A8=E 11 7571723 A>740BL>3@0=8G5=85?>B@51;5=8O@5AC@A>2 17 7571734 A>740BL?>420;B01;8FK 131 7571751 A>740BL?>;8B8:C 10 7571882 A>740BL?>;=CN@575@2=CN:>?8N 22 7571892 A>740BL?>;L7>20B5;O 30 7571914 A>740BL?>GB>2K9OI8: 11 7571944 A>740BL?@>D8;L157>?0A=>AB8 17 7571955 A>740BL@01>G89A5@25@ 17 7571972 A>740BL@07@5H5==>52=5H=55?@8;>65=85 17 7571989 A>740BL@07@5H5==CN2=5H=NN:><?>=5=BC 17 7572006 A>740BL@07@5H5==K9com:;0AA 17 7572023 A>740BL@07@5H5==K928@BC0;L=K9:0B0;>3 17 7572040 A>740BL@07@5H5==K92=5H=89<>4C;L 17 7572057 A>740BL@07@5H5==K98=B5@=5B@5AC@A 17 7572074 A>740BL@07K<5=>20B5;L?8 23 7572091 A>740BL@53;0<5=B=>57040=85 14 7572114 A>740BLA5:F8Ncdata 14 7572128 A>740BLA>>1I5=85 21 7572142 A>740BLA?8A>: 15 7572163 A>740BLAAK;:C=0ACI=>ABL 14 7572178 A>740BLAE5<Cxml 17 7572192 A>740BLAG5B 19 7572209 A>740BLAG5BG8:?>B@51;5=8O@5AC@A>2 17 7572228 A>740BLB5:AB>2K9C75; 37 7572245 A>740BLB@51>20=85=07=0G5=8O 12 7572282 A>740BLC75; 18 7572294 A>740BLD01@8:Cxdto 18 7572312 A>740BLD09; 22 7572330 A>740BLD>@<0BAB@>: 14 7572352 A>740BLD@03<5=B4>:C<5=B0 14 7572366 A>740BLGB5=85A>>1I5=8O 41 7572380 A>740BLH01;>= 10 7572421 A>740BLM;5<5=B 344 7572431 A>740BLM;5<5=BA?8A:0 12 7572775 A>740BLM;5<5=BKD>@<K?>;L7>20B5;LA:8E=0AB@>5: 42 7572787 A>740NB 3 7572829 A>740NBAO 108 7572832 A>740NI5< 4 7572940 A>740NI89 4 7572944 A>740QB 4 7572948 A>740QBAO 30 7572952 A>:@0B8BL 4 7572982 A>:@0B8BL6C@=0;@538AB@0F88 16 7572986 A>:@0I05B 4 7573002 A>:@0I0BL 4 7573006 A>:@0I5= 36 7573010 A>:@0I5=0 4 7573046 A>:@0I5=85 72 7573050 A>:@0I5=88 36 7573122 A>:@0I5=8O 51 7573158 A>:@0I5==CN 4 7573209 A>:@0I5==K9 44 7573213 A>:@; 23 7573257 A>:@;? 75 7573280 A>:@? 28 7573355 A>;8 4 7573383 A>;8B8 4 7573387 A>;8BL 4 7573391 A>;L 16 7573395 A>;LN 12 7573411 A>< 26 7573423 A><0 26 7573449 A><0;8 22 7573475 A><=>68B5;L 7 7573497 A>>1@065=85 4 7573504 A>>1@065=8O< 4 7573508 A>>1I05BAO 3 7573512 A>>1I0BL>=5A>>B25BAB288>B1>@C 104 7573515 A>>1I0BLAO 3 7573619 A>>1I5=85 3617 7573622 A>>1I5=851 5 7577239 A>>1I5=852 5 7577244 A>>1I5=85ndef 29 7577249 A>>1I5=851;>:8@>2:8 52 7577278 A>>1I5=852=5H=53>A09B0 24 7577330 A>>1I5=852=5H=5<CA09BC 21 7577354 A>>1I5=85< 21 7577375 A>>1I5=85>1>H81:5 40 7577396 A>>1I5=85>1>H81:54;O?>;L7>20B5;O 28 7577436 A>>1I5=85?>;L7>20B5;N 244 7577464 A>>1I5=85?@8703@C7:5 9 7577708 A>>1I5=85A5@28A08=B53@0F88 73 7577717 A>>1I5=85A8AB5<K2708<>459AB28O 150 7577790 A>>1I5=88 88 7577940 A>>1I5=89 577 7578028 A>>1I5=8N 13 7578605 A>>1I5=8O 1883 7578618 A>>1I5=8O< 5 7580501 A>>1I5=8O<8 17 7580506 A>>1I5=8OA8AB5<K2708<>459AB28O 9 7580523 A>>1I5=8OE 4 7580532 A>>1I5=L5 577 7580536 A>>1I5AB2> 4 7581113 A>>1I8; 4 7581117 A>>1I8< 152 7581121 A>>1I8BL 1664 7581273 A>>B25BAB25==> 143 7582937 A>>B25BAB25==K9 143 7583080 A>>B25BAB285 2121 7583223 A>>B25BAB28542865=8O< 9 7585344 A>>B25BAB2854>:C<5=B0< 9 7585353 A>>B25BAB285< 44 7585362 A>>B25BAB285AG5B>2 10 7585406 A>>B25BAB285AG5B>21C8<AD> 5 7585416 A>>B25BAB285AG5B>2A@57?>A;54=8E 6 7585421 A>>B25BAB288 670 7585427 A>>B25BAB289 25 7586097 A>>B25BAB28N 125 7586122 A>>B25BAB28O 322 7586247 A>>B25BAB28O< 5 7586569 A>>B25BAB28O?@>AB@0=AB28<5= 16 7586574 A>>B25BAB2>20;0 6 7586590 A>>B25BAB2>20;8 336 7586596 A>>B25BAB2>20BL 5159 7586932 A>>B25BAB2C5B 1241 7592091 A>>B25BAB2C5BH01;>=C 4 7593332 A>>B25BAB2CNB 526 7593336 A>>B25BAB2CNI0O 125 7593862 A>>B25BAB2CNI53> 706 7593987 A>>B25BAB2CNI55 247 7594693 A>>B25BAB2CNI59 214 7594940 A>>B25BAB2CNI5< 69 7595154 A>>B25BAB2CNI5<C 9 7595223 A>>B25BAB2CNI85 546 7595232 A>>B25BAB2CNI89 5346 7595778 A>>B25BAB2CNI8< 572 7601124 A>>B25BAB2CNI8<8 63 7601696 A>>B25BAB2CNI8E 859 7601759 A>>B25BAB2CNICN 69 7602618 A>>B=>A8BL 5 7602687 A>>B=>H5=85 17 7602692 A>>B=>H5=88 4 7602709 A>>B=>H5=8N 9 7602713 A>>I5=8O 4 7602722 A>?>AB028<>3> 4 7602726 A>?>AB028<K9 4 7602730 A>?>AB02;5=85 145 7602734 A>?>AB02;5=85:>=B5:AB>2>1AC645=89 9 7602879 A>?>AB02;5=85?>;L7>20B5;59 9 7602888 A>?>AB02;5=89 4 7602897 A>?>AB02;5=8O 87 7602901 A>?>AB02;5=L5 4 7602988 A>?>AB02;O5<K9 4 7602992 A>?>AB02;O5B 5 7602996 A>?>AB02;OBL 9 7603001 A>?>AB02;OBLAO 15 7603010 A>?>AB02;ONBAO 5 7603025 A>?@>2>640BLAO 6 7603030 A>?@>2>640NBAO 6 7603036 A>@ 322 7603042 A>@>: 6 7603364 A>@>:0 6 7603370 A>@B 107 7603376 A>@B8@>20BL 177 7603483 A>@B8@>20BL?>7=0G5=8N 18 7603660 A>@B8@>20BL?>?@54AB02;5=8N 17 7603678 A>@B8@>20BLA?8A>: 12 7603695 A>@B8@>20BLA?8A>:?>2>7@0AB0=8N 12 7603707 A>@B8@>20BLA?8A>:?>C1K20=8N 12 7603719 A>@B8@>20BLAO 73 7603731 A>@B8@>2:0 442 7603804 A>@B8@>2:5 4 7604246 A>@B8@>2:8 343 7604250 A>@B8@>2:>9 4 7604593 A>@B8@>2:C 19 7604597 A>@B8@C5B 58 7604616 A>@B8@C5BAO 56 7604674 A>@B8@CNBAO 51 7604730 A>A54=5<C 10 7604781 A>A54=85 14 7604791 A>A54=89 200 7604805 A>A54=8E 8 7605005 A>A;0BLAO 25 7605013 A>AB02 2153 7605038 A>AB020 461 7607191 A>AB0202B>=><=>9:>=D83C@0F88 10 7607652 A>AB025 82 7607662 A>AB028=45:A>2 7 7607744 A>AB02:5 4 7607751 A>AB02:><0=4=>9?0=5;8=0<>18;L=><CAB@>9AB25 9 7607755 A>AB02:><0=4=>9?0=5;8D>@<K=0<>18;L=><CAB@>9AB25 40 7607764 A>AB02:>?88107K40==KE 63 7607804 A>AB02;5=85 5 7607867 A>AB02;5=8O 5 7607872 A>AB02;O5B 15 7607877 A>AB02;O5BAO 88 7607892 A>AB02;OBL 35 7607980 A>AB02;OBLAO 88 7608015 A>AB02;ONB 20 7608103 A>AB02;ONI0O 65 7608123 A>AB02;ONI59 6 7608188 A>AB02;ONI85 10 7608194 A>AB02;ONI89 65 7608204 A>AB02;ONI8< 5 7608269 A>AB02;ONI8<8 3 7608274 A>AB02;ONI8E 27 7608277 A>AB02;ONICN 12 7608304 A>AB02=0O 15 7608316 A>AB02=>3> 75 7608331 A>AB02=>5 5 7608406 A>AB02=>9 302 7608411 A>AB02=>< 6 7608713 A>AB02=><C 4 7608719 A>AB02=CN 8 7608723 A>AB02=K5 14 7608731 A>AB02=K< 29 7608745 A>AB02=KE 81 7608774 A>AB02>1I53>@5:2878B0 24 7608855 A>AB02>< 323 7608879 A>AB02?;0=0>1<5=0 24 7609202 A>AB02?>:070B5;59 5 7609226 A>AB02B01;8G=>3>?@>AB@0=AB20107K40==KE 68 7609231 A>AB02D>@< 5 7609299 A>AB02D>@<=0G0;L=>9AB@0=8FK 29 7609304 A>AB02DC=:F8>=0;L=>9>?F88 47 7609333 A>AB02E@0=8<KE40==KE 15 7609380 A>AB02E@0=8<KE40==KEE@0=8;8I042>8G=KE40==KE 64 7609395 A>AB>8B 272 7609459 A>AB>O; 5 7609731 A>AB>O;0 4 7609736 A>AB>O=85 1125 7609740 A>AB>O=85websocketA>548=5=8O 33 7610865 A>AB>O=85035=B0:;85=BA:>3>?@8;>65=8O 28 7610898 A>AB>O=852=5H=53>8AB>G=8:040==KE 20 7610926 A>AB>O=85:0=0;0A5@28A08=B53@0F88 19 7610946 A>AB>O=85:>?88 9 7610965 A>AB>O=85:>?88107K40==KE 24 7610974 A>AB>O=85< 10 7610998 A>AB>O=85>1=>2;5=8O 9 7611008 A>AB>O=85>1=>2;5=8O:>=D83C@0F88107K40==KE 24 7611017 A>AB>O=85>1=>2;5=8O:>?88107K40==KE 39 7611041 A>AB>O=85>:=0 19 7611080 A>AB>O=85@01>G53>?@>F5AA0 11 7611099 A>AB>O=85@540:B8@>20=8O 10 7611110 A>AB>O=85@540:B8@>20=8O7=0G5=8O4803@0<<K 24 7611120 A>AB>O=85AB@0=8FD>@<K 24 7611144 A>AB>O=85D>=>2>3>7040=8O 41 7611168 A>AB>O=85M;5<5=B0=0AB@>9:8:><?>=>2:840==KE 35 7611209 A>AB>O=88 130 7611244 A>AB>O=89 21 7611374 A>AB>O=8N 31 7611395 A>AB>O=8O 391 7611426 A>AB>O=8O< 6 7611817 A>AB>O=8OB01;8F:>?89107K40==KE 6 7611823 A>AB>O=8OE 14 7611829 A>AB>O=L5 21 7611843 A>AB>OB 5 7611864 A>AB>OBL 687 7611869 A>AB>OI0O 118 7612556 A>AB>OI53> 5 7612674 A>AB>OI55 53 7612679 A>AB>OI59 19 7612732 A>AB>OI5< 5 7612751 A>AB>OI85 4 7612756 A>AB>OI89 239 7612760 A>AB>OI8< 5 7612999 A>AB>OI8E 13 7613004 A>AB>OICN 20 7613017 A>B0O 13 7613037 A>B5= 6 7613050 A>B=O 13 7613056 A>B>20O 18 7613069 A>B>2CN 4 7613087 A>B>2K540==K5 9 7613091 A>B>2K9 22 7613100 A>B@C4=8: 100 7613122 A>B@C4=8:0 32 7613222 A>B@C4=8:8 14 7613254 A>B@C4=8:>2 23 7613268 A>BK9 13 7613291 A>BK<8 7 7613304 A>DB 9 7613311 A>E@0=5= 75 7613320 A>E@0=5=0 13 7613395 A>E@0=5=85 1042 7613408 A>E@0=5=8540==KE2=0AB@>9:0E 13 7614450 A>E@0=5=8540==KE?>;L7>20B5;O 46 7614463 A>E@0=5=8540==KED>@<K2=0AB@>9:0E 19 7614509 A>E@0=5=85< 25 7614528 A>E@0=5=85>D>@<;5=8O:><?>=>2:840==KE 61 7614553 A>E@0=5=85F25B>2 23 7614614 A>E@0=5=88 221 7614637 A>E@0=5=8O 612 7614858 A>E@0=5==0O0CB5=B8D8:0F8O 42 7615470 A>E@0=5==>3> 10 7615512 A>E@0=5==>5 15 7615522 A>E@0=5==K5 97 7615537 A>E@0=5==K9 347 7615634 A>E@0=5==K< 4 7615981 A>E@0=5==KE 45 7615985 A>E@0=5=> 29 7616030 A>E@0=5=K 84 7616059 A>E@0=8< 5 7616143 A>E@0=8B 4 7616148 A>E@0=8BAO 4 7616152 A>E@0=8BL 423 7616156 A>E@0=8BL2;>65=85 9 7616579 A>E@0=8BL40==K52<5AB5A?>4?8ALN 6 7616588 A>E@0=8BL70?@>A=0?>;CG5=85;8F5=788 10 7616594 A>E@0=8BL7=0G5=85 24 7616604 A>E@0=8BL7=0G5=8O 12 7616628 A>E@0=8BL:0: 20 7616640 A>E@0=8BL=0AB@>9:8>BG5B0 12 7616660 A>E@0=8BL=0AB@>9:8?>;L7>20B5;O 11 7616672 A>E@0=8BL=0AB@>9:C?>C<>;G0=8N 12 7616683 A>E@0=8BL?5@A>=0;L=K540==K5 5 7616695 A>E@0=8BL?5@A>=0;L=K540==K5=0A5@25@5 6 7616700 A>E@0=8BLAO 7 7616706 A>E@0=8BLD09; 12 7616713 A>E@0==K9 75 7616725 A>E@0=O5<>3> 16 7616800 A>E@0=O5<>5 20 7616816 A>E@0=O5<>57=0G5=85?0@>;O 36 7616836 A>E@0=O5<>9 5 7616872 A>E@0=O5<><C 6 7616877 A>E@0=O5<K5 57 7616883 A>E@0=O5<K52=0AB@>9:0E40==K5<>48D8F8@>20=K 9 7616940 A>E@0=O5<K540==K5 18 7616949 A>E@0=O5<K5=0AB@>9:8 4 7616967 A>E@0=O5<K9 175 7616971 A>E@0=O5<KE 85 7617146 A>E@0=O5B 195 7617231 A>E@0=O5BAO 123 7617426 A>E@0=OBAO 3 7617549 A>E@0=OBL 332 7617552 A>E@0=OBL0CB5=B8D8:0F8N4;O?>2B>@=>90CB5=B8D8:0F88?>C<>;G0=8N 36 7617884 A>E@0=OBL>B=>A8B5;L=K5?CB8 19 7617920 A>E@0=OBL?>;=K5?CB8 19 7617939 A>E@0=OBL?>C<>;G0=8N 20 7617958 A>E@0=OBLA2>9AB20>B>1@065=8O 11 7617978 A>E@0=OBLAO 311 7617989 A>E@0=ONB 4 7618300 A>E@0=ONBAO 175 7618304 A>E@0=OO 8 7618479 A>E@7=0G 5 7618487 A>G5B0=85 213 7618492 A>G5B0=85:;028H 195 7618705 A>G5B0=85< 16 7618900 A>G5B0=88 15 7618916 A>G5B0=89 4 7618931 A>G5B0=8O 71 7618935 A>G5B0=8OE 16 7619006 A>G5B0=L5 4 7619022 A>N7 7 7619026 A>N70 7 7619033 A?0BL 53 7619040 A?5F 5 7619093 A?5F80;878@>20==0O 4 7619098 A?5F80;878@>20==>9 15 7619102 A?5F80;878@>20==K9 105 7619117 A?5F80;878@>20BL 86 7619222 A?5F80;8AB 18 7619308 A?5F80;8AB0 18 7619326 A?5F80;L=0O 4 7619344 A?5F80;L=> 4 7619348 A?5F80;L=>3> 56 7619352 A?5F80;L=>9 15 7619408 A?5F80;L=>< 30 7619423 A?5F80;L=K5 57 7619453 A?5F80;L=K9 593 7619510 A?5F80;L=K9@568<22>40B5:AB0 50 7620103 A?5F80;L=K< 34 7620153 A?5F80;L=K<8 28 7620187 A?5F80;L=KE 335 7620215 A?5F8D8:0 4 7620550 A?5F8D8:0B>@ 5 7620554 A?5F8D8:0B>@K 5 7620559 A?5F8D8:0F859 5 7620564 A?5F8D8:0F88 151 7620569 A?5F8D8:0F8N 22 7620720 A?5F8D8:0F8O 194 7620742 A?5F8D8:8 4 7620936 A?5F8D8G5A:85 5 7620940 A?5F8D8G5A:89 8 7620945 A?5F8D8G5A:8E 3 7620953 A?5F8D8G=0O 4 7620956 A?5F8D8G=K5 162 7620960 A?5F8D8G=K9 181 7621122 A?5F8D8G=KE 10 7621303 A?5FA8<2>; 68 7621313 A?5FA8<2>;K 4 7621381 A?84 5 7621385 A?8A0=85B>20@>2 5 7621390 A?8A:0 5267 7621395 A?8A:0<8 44 7626662 A?8A:0E 33 7626706 A?8A:5 1073 7626739 A?8A:8 330 7627812 A?8A:8>B7K20A5@B8D8:0B>2>1=>2;5=K 4 7628142 A?8A:>2 262 7628146 A?8A:>2K9 14 7628408 A?8A:>2K< 10 7628422 A?8A:>2KE 4 7628432 A?8A:>< 453 7628436 A?8A:C 62 7628889 A?8A> 4 7628951 A?8A>: 9934 7628955 A?8A>:xdto 71 7638889 A?8A>:03@530B>2@538AB@>2=0:>?;5=8O 6 7638960 A?8A>:2K1>@0 104 7638966 A?8A>:2K1>@0=02830F8>==>9AAK;:8 53 7639070 A?8A>:4>:C<5=B>2 6 7639123 A?8A>:4>?CAB8<KE7=0G5=89 12 7639129 A?8A>:7=0G5=89 667 7639141 A?8A>::><?>=5=Bxs 114 7639808 A?8A>::>?89107K40==KE 6 7639922 A?8A>::C@AK20;NB 5 7639928 A?8A>:=02830F8>=KEAAK;>: 24 7639933 A?8A>:>1>@C4>20=8O 9 7639957 A?8A>:>1J5:B>2 5 7639966 A?8A>:?0@0<5B@>2 6 7639971 A?8A>:?>8A:0 4 7639977 A?8A>:?>;59 123 7639981 A?8A>:?>;=>B5:AB>2>3>?>8A:0 115 7640104 A?8A>:?>;CG0B5;59 15 7640219 A?8A>:?@>25@:8@0A:@KB8O?0@>;O 57 7640234 A?8A>:?@>25@:8@0A:@KB8O?0@>;O<0AA82 5 7640291 A?8A>:@01>B=8:>2 11 7640296 A?8A>:@0AH8@5==KE8<5=xml 45 7640307 A?8A>:@538AB@0 6 7640352 A?8A>:A2>9AB2 8 7640358 A?8A>:A>E@0=5=8O 7 7640366 A?8A>:A?@02>G=8:0 5 7640373 A?8A>:AAK;>: 16 7640378 A?8A>:AB5:CI8<8=0AB@>9:0<8 9 7640394 A?8A>:AB5:CI8<8=0AB@>9:0<88AB@>:>9 9 7640403 A?8A>:AB@>:dom 32 7640412 A?8A>:AG5B>2 6 7640444 A?8A>:B8?>24>:C<5=B>2 5 7640450 A?8A>:B8?>2F5= 81 7640455 A?8A>:C40;O5<KE 5 7640536 A?8A>:C7;>2dom 67 7640541 A?8A>:C7;>2html 131 7640608 A?8A>:M;5<5=B>2dom 128 7640739 A?;09= 12 7640867 A?;09=0 4 7640879 A?;09=>2 8 7640883 A?;8B 27 7640891 A?;>H=0O 69 7640918 A?;>H=>5 4 7640987 A?;>H=>9 95 7640991 A?;>H=K< 8 7641086 A?>4G8=5==K<8 46 7641094 A?>78F8>=8@>20= 4 7641140 A?>78F8>=8@>20=0 44 7641144 A?>78F8>=8@>20==0O 4 7641188 A?>78F8>=8@>20==>9 4 7641192 A?>78F8>=8@>20BL 10 7641196 A?>78F8>=8@>20BLAO 13 7641206 A?>78F8>=8@C5BAO 8 7641219 A?>A>1 1784 7641227 A?>A>1pop30CB5=B8D8:0F88 9 7643011 A?>A>1smtp0CB5=B8D8:0F88 9 7643020 A?>A>10 111 7643029 A?>A>10<8 53 7643140 A?>A>10CB5=B8D8:0F88 66 7643193 A?>A>10CB5=B8D8:0F88?>;L7>20B5;O8=D>@<0F8>==>9107K 106 7643259 A?>A>10CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 66 7643365 A?>A>10E 4 7643431 A?>A>118><5B@8G5A:>9?@>25@:8 33 7643435 A?>A>12>AAB0=>2;5=8O=0AB@>5::><?>=>2:840==KE 20 7643468 A?>A>12>AAB0=>2;5=8O?0@>;O 45 7643488 A?>A>12>AAB0=>2;5=8O?0@>;O?>;L7>20B5;O8=D>@<0F8>==>9107K 29 7643533 A?>A>12K1>@0 98 7643562 A?>A>12K1>@0A5@B8D8:0B0macos 36 7643660 A?>A>12K1>@0A5@B8D8:0B0windows 43 7643696 A?>A>12K1>@0A5@B8D8:0B0>A 40 7643739 A?>A>12K1>@:8 17 7643779 A?>A>14>?>;=8B5;L=>9?@>25@:8?>;L7>20B5;O 35 7643796 A?>A>15 10 7643831 A?>A>170?>;=5=8OB5:AB0703>;>2:0 9 7643841 A?>A>170?>;=5=8OB5:AB0703>;>2:0H:0;K4803@0<<K 24 7643850 A?>A>170?@>A0>1=>2;5=8O 29 7643874 A?>A>170I8BK4>ABC?0 28 7643903 A?>A>170I8BK4>ABC?0157>?0A=>3>E@0=8;8I0 32 7643931 A?>A>1:>48@>20=8O 18 7643963 A?>A>1:>48@>20=8O8=B5@=5B?>GB>2>3>2;>65=8O 19 7643981 A?>A>1:>48@>20=8O=5asciiA8<2>;>2 17 7644000 A?>A>1:>48@>20=8O=5asciiA8<2>;>28=B5@=5B?>GB>2>3>A>>1I5=8O 28 7644017 A?>A>1:>48@>20=8OAB@>:8 43 7644045 A?>A>1=K9 5 7644088 A?>A>1=KE 5 7644093 A?>A>1>2 104 7644098 A?>A>1>< 144 7644202 A?>A>1>?@545;5=8O<0:A8<0;L=>3>7=0G5=8O 13 7644346 A?>A>1>?@545;5=8O<8=8<0;L=>3>7=0G5=8O 13 7644359 A?>A>1>?@545;5=8O>3@0=8G820NI53>7=0G5=8O4803@0<<K 28 7644372 A?>A>1>B>1@065=8O>:=0 15 7644400 A?>A>1?5@5B0A:820=8OD09;>2 46 7644415 A?>A>1?>8A:0AB@>:8 126 7644461 A?>A>1?>8A:0AB@>:8?@822>45?>AB@>:5 243 7644587 A?>A>1?>;CG5=8O:><?>=5=B 5 7644830 A?>A>1?>;CG5=8O:><?>=5=BA2O7=>AB8@0AG5B0A8AB5<;8=59=KEC@02=5=89 24 7644835 A?>A>1?@>25@:8 16 7644859 A?>A>1?@>25@:8?>4?8A8<>18;L=>3>:;85=B0 29 7644875 A?>A>1?@>25@:8?>;L7>20B5;O 5 7644904 A?>A>1@0A?@545;5=8O 6 7644909 A?>A>1@540:B8@>20=8O 231 7644915 A?>A>1@540:B8@>20=8OA?8A:0 55 7645146 A?>A>1A@02=5=8O 14 7645201 A?>A>1A@02=5=8OD09;>2 24 7645215 A?>A>1AB2>20BL 12 7645239 A?>A>1C 42 7645251 A?>A>1GB5=8O7=0G5=89 8 7645293 A?>A>1GB5=8O7=0G5=89B01;8G=>3>4>:C<5=B0 21 7645301 A?>A>1K 54 7645322 A?>AV1 243 7645376 A?@ 12 7645619 A?@020 321 7645631 A?@02025@B8:0;L=> 9 7645952 A?@0203>@87>=B0;L=> 9 7645961 A?@020=0;52> 14 7645970 A?@0254;82> 18 7645984 A?@0254;82K9 18 7646002 A?@02:0 460 7646020 A?@02:0D>@<K 17 7646480 A?@02:8 164 7646497 A?@02:C 89 7646661 A?@02>G8:AAK;:0 18 7646750 A?@02>G=0O 52 7646768 A?@02>G=8: 4580 7646820 A?@02>G=8:1 30 7651400 A?@02>G=8:0 2450 7651430 A?@02>G=8:0< 14 7653880 A?@02>G=8:0<8 16 7653894 A?@02>G=8:0E 9 7653910 A?@02>G=8:2K1>@:0 136 7653919 A?@02>G=8:5 60 7654055 A?@02>G=8:8 1030 7654115 A?@02>G=8:8<5=5465@ 30 7655145 A?@02>G=8:<5=5465@ 230 7655175 A?@02>G=8:>1J5:B 587 7655405 A?@02>G=8:>2 214 7655992 A?@02>G=8:>< 16 7656206 A?@02>G=8:A?8A>: 136 7656222 A?@02>G=8:A?8A>:?@8?>;CG5=8840==KE 4 7656358 A?@02>G=8:AAK;:0 504 7656362 A?@02>G=8:B01;8G=0OG0ABL 24 7656866 A?@02>G=8:B01;8G=0OG0ABLAB@>:0 5 7656890 A?@02>G=8:C 16 7656895 A?@02>G=>9 41 7656911 A?@02>G=CN 11 7656952 A?@02>G=K9 52 7656963 A?@0H820BL?>;L7>20B5;O 9 7657015 A?@:>=B@035=BK 7 7657024 A?@>: 4 7657031 A?@OB0BL 7 7657035 A?CB=8: 4 7657042 A?CB=8:8 4 7657046 A?OI53> 46 7657050 A?OI5< 10 7657096 A?OI89 109 7657106 A?OI89A50=A 11 7657215 A@010BK20=85 22 7657226 A@010BK20=8O 22 7657248 A@01>B05B 36 7657270 A@01>B0BL 36 7657306 A@02=5=85 1382 7657342 A@02=5=857=0G5=89 46 7658724 A@02=5=85< 220 7658770 A@02=5=85D09;>2 60 7658990 A@02=5=88 87 7659050 A@02=5=8N 56 7659137 A@02=5=8O 663 7659193 A@02=8205<>3> 8 7659856 A@02=8205<>5 112 7659864 A@02=8205<K9 295 7659976 A@02=8205<KE 7 7660271 A@02=8205B 181 7660278 A@02=8205BAO 6 7660459 A@02=820BL 365 7660465 A@02=820BLAO 83 7660830 A@02=820NBAO 77 7660913 A@02=820O 4 7660990 A@02=8BL 62 7660994 A@02=8BL?>78F8N24>:C<5=B5 436 7661056 A@02=8BLB01;8FK7=0G5=89 6 7661492 A@07C 282 7661498 A@54 24 7661780 A@540 101 7661804 A@545 40 7661905 A@548 475 7661945 A@54=53> 24 7662420 A@54=55 162 7662444 A@54=55:>;8G5AB2>?>B>:>2 11 7662606 A@54=55>B:@KB8O870:@KB8O 9 7662617 A@54=59 4 7662626 A@54=5<C 4 7662630 A@54=85 4 7662634 A@54=858=B5@20;K 9 7662638 A@54=89 269 7662647 A@54=8970@01>B>: 12 7662916 A@54=89:C@A 7 7662928 A@54=89@07<5@>1J5:B0 9 7662935 A@54=8E 48 7662944 A@54=NN 6 7662992 A@54=OO 23 7662998 A@54=OO4;8B5;L=>ABL2K7>20 11 7663021 A@54=OO4;8B5;L=>ABL2K7>2>2A5@28A>2 11 7663032 A@54=OO4;8B5;L=>ABL2K7>2>2AC14 11 7663043 A@54=OO4;8B5;L=>ABL>1@01>B:82K7>20@01>G8<?@>F5AA>< 11 7663054 A@54AB2 113 7663065 A@54AB20 644 7663178 A@54AB20nfc 21 7663822 A@54AB201CD5@0>1<5=0 46 7663843 A@54AB2035>?>78F8>=8@>20=8O 112 7663889 A@54AB20:@8?B>3@0D88 39 7664001 A@54AB20< 64 7664040 A@54AB20<8 362 7664104 A@54AB20<C;LB8<5480 168 7664466 A@54AB20>B>1@065=8O@5:;0<K 10 7664634 A@54AB20?5@540G840==KE=0CAB@>9AB25 10 7664644 A@54AB20?>GBK 28 7664654 A@54AB20B5;5D>=88 121 7664682 A@54AB20CAB@>9AB20 10 7664803 A@54AB2> 664 7664813 A@54AB2>< 14 7665477 A@54C 16 7665491 A@54K 19 7665507 A@57 76 7665526 A@570 38 7665602 A@575 4 7665640 A@57>2 5 7665644 A@57?5@2KE 22 7665649 A@57?>A;54=8E 27 7665671 A@57C 8 7665698 A@>: 101 7665706 A@>:0 28 7665807 A@>:0< 4 7665835 A@>:0E 5 7665839 A@>:459AB28O:>40?>4B25@645=8O 54 7665844 A@>:459AB28O:>40?>4B25@645=8O0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 7665898 A@>:8A?>;=5=8O 11 7665934 A@>:8A?>;=5=8O70:070 10 7665945 A@>:>< 17 7665955 A@>:?@54C?@5645=8O>18AB5G5=88A@>:0459AB28O?0@>;59 57 7665972 A@>:?@54C?@5645=8O>18AB5G5=88A@>:0459AB28O?0@>;59?>;L7>20B5;59 42 7666029 AA 24 7666071 AAz 4 7666095 AAK;05BAO 47 7666099 AAK;0BLAO 238 7666146 AAK;0NBAO 168 7666384 AAK;0NI85AO 4 7666552 AAK;0NI89AO 4 7666556 AAK;:0 6213 7666560 AAK;:0< 26 7672773 AAK;:0<8 32 7672799 AAK;:0=0:;NG 9 7672831 AAK;:0=0=587<5==K9uri 6 7672840 AAK;:0=0>1J5:B 7 7672846 AAK;:0=0A1 7 7672853 AAK;:0=0A2 7 7672860 AAK;:0=0AB8;L 6 7672867 AAK;:0=0ACI=>ABL 476 7672873 AAK;:0=0ACI=>ABLdom 802 7673349 AAK;:0=0D09; 189 7674151 AAK;:0=0M;5<5=B 25 7674340 AAK;:5 401 7674365 AAK;:8 2458 7674766 AAK;:8=0D09;K 16 7677224 AAK;:>9 126 7677240 AAK;:C 1204 7677366 AAK;>: 668 7678570 AAK;>G=0O 4 7679238 AAK;>G=>3> 32 7679242 AAK;>G=>5 20 7679274 AAK;>G=>9 40 7679294 AAK;>G=><C 5 7679334 AAK;>G=K5 11 7679339 AAK;>G=K9 165 7679350 AAK;>G=K9:;NG 12 7679515 AAK;>G=K<8 5 7679527 AAK;>G=KE 43 7679532 AB018;L=0O 4 7679575 AB018;L=K9 4 7679579 AB028B 8 7679583 AB028B8 5 7679591 AB028B8AO 6 7679596 AB028BAO 24 7679602 AB028BL 13 7679626 AB028BLAO 25 7679639 AB02:0=4A 11 7679664 AB02I 5 7679675 AB06 8 7679680 AB0; 277 7679688 AB0;0 287 7679965 AB0;89 10 7680252 AB0;L=>9 10 7680262 AB0;L=K< 10 7680272 AB0=40@B 422 7680282 AB0=40@B0 67 7680704 AB0=40@B5 85 7680771 AB0=40@B870F88 8 7680856 AB0=40@B870F8O 9 7680864 AB0=40@B878@>20BL 14 7680873 AB0=40@B=0O 1112 7680887 AB0=40@B=0O3@C??0:><0=4 64 7681999 AB0=40@B=0O40B0=0G0;0 50 7682063 AB0=40@B=0O:0@B8=:0 4 7682113 AB0=40@B=0O:><0=402E>4OI53>70?@>A0?>45;8BLAO 30 7682117 AB0=40@B=0O:><0=40?;0=8@>2I8:0 60 7682147 AB0=40@B=0O:><0=40?>;O22>40 71 7682207 AB0=40@B=0O:><0=40?>;O?;0=8@>2I8:0 55 7682278 AB0=40@B=0O:><0=40A8AB5<K2708<>459AB28O 79 7682333 AB0=40@B=0O=0AB@>9:0:><?>=>2:840==KE 12 7682412 AB0=40@B=0O>1@01>B:0 1352 7682424 AB0=40@B=89 445 7683776 AB0=40@B=>3> 404 7684221 AB0=40@B=>5 190 7684625 AB0=40@B=>5>B:;>=5=85 9 7684815 AB0=40@B=>5>D>@<;5=85 130 7684824 AB0=40@B=>5E@0=8;8I5=0AB@>5:2K1>@:0 55 7684954 AB0=40@B=>5E@0=8;8I5=0AB@>5:2K1>@:0=0AB@>5:?>C<>;G0=8N 36 7685009 AB0=40@B=>5E@0=8;8I5=0AB@>5:<5=5465@ 185 7685045 AB0=40@B=>9 1460 7685230 AB0=40@B=>< 36 7686690 AB0=40@B=><C 44 7686726 AB0=40@B=CN 42 7686770 AB0=40@B=K5 155 7686812 AB0=40@B=K5=0AB@>9:8 11 7686967 AB0=40@B=K5?>;L7>20B5;8 9 7686978 AB0=40@B=K5?>;L7>20B5;8A8AB5<K2708<>459AB28O 14 7686987 AB0=40@B=K5@5:2878BK 197 7687001 AB0=40@B=K5B01;8G=K5G0AB8 23 7687198 AB0=40@B=K9 3477 7687221 AB0=40@B=K92843;>10;L=>3>?>8A:0 105 7690698 AB0=40@B=K9?5@8>4 177 7690803 AB0=40@B=K9@5:2878B 4 7690980 AB0=40@B=K9@5:2878BAB0=40@B=0OB01;8G=0OG0ABL 14 7690984 AB0=40@B=K9D>@<0B40==KE1CD5@0>1<5=0 45 7690998 AB0=40@B=K< 137 7691043 AB0=40@B=K<8 30 7691180 AB0=40@B=KE 706 7691210 AB0=40@B>< 176 7691916 AB0=40@BC 66 7692092 AB0=40@BK 4 7692158 AB0=5B 23 7692162 AB0=8F0 4 7692185 AB0=>28BAO 331 7692189 AB0=>28BLAO 406 7692520 AB0=>2OBAO 75 7692926 AB0=CB 8 7693001 AB0@0O 19 7693009 AB0@89 272 7693028 AB0@>3> 253 7693300 AB0@>5 298 7693553 AB0@>57=0G5=85 5 7693851 AB0@>5:@C652> 12 7693856 AB0@>9 27 7693868 AB0@B 327 7693895 AB0@B0 105 7694222 AB0@B187=5A?@>F5AA0 12 7694327 AB0@B5 50 7694339 AB0@B>20= 51 7694389 AB0@B>20==K9 51 7694440 AB0@B>20BL 31 7694491 AB0@B>2K9 16 7694522 AB0@B>< 5 7694538 AB0@C20B8 6 7694543 AB0@CN 6 7694549 AB0@H0O 4 7694555 AB0@H5 26 7694559 AB0@H53> 52 7694585 AB0@H55 4 7694637 AB0@H59 11 7694641 AB0@H5<C 28 7694652 AB0@H89 112 7694680 AB0@H8=AB20 6 7694792 AB0@H8=AB2> 6 7694798 AB0@K5 24 7694804 AB0@K9 422 7694828 AB0@K9?8=:>4 9 7695250 AB0@K9C75; 252 7695259 AB0@K< 40 7695511 AB0@K<8 24 7695551 AB0@KE 4 7695575 AB0B8 10 7695579 AB0B8AB8: 117 7695589 AB0B8AB8:0 123 7695706 AB0B8AB8:070?@>A>2 6 7695829 AB0B8AB8:08A?>;L7>20=8O?@8;>65=8O 19 7695835 AB0B8AB8:0=0G0;L=>3>>1=>2;5=8O:>?89107K40==KE 6 7695854 AB0B8AB8:0B5:CI53>>1=>2;5=8O:>?89107K40==KE 6 7695860 AB0B8AB8:5 13 7695866 AB0B8AB8:8 78 7695879 AB0B8AB8:>9 9 7695957 AB0B8AB8:C 6 7695966 AB0B8AB8G5A:89 4 7695972 AB0B8AB8G5A:>9 4 7695976 AB0B8G5A:89 4 7695980 AB0B8G5A:>3> 4 7695984 AB0BCA 259 7695988 AB0BCA0 25 7696247 AB0BCA2>AAB0=>2;5=8O 9 7696272 AB0BCA2>AAB0=>2;5=8O872K3@C7:840==KEA8AB5<K2708<>459AB28O 19 7696281 AB0BCA2K3@C7:840==KEA8AB5<K2708<>459AB28O 34 7696300 AB0BCA>2 40 7696334 AB0BCA>< 25 7696374 AB0BCA>?>25I5=8O?>;L7>20B5;O 44 7696399 AB0BCA@071>@0 9 7696443 AB0BCA@071>@08=B5@=5B?>GB>2>3>A>>1I5=8O 19 7696452 AB0BCA@5:;0<K 41 7696471 AB0BCAA>>1I5=8O 64 7696512 AB0BCAB@0=70:F88 22 7696576 AB0BCAB@0=70:F8870?8A86C@=0;0@538AB@0F88 31 7696598 AB0BL 331 7696629 AB5: 36 7696960 AB5:0 36 7696996 AB5:5 7 7697032 AB5:;> 4 7697039 AB5:;>< 4 7697043 AB5:C 6 7697047 AB5? 49 7697053 AB5?0 49 7697102 AB5?5=8 21 7697151 AB5?5==0O 4 7697172 AB5?5==>9 10 7697176 AB5?5==K9 10 7697186 AB5?5=L 82 7697196 AB5?5=LA60B8O 5 7697278 AB5@5> 9 7697283 AB5@5>D>=8G5A:0O 4 7697292 AB5@5>D>=8G5A:89 4 7697296 AB5GL 23 7697300 AB8;5 113 7697323 AB8;52>9 4 7697436 AB8;59 51 7697440 AB8;5< 9 7697491 AB8;8 16 7697500 AB8;L 961 7697516 AB8;L3@0=8FK 26 7698477 AB8;L;8=88 23 7698503 AB8;L>B>1@065=8O 16 7698526 AB8;LAB@5;:8 28 7698542 AB8;N 5 7698570 AB8;O 183 7698575 AB8;O< 5 7698758 AB> 19 7698763 AB>8<>AB8 9 7698782 AB>8<>ABL 17 7698791 AB>8<>ABL?@>4C:F88 6 7698808 AB>8B 26 7698814 AB>8BL 62 7698840 AB>; 94 7698902 AB>;0 16 7698996 AB>;15F 51 7699012 AB>;18: 16 7699063 AB>;18:0 8 7699079 AB>;18:>2 4 7699087 AB>;18:>< 4 7699091 AB>;1F0 13 7699095 AB>;1F0<8 12 7699108 AB>;1F0E 4 7699120 AB>;1F>2 10 7699124 AB>;1FK 33 7699134 AB>;5 10 7699167 AB>;5B85 19 7699177 AB>;5B8O 19 7699196 AB>;>< 4 7699215 AB>;L:> 73 7699219 AB>= 9 7699292 AB>? 5 7699301 AB>?0 17 7699306 AB>@=8@>20=85 10 7699323 AB>@=8@>20=8O 9 7699333 AB>@=8@C5<K9 6 7699342 AB>@=8@C5<KE 6 7699348 AB>@=8@CNI0O 10 7699354 AB>@=8@CNI59 10 7699364 AB>@=8@CNI89 12 7699374 AB>@=> 85 7699386 AB>@=>70?8A8 7 7699471 AB>@>= 27 7699478 AB>@>=0 473 7699505 AB>@>=0< 5 7699978 AB>@>=5 261 7699983 AB>@>==55 15 7700244 AB>@>==89 27 7700259 AB>@>==8<8 12 7700286 AB>@>=>9 5 7700298 AB>@>=C 74 7700303 AB>@>=K 103 7700377 AB>B8=:0 11 7700480 AB>B8=:8 8 7700491 AB>OBL 67 7700499 AB>OI85 32 7700566 AB>OI89 68 7700598 AB@ 62 7700666 AB@1 19 7700728 AB@2 14 7700747 AB@3 14 7700761 AB@html 13 7700775 AB@json 4 7700788 AB@xml 23 7700792 AB@0= 5 7700815 AB@0=0 113 7700820 AB@0=0?@>8AE>645=8O 11 7700933 AB@0=0F5=B@0;8F5=78@>20=8O 15 7700944 AB@0=8F 277 7700959 AB@0=8F0 1075 7701236 AB@0=8F0pdf 57 7702311 AB@0=8F0< 14 7702368 AB@0=8F0<8 18 7702382 AB@0=8F0?0=5;8 98 7702400 AB@0=8F0A:0=8@>20=8O4>:C<5=B>2 37 7702498 AB@0=8F0E 8 7702535 AB@0=8F2A53> 5 7702543 AB@0=8F5 171 7702548 AB@0=8F59 14 7702719 AB@0=8FC 114 7702733 AB@0=8FK 597 7702847 AB@0=8FK?0=5;8 74 7703444 AB@0=K 48 7703518 AB@0E>2>9=><5@ 6 7703566 AB@4;8=0 23 7703572 AB@5;:0 214 7703595 AB@5;:0225@E 9 7703809 AB@5;:0225@E2=87 9 7703818 AB@5;:02;52> 9 7703827 AB@5;:02;52>2?@02> 9 7703836 AB@5;:02=87 9 7703845 AB@5;:02?@02> 9 7703854 AB@5;:0:>=F0 13 7703863 AB@5;:0=0G0;0 13 7703876 AB@5;:5 40 7703889 AB@5;:8 61 7703929 AB@5;:>9 4 7703990 AB@5;>: 210 7703994 AB@5<8BLAO 5 7704204 AB@5<OBAO 5 7704209 AB@70:0=G8205BAO=0 22 7704214 AB@70<5=8BL 23 7704236 AB@70<5=8BL?>@53C;O@=><C2K@065=8N 14 7704259 AB@:>0 4 7704273 AB@=09B8 30 7704277 AB@=09B82A5?>@53C;O@=><C2K@065=8N 11 7704307 AB@=09B882K45;8BL>D>@<;5=85< 11 7704318 AB@=09B8?>@53C;O@=><C2K@065=8N 17 7704329 AB@=0G8=05BAOA 22 7704346 AB@>30BL 10 7704368 AB@>30O 10 7704378 AB@>389 105 7704388 AB@>3> 78 7704493 AB@>5=85 5 7704571 AB@>8B 5 7704576 AB@>8BAO 129 7704581 AB@>8BL 25 7704710 AB@>8BLAO 137 7704735 AB@>9 10 7704872 AB@>: 7857 7704882 AB@>:0 32412 7712739 AB@>:01 6 7745151 AB@>:02 6 7745157 AB@>:0guid 5 7745163 AB@>:0html 5 7745168 AB@>:0json 5 7745173 AB@>:0xml 21 7745178 AB@>:0xsl 5 7745199 AB@>:004@5A0 17 7745204 AB@>:004@5A04>?>;=8B5;L=0O 9 7745221 AB@>:004@5A0>A=>2=0O 9 7745230 AB@>:03@C??8@>2:848=0<8G5A:>3>A?8A:0 26 7745239 AB@>:040==KE 6 7745265 AB@>:045@520 5 7745271 AB@>:045@5207=0G5=89 113 7745276 AB@>:048=0<8G5A:>3>A?8A:0 23 7745389 AB@>:04>: 6 7745412 AB@>:04>:C<5=B0 5 7745418 AB@>:0:>40 8 7745423 AB@>:0:><0=4K 35 7745431 AB@>:0< 67 7745466 AB@>:0<5=N 11 7745533 AB@>:0<8 37 7745544 AB@>:0=08<5=>20=8O 16 7745581 AB@>:0?0@0<5B@>22=5H=53>C?@02;5=8OA50=A0<8 47 7745597 AB@>:0?>4A:07:8 5 7745644 AB@>:0?>8A:0 212 7745649 AB@>:0?>@O4:0 6 7745861 AB@>:0@57C;LB0B 6 7745867 AB@>:0A8<2>;>2 12 7745873 AB@>:0A>548=5=8O 50 7745885 AB@>:0A>548=5=8O8=D>@<0F8>==>9107K 11 7745935 AB@>:0A>@B8@>2:8 6 7745946 AB@>:0A>AB020 12 7745952 AB@>:0AG8A;>< 13 7745964 AB@>:0B01;8FK 33 7745977 AB@>:0B01;8FK7=0G5=89 86 7746010 AB@>:0B01;8FK>1;0AB8:><?>=>2:840==KE 50 7746096 AB@>:0B>20@ 63 7746146 AB@>:0D?4 8 7746209 AB@>:0E 243 7746217 AB@>:0F8D@ 5 7746460 AB@>:5 1350 7746465 AB@>:8 4509 7747815 AB@>:845@5207=0G5=89 6 7752324 AB@>:848=0<8G5A:>3>A?8A:0 24 7752330 AB@>:8:C40;5=8N 7 7752354 AB@>:8A>AB020 70 7752361 AB@>:8D?4 7 7752431 AB@>:>2 5 7752438 AB@>:>20O 9 7752443 AB@>:>289 455 7752452 AB@>:>2>3> 368 7752907 AB@>:>2>5 644 7753275 AB@>:>2>57=0G5=85 9 7753919 AB@>:>2>< 5 7753928 AB@>:>2><C 91 7753933 AB@>:>2K5 31 7754024 AB@>:>2K9 1029 7754055 AB@>:>2K< 28 7755084 AB@>:>2K<8 4 7755112 AB@>:>2KE 72 7755116 AB@>:>9 388 7755188 AB@>:C 2081 7755576 AB@>G:0 6 7757657 AB@>G:8 6 7757663 AB@>G=>9 22 7757669 AB@>G=K5 22 7757691 AB@>G=K9 22 7757713 AB@>G>: 6 7757735 AB@>O 10 7757741 AB@>OBAO 4 7757751 AB@?>4:;NG5=8O 16 7757755 AB@?>4>1=0?>@53C;O@=><C2K@065=8N 12 7757771 AB@?>;CG8BLAB@>:C 12 7757783 AB@?CBL:40==K< 5 7757795 AB@@0745;8BL 16 7757800 AB@A>548=8BL 16 7757816 AB@A>>1I5=8O 13 7757832 AB@A@02=8BL 11 7757845 AB@AAK;:0 7 7757856 AB@C:B14 6 7757863 AB@C:B>@>9 36 7757869 AB@C:BC@ 54 7757905 AB@C:BC@0 4406 7757959 AB@C:BC@04;O>B1>@0 7 7762365 AB@C:BC@0:>=D83C@0F88 6 7762372 AB@C:BC@0=0AB@>5::><?>=>2:840==KE 75 7762378 AB@C:BC@0=0AB@>9:8 7 7762453 AB@C:BC@0?>8A:0 8 7762460 AB@C:BC@0@5:2878B>2 46 7762468 AB@C:BC@5 168 7762514 AB@C:BC@8@>20==0O 20 7762682 AB@C:BC@8@>20==>9 4 7762702 AB@C:BC@8@>20==CN 5 7762706 AB@C:BC@8@>20==K9 29 7762711 AB@C:BC@=K5 4 7762740 AB@C:BC@=K9 4 7762744 AB@C:BC@>9 641 7762748 AB@C:BC@C 358 7763389 AB@C:BC@K 1633 7763747 AB@G8A;>2E>645=89 12 7765380 AB@G8A;>AB@>: 17 7765392 AB@H01;>= 13 7765409 ABC; 63 7765422 ABC;0 6 7765485 ABC?5=L 4 7765491 ABC?5=O<8 4 7765495 ABC?V=L 4 7765499 ABV; 20 7765503 AC0E8;8 18 7765523 AC11>B0 36 7765541 AC11>BC 24 7765577 AC14 300 7765601 AC1:>=B> 959 7765901 AC1:>=B>1 62 7766860 AC1:>=B>2 49 7766922 AC1:>=B>4B 96 7766971 AC1:>=B>4B1 18 7767067 AC1:>=B>4B2 12 7767085 AC1:>=B>:B 97 7767097 AC1:>=B>:B1 6 7767194 AC1:>=B>:B2 6 7767200 AC1AG5B 4 7767206 AC1AG5B>2 4 7767210 AC1J5:B 31 7767214 AC1J5:B0 21 7767245 AC1J5:B5 4 7767266 AC1L5:B0 4 7767270 AC40= 12 7767274 AC< 18 7767286 AC<< 12 7767304 AC<<0 533 7767316 AC<<02A53> 6 7767849 AC<<04>:C<5=B0 10 7767855 AC<<0>1>@>B 6 7767865 AC<<0@=0O 6 7767871 AC<<0@=>3> 10 7767877 AC<<0@=>5 30 7767887 AC<<0@=K9 91 7767917 AC<<5 15 7768008 AC<<8@>20=85 138 7768023 AC<<8@>20=88 76 7768161 AC<<8@>20=8O 94 7768237 AC<<8@>20==K9 12 7768331 AC<<8@>20==K<8 12 7768343 AC<<8@>20BL 95 7768355 AC<<8@>20BLAO 39 7768450 AC<<8@C5<K9 5 7768489 AC<<8@C5<KE 5 7768494 AC<<8@C5B 65 7768499 AC<<8@CNBAO 39 7768564 AC<<>9 10 7768603 AC<<C 64 7768613 AC<<K 113 7768677 AC<K 18 7768790 AC??>@B 36 7768808 AC?@C3 14 7768844 AC?@C30 14 7768858 AC@@>30B=>9 4 7768872 AC@@>30B=K9 4 7768876 ACB:8 35 7768880 ACB>: 23 7768915 ACBL 4 7768938 ACDD8:A 19 7768942 ACDD8:A8<5=8 9 7768961 ACI5AB25==> 39 7768970 ACI5AB25==>5 4 7769009 ACI5AB25==CN 5 7769013 ACI5AB25==K9 53 7769018 ACI5AB25==K< 4 7769071 ACI5AB25==KE 5 7769075 ACI5AB2>20;8 4 7769080 ACI5AB2>20=85 28 7769084 ACI5AB2>20=8O 17 7769112 ACI5AB2>20BL 2083 7769129 ACI5AB2C5B 1627 7771212 ACI5AB2C5B0A8=E 18 7772839 ACI5AB2CNB 197 7772857 ACI5AB2CNI53> 240 7773054 ACI5AB2CNI55 4 7773294 ACI5AB2CNI59 57 7773298 ACI5AB2CNI5< 4 7773355 ACI5AB2CNI5<C 26 7773359 ACI5AB2CNI85 89 7773385 ACI5AB2CNI89 286 7773474 ACI5AB2CNI8< 241 7773760 ACI5AB2CNI8<8 18 7774001 ACI5AB2CNI8E 268 7774019 ACI5AB2CNICN 23 7774287 ACI=>AB59 235 7774310 ACI=>AB8 241 7774545 ACI=>ABL 859 7774786 ACI=>ABLdom 849 7775645 ACI=>ABLN 4 7776494 AD5@0 6 7776498 AD5@C 6 7776504 AD>@<8@>20; 4 7776510 AD>@<8@>20= 68 7776514 AD>@<8@>20=0 80 7776582 AD>@<8@>20==0O 12 7776662 AD>@<8@>20==>3> 32 7776674 AD>@<8@>20==>5 11 7776706 AD>@<8@>20==><C 6 7776717 AD>@<8@>20==K5 23 7776723 AD>@<8@>20==K9 474 7776746 AD>@<8@>20==K<8 4 7777220 AD>@<8@>20=> 162 7777224 AD>@<8@>20=K 61 7777386 AD>@<8@>20BL 139 7777447 AD>@<8@>20BL70?@>A?>=0;>30< 6 7777586 AD>@<8@>20BL:>=B@>;L=CNAC<<CAB@>:8:>40?>;CG5=8O;8F5=788 10 7777592 AD>@<8@>20BL>BG5B 12 7777602 AD>@<8@>20BL?>25@A88 68 7777614 AD>@<8@>20BL?@8>B:@KB88 9 7777682 AD>@<8@>20BLAO 5 7777691 AD>@<8@>20BLM;5<5=BK 12 7777696 AD>@<8@C5B 5 7777708 AD>@<8@C5BAO 5 7777713 AE5< 122 7777718 AE5<0 4954 7777840 AE5<0xml 1193 7782794 AE5<04;OAE5<Kxml 13 7783987 AE5<070?@>A0 36 7784000 AE5<0:0:42>8G=K540==K5 10 7784036 AE5<0:0:AB@>:0 10 7784046 AE5<0:><?>=>2:840==KE 244 7784056 AE5<0< 5 7784300 AE5<0A8AB5<K0=0;8B8:8 56 7784305 AE5<0B8G5A:89 4 7784361 AE5<0B8G5A:>5 4 7784365 AE5<0B8G=K9 4 7784369 AE5<0B8G=K< 4 7784373 AE5<5 176 7784377 AE5<>9 56 7784553 AE5<C 172 7784609 AE5<K 4021 7784781 AE;>?=CBK< 5 7788802 AE;>?K20=85 11 7788807 AE;>?K20=88 5 7788818 AE;>?K20=8O 5 7788823 AE>45= 4 7788828 AE>48BLAO 4 7788832 AE>4=>9 5 7788836 AE>4=K9 14 7788841 AE>4OBAO 4 7788855 AE>689 3 7788859 AE>68E 3 7788862 AF5=0@852 16 7788865 AF5=0@85< 4 7788881 AF5=0@88 4 7788885 AF5=0@89 32 7788889 AF5=0@8OE 4 7788921 AG 7 7788925 AG5B 2760 7788932 AG5B01 7 7791692 AG5B02 5 7791699 AG5B03 6 7791704 AG5B41 5 7791710 AG5B0 514 7791715 AG5B0< 118 7792229 AG5B0<8 6 7792347 AG5B0E 15 7792353 AG5B4B 84 7792368 AG5B5 91 7792452 AG5B:B 84 7792543 AG5B>2 2049 7792627 AG5B>< 10 7794676 AG5BC 81 7794686 AG5BCG5B01C 6 7794767 AG5BE>7@0AG5B=K9 12 7794773 AG5BG8: 191 7794785 AG5BG8:0 125 7794976 AG5BG8:>2 35 7795101 AG5BG8:C 5 7795136 AG5BK 2114 7795141 AG8B05BAO 409 7797255 AG8B0= 40 7797664 AG8B0=0 23 7797704 AG8B0==0O 8 7797727 AG8B0==>3> 13 7797735 AG8B0==>9 10 7797748 AG8B0==CN 5 7797758 AG8B0==K5 5 7797763 AG8B0==K9 111 7797768 AG8B0==K< 45 7797879 AG8B0=> 4 7797924 AG8B0BL 23 7797928 AG8B0BL4;8B5;L=>ABL2K7>2>2 11 7797951 AG8B0BL4;8B5;L=>ABL2K7>2>2A5@28A>2 11 7797962 AG8B0BL4;8B5;L=>ABL2K7>2>2AC14 11 7797973 AG8B0BL:>;8G5AB2>0:B82=KEA50=A>2 11 7797984 AG8B0BL:>;8G5AB2>2K7>2>2 11 7797995 AG8B0BL:>;8G5AB2>A50=A>2 11 7798006 AG8B0BL>1J5<40==KE70?8A0==KE=048A: 11 7798017 AG8B0BL>1J5<40==KE?5@540==KE8?>;CG5==KEAC14 11 7798028 AG8B0BL>1J5<40==KEAG8B0==KEA48A:0 11 7798039 AG8B0BL?>B@51;5=85?0<OB8 11 7798050 AG8B0BL?@>F5AA>@=>52@5<O 11 7798061 AG8B0BLAO 529 7798072 AG8B0NB 8 7798601 AG8B0NBAO 89 7798609 AG8BK205<K5 14 7798698 AG8BK205<K9 34 7798712 AG8BK205<K<8 4 7798746 AG8BK205<KE 16 7798750 AG8BK205B 305 7798766 AG8BK205BAO 10 7799071 AG8BK20;AO 36 7799081 AG8BK20=85 273 7799117 AG8BK20=88 47 7799390 AG8BK20=8O 154 7799437 AG8BK20BL 316 7799591 AG8BK20BLAO 70 7799907 AG8BK20NBAO 19 7799977 AH0 32 7799996 AJ5<:0 12 7800028 AJ5<:5 8 7800040 AK=K?B0 9 7800048 AK@ 5 7800057 AK@0 4 7800062 AK@>9 9 7800066 AK@KE 4 7800075 AM:>=><8B 4 7800079 AM:>=><8BL 4 7800083 B 1943 7800087 B0 26 7802030 B01 90 7802056 B014>: 209 7802146 B014>:1 6 7802355 B014>:2 6 7802361 B014>:C<5=B 8 7802367 B01;0 3201 7802375 B01;8F 718 7805576 B01;8F0 7219 7806294 B01;8F01 23 7813513 B01;8F02 12 7813536 B01;8F004@5A>2 5 7813548 B01;8F040==KE 5 7813553 B01;8F04;O4>102;5=8O 9 7813558 B01;8F04;O87<5=5=8OAE5<K70?@>A0 26 7813567 B01;8F04;O?><5I5=8O 9 7813593 B01;8F07=0G5=89 724 7813602 B01;8F087<5@5=8O 368 7814326 B01;8F0:;0AB5@870F88 9 7814694 B01;8F0:><?>=>2:840==KE 258 7814703 B01;8F0:C@A>2 10 7814961 B01;8F0< 24 7814971 B01;8F0<0:5B0:><?>=>2:840==KE 114 7814995 B01;8F0<8 25 7815109 B01;8F0=>@<K2@5<5=8 6 7815134 B01;8F0>AB0B:>2 8 7815140 B01;8F0>BG5B>2 6 7815148 B01;8F0@538AB@>2=0:>?;5=8O 11 7815154 B01;8F0@57C;LB0B 8 7815165 B01;8F0@57C;LB0B>2 9 7815173 B01;8F0A2O759 9 7815182 B01;8F0A>AB020 21 7815191 B01;8F0AE5<K70?@>A0 34 7815212 B01;8F0D>@<K 926 7815246 B01;8F0D?4 6 7816172 B01;8F0E 73 7816178 B01;8F0F5= 66 7816251 B01;8F0G0AB>B 9 7816317 B01;8F5 939 7816326 B01;8F59 127 7817265 B01;8FC 669 7817392 B01;8FK 4526 7818061 B01;8FK4;O87<5=5=8O 9 7822587 B01;8FK4;O87<5=5=8OAE5<K70?@>A0 44 7822596 B01;8FK845=B8G=K 5 7822640 B01;8FK87<5@5=89 20 7822645 B01;8FKB@0=70:F89:>?89107K40==KE 6 7822665 B01;8FO 939 7822671 B01;8G=0O 517 7823610 B01;8G=0OG0ABL 356 7824127 B01;8G=0OG0ABL1 16 7824483 B01;8G=0OG0ABLA>AB024>:C<5=B0 5 7824499 B01;8G=0OG0ABLAB@>:0 5 7824504 B01;8G=89 4139 7824509 B01;8G=>3> 4111 7828648 B01;8G=>5 221 7832759 B01;8G=>5?>;5 875 7832980 B01;8G=>5?>;51 23 7833855 B01;8G=>5?@>AB@0=AB2>E@0=5=8O40==KE 6 7833878 B01;8G=>5?@>AB@0=AB2>E@0=5=8O8=45:A>2 6 7833884 B01;8G=>9 1456 7833890 B01;8G=>9G0AB8 4 7835346 B01;8G=>< 462 7835350 B01;8G=><C 41 7835812 B01;8G=CN 139 7835853 B01;8G=K5 311 7835992 B01;8G=K5?@>AB@0=AB20107K40==KE 16 7836303 B01;8G=K5G0AB8 98 7836319 B01;8G=K9 6919 7836417 B01;8G=K94>:C<5=B 1153 7843336 B01;8G=K94>:C<5=B2AB028BL?@8<5G0=85 12 7844489 B01;8G=K94>:C<5=B2AB028BL@07@K2AB@0=8FK 12 7844501 B01;8G=K94>:C<5=B>B>1@060BL3@C??8@>2:8 12 7844513 B01;8G=K94>:C<5=B>B>1@060BL703>;>2:8 12 7844525 B01;8G=K94>:C<5=B>B>1@060BL?@8<5G0=8O 12 7844537 B01;8G=K94>:C<5=B>B>1@060BLA5B:C 12 7844549 B01;8G=K94>:C<5=BB>;L:>?@>A<>B@ 12 7844561 B01;8G=K94>:C<5=BC40;8BL?@8<5G0=85 12 7844573 B01;8G=K94>:C<5=BC40;8BL@07@K2AB@0=8FK 12 7844585 B01;8G=K< 94 7844597 B01;8G=K<8 95 7844691 B01;8G=KE 273 7844786 B01;>84 11 7845059 B01;?>;5 5 7845070 B01>1>@>B>2 6 7845075 B01>AB0B:>2 6 7845081 B01?>A;54>20B5;L=>AB59 10 7845087 B01AAK;>: 7 7845097 B01C;OF88 59 7845104 B01C;OF8O 83 7845163 B08;0=4 12 7845246 B0920=L 14 7845258 B09< 8 7845272 B09<0CB 452 7845280 B09<0CB0 47 7845732 B09<0CB7025@H5=8O 13 7845779 B09<0CB70?@>A0A5@28A0?@>25@:8@0A:@KB8O?0@>;O 46 7845792 B09<0CB?@>25@:8A>548=5=8O 19 7845838 B09<0CBC 12 7845857 B09<5@ 14 7845869 B09<5@0 14 7845883 B09A:89 14 7845897 B0: 1358 7845911 B0:0BL 149 7847269 B0:0O 149 7847418 B0:5 1193 7847567 B0:65 13673 7848760 B0:85 233 7862433 B0:89 1601 7862666 B0:8< 610 7864267 B0:8<8 38 7864877 B0:8E 405 7864915 B0:>2>3> 336 7865320 B0:>2>5 22 7865656 B0:>2>9 17 7865678 B0:>2K5 45 7865695 B0:>3> 577 7865740 B0:>5 137 7866317 B0:>9 2570 7866454 B0:>< 113 7869024 B0:><C 21 7869137 B0:A8 127 7869158 B0:A8@07@5H8BL25@A8O8 9 7869285 B0:CN 57 7869294 B0< 38 7869351 B0<8;LA:89 14 7869389 B0= 51 7869403 B0=35=A 11 7869454 B0=35=A0 5 7869465 B0=70=8O 12 7869470 B0@0 13 7869482 B0@8D 8 7869495 B0@8DC 8 7869503 B2>@8B5;L=K9 12 7869511 B4 5 7869523 B4>:C<5=B 7 7869528 B4?@85<=8: 12 7869535 B5 175 7869547 B53 48 7869722 B530 8 7869770 B530< 21 7869778 B538 12 7869799 B5:3@C??8@>2:0 3 7869811 B5:40B0 8 7869814 B5:4>: 4 7869822 B5:4>:C<5=B 5 7869826 B5:70B@0B0 12 7869831 B5::;85=B 5 7869843 B5::>; 7 7869848 B5::>;>=:0 6 7869855 B5::C@A 13 7869861 B5:<><5=B 5 7869874 B5:=0F5=:0 7 7869879 B5:>1;0ABL 11 7869886 B5:>1J5:B 15 7869897 B5:>@30=870F8O 6 7869912 B5:AB 8421 7869918 B5:ABdom 961 7878339 B5:ABhtml 1446 7879300 B5:ABhB<; 9 7880746 B5:AB0 2654 7880755 B5:AB02B>?>41>@0 6 7883409 B5:AB0<8 17 7883415 B5:AB2>?@>A0 30 7883432 B5:AB2?@545;0E3@0=8F>1;0AB8 10 7883462 B5:AB2F5=B@5 12 7883472 B5:AB4;O>H81:8=5B@51CNI59?5@570?CA: 14 7883484 B5:AB4;O>H81:8B@51CNI59?5@570?CA: 14 7883498 B5:AB4;O?>8A:0 6 7883512 B5:AB4;OCAB0=>2:8 6 7883518 B5:AB4>: 44 7883524 B5:AB5 214 7883568 B5:AB703>;>2:0 268 7883782 B5:AB703>;>2:00:B82=>3>>:=0 11 7884050 B5:AB703>;>2:0=50:B82=>3>>:=0 11 7884061 B5:AB70?>;=5=8O 111 7884072 B5:AB70?@>A0 45 7884183 B5:AB8;L 10 7884228 B5:AB:=>?:8 11 7884238 B5:AB:=>?:822>40M:@0==>9:;0280BC@K 60 7884249 B5:AB=0AB@>9:8 6 7884309 B5:AB=52K1@0==>9:0@B8=:8 29 7884315 B5:AB=54>ABC?=K9 11 7884344 B5:AB>1@07F0 10 7884355 B5:AB>2 94 7884365 B5:AB>20O 22 7884459 B5:AB>20O70?8ALndef 34 7884481 B5:AB>289 555 7884515 B5:AB>2>3> 550 7885070 B5:AB>2>5 301 7885620 B5:AB>2>5A>45@68<>5 378 7885921 B5:AB>2>9 1191 7886299 B5:AB>2>< 25 7887490 B5:AB>2><C 5 7887515 B5:AB>2CN 8 7887520 B5:AB>2K5 230 7887528 B5:AB>2K9 1331 7887758 B5:AB>2K94>:C<5=B 422 7889089 B5:AB>2K< 66 7889511 B5:AB>2K<8 168 7889577 B5:AB>2KE 113 7889745 B5:AB>:=0 11 7889858 B5:AB>< 174 7889869 B5:AB?>420;0 20 7890043 B5:AB?>4?8A8 27 7890063 B5:AB?>4A25G5==K9 11 7890090 B5:AB?>4A:07:8 11 7890101 B5:AB?><>I8 13 7890112 B5:AB?@54C?@5645=8O 45 7890125 B5:AB?C=:B0<5=N 11 7890170 B5:AB@ 10 7890181 B5:AB@540:B8@>20=8O 10 7890191 B5:AB@>:0 10 7890201 B5:ABA:0@B8=:0<8 13 7890211 B5:ABA;520 21 7890224 B5:ABA>>1I5=8O 41 7890245 B5:ABA>>1I5=8Ohtml 54 7890286 B5:ABA>>1I5=8Ohtml0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 7890340 B5:ABA?@020 12 7890376 B5:ABAE5<K:><?>=>2:840==KE 5 7890388 B5:ABC 163 7890393 B5:ABD>@<0B8@>20==>3>4>:C<5=B0 116 7890556 B5:ABH01;>=0 72 7890672 B5:ABH0?:8 23 7890744 B5:ABK 335 7890767 B5:ABKA>>1I5=89>1>H81:0E 40 7891102 B5:ABKA>>1I5=8O>1>H81:5 36 7891142 B5:B8? 3 7891178 B5:B>20@ 47 7891181 B5:CI0O 433 7891228 B5:CI0O2848<>ABL 60 7891661 B5:CI0O3@C??8@>2:0 5 7891721 B5:CI0O40B0 247 7891726 B5:CI0O40B0A50=A0 21 7891973 B5:CI0O45:040 10 7891994 B5:CI0O4>ABC?=>ABL 70 7892004 B5:CI0O7040G0 11 7892074 B5:CI0O:>;>=:0 26 7892085 B5:CI0O<8=CB0 11 7892111 B5:CI0O<>48D8F8@>20==>ABL 10 7892122 B5:CI0O=0G0;L=0O?>78F8O 10 7892132 B5:CI0O=545;O 9 7892142 B5:CI0O>1;0ABL 37 7892151 B5:CI0O?>78F8O 44 7892188 B5:CI0OA5@8O 8 7892232 B5:CI0OAB@0=8F0 70 7892240 B5:CI0OAB@>:0 440 7892310 B5:CI0OC=825@A0;L=0O40B0 32 7892750 B5:CI0OC=825@A0;L=0O40B02<8;;8A5:C=40E 11 7892782 B5:CI0OOG59:0 6 7892793 B5:CI53> 2039 7892799 B5:CI55 368 7894838 B5:CI55459AB285?@870:@KB88 5 7895206 B5:CI557=0G5=85 22 7895211 B5:CI558;8?5@2K< 9 7895233 B5:CI558;8?>A;54=8< 25 7895242 B5:CI55>B:@KB0 10 7895267 B5:CI55?>;C3>485 9 7895277 B5:CI55?><5B:0 10 7895286 B5:CI55A>AB>O=85AB@0=8F 9 7895296 B5:CI55B>;L:>?@>A<>B@ 60 7895305 B5:CI59 970 7895365 B5:CI5< 456 7896335 B5:CI5<C 177 7896791 B5:CI85 122 7896968 B5:CI8540==K5 218 7897090 B5:CI8540==K5A?8A:0 12 7897308 B5:CI8540==K5AB@C:BC@K=0AB@>5::><?>=>2:840==KE 106 7897320 B5:CI85?5@8>4K>B>1@065=8O 18 7897426 B5:CI85?>;L7>20B5;LA:85=0AB@>9:8 13 7897444 B5:CI85F5=K:>=:C@5=B>2 6 7897457 B5:CI89 5585 7897463 B5:CI8920@80=B8=B5@D59A0 15 7903048 B5:CI8920@80=B8=B5@D59A0:;85=BA:>3>?@8;>65=8O 11 7903063 B5:CI8920@80=B>A=>2=>3>H@8DB0 10 7903074 B5:CI893>4 9 7903084 B5:CI8945=L 9 7903093 B5:CI898=45:A 25 7903102 B5:CI898=B5@20; 9 7903127 B5:CI898A?>;=8B5;L 9 7903136 B5:CI89:0B0;>3 34 7903145 B5:CI89:20@B0; 9 7903179 B5:CI89:>4;>:0;870F88 11 7903188 B5:CI89:>=:C@5=B 8 7903199 B5:CI89<5AOF 9 7903207 B5:CI89>1J5:B 220 7903216 B5:CI89>B45; 6 7903436 B5:CI89?>;L7>20B5;L 71 7903442 B5:CI89?>;L7>20B5;L>A 60 7903513 B5:CI89?>;L7>20B5;LO2;O5BAO04<8=8AB@0B>@><01>=5=B0 11 7903573 B5:CI89?>;L7>20B5;LO2;O5BAOCG0AB=8:>< 15 7903584 B5:CI89?>GB>2K9OI8: 39 7903599 B5:CI89@568< 10 7903638 B5:CI89@568<70?CA:0 15 7903648 B5:CI89@568<@540:B8@>20=85 20 7903663 B5:CI89@>48B5;L 118 7903683 B5:CI89A50=AB5AB8@C5BAO 11 7903801 B5:CI89A?>A>118><5B@8G5A:>9?@>25@:8 10 7903812 B5:CI89AB8;L 5 7903822 B5:CI89C75; 9 7903827 B5:CI89G0A 10 7903836 B5:CI89M;5<5=B 90 7903846 B5:CI89M;5<5=BA?8A:0 5 7903936 B5:CI89O7K: 27 7903941 B5:CI89O7K:A8AB5<K 11 7903968 B5:CI8< 180 7903979 B5:CI8<8 151 7904159 B5:CI8E 195 7904310 B5:CICN 371 7904505 B5:M;5<5=BA?8A:0 9 7904876 B5; 16 7904885 B5;0 118 7904901 B5;5 2111 7905019 B5;53@0<0 12 7907130 B5;5D>= 122 7907142 B5;5D>=0 81 7907264 B5;5D>=0E 4 7907345 B5;5D>=5 5 7907349 B5;5D>=88 22 7907354 B5;5D>=8O 26 7907376 B5;5D>==89 40 7907402 B5;5D>==>3> 40 7907442 B5;5D>==K9 44 7907482 B5;5D>=>2 15 7907526 B5;5D>=C 15 7907541 B5;> 2501 7907556 B5;>3@C??8@>2:84803@0<<K<0:5B0:><?>=>2:840==KE 64 7910057 B5;>3@C??8@>2:8B01;8FK<0:5B0:><?>=>2:840==KE 83 7910121 B5;>85@0@E88 48 7910204 B5;>:0:AB@>:0 5 7910252 B5;>< 6 7910257 B5;><0:5B0:><?>=>2:840==KE 74 7910263 B5;>A>>1I5=8O 10 7910337 B5;>A>>1I5=8OA5@28A08=B53@0F88 6 7910347 B5;C 10 7910353 B5;C3C 14 7910363 B5< 495 7910377 B5<0 550 7910872 B5<1@ 6 7911422 B5<1@0 4 7911428 B5<8 9 7911432 B5<=0 8 7911441 B5<=0O 8 7911449 B5<=> 80 7911457 B5<=>18@N7>2K9 12 7911537 B5<=>1>@4>2K9 12 7911549 B5<=>3@8D5;L=>A5@K9 12 7911561 B5<=>3@8D5;L=>A8=89 12 7911573 B5<=>75;5=K9 12 7911585 B5<=>7>;>B8ABK9 12 7911597 B5<=>9 5 7911609 B5<=>:@0A=K9 12 7911614 B5<=>>;82:>2>75;5=K9 12 7911626 B5<=>>@0=652K9 12 7911638 B5<=>A5@K9 12 7911650 B5<=>A8=89 12 7911662 B5<=>D8>;5B>2K9 12 7911674 B5<=K9 118 7911686 B5<=K< 3 7911804 B5<? 115 7911807 B5<C 12 7911922 B5<L 9 7911934 B5=59 4 7911943 B5=8 15 7911947 B5=8BL 15 7911962 B5=L 19 7911977 B5=L:=>?:8 11 7911996 B5=L:=>?:8A25B;0O 11 7912007 B5=L:=>?:8B5<=0O 11 7912018 B5?5@L 10 7912029 B5?;0O 9 7912039 B5?;89 9 7912048 B5?;> 5 7912057 B5?;>@>7>2K9 12 7912062 B5?;K9 15 7912074 B5?;KE 4 7912089 B5@5BL 113 7912093 B5@< 74 7912206 B5@<0 52 7912280 B5@<8 11 7912332 B5@<8= 122 7912343 B5@<8=0 4 7912465 B5@<8=0E 119 7912469 B5@<8=>2 3 7912588 B5@<>2 6 7912591 B5@<K 16 7912597 B5@B8 113 7912613 B5@O5B 3 7912726 B5@OBL 3 7912729 B5@OBLAO 5 7912732 B5@ONBAO 5 7912737 B5AB 99 7912742 B5AB0 10 7912841 B5AB5 3 7912851 B5AB8@>20=85 176 7912854 B5AB8@>20=88 24 7913030 B5AB8@>20=8O 88 7913054 B5AB8@>20BLAO 4 7913142 B5AB8@C5<0O3@C??0:><0=4=>3>8=B5@D59A0 60 7913146 B5AB8@C5<0O3@C??0D>@<K 262 7913206 B5AB8@C5<0O45:>@0F8OD>@<K 214 7913468 B5AB8@C5<0O:=>?:0:><0=4=>3>8=B5@D59A0 59 7913682 B5AB8@C5<0O:=>?:0D>@<K 177 7913741 B5AB8@C5<0OB01;8F0D>@<K 324 7913918 B5AB8@C5<0OD>@<0 216 7914242 B5AB8@C5<>3> 447 7914458 B5AB8@C5<>5 19 7914905 B5AB8@C5<>54>?>;=5=85M;5<5=B0D>@<K 80 7914924 B5AB8@C5<>5>:=>:;85=BA:>3>?@8;>65=8O 115 7915004 B5AB8@C5<>5?>;5D>@<K 217 7915119 B5AB8@C5<>5?@8;>65=85 118 7915336 B5AB8@C5<>9 8 7915454 B5AB8@C5<>< 13 7915462 B5AB8@C5<K9 497 7915475 B5AB8@C5<K9:><0=4=K98=B5@D59A>:=0 44 7915972 B5AB8@C5<K< 16 7916016 B5AB> 13 7916032 B5AB>2 4 7916045 B5AB>2K5 4 7916049 B5AB>2K9 4 7916053 B5AB>?>25I5=89 6 7916057 B5ABL 3 7916063 B5E 679 7916066 B5E=8: 24 7916745 B5E=8:0 24 7916769 B5E=8G5A:89 31 7916793 B5E=8G5A:8E 4 7916824 B5E=8G5A:>3> 18 7916828 B5E=8G5A:>9 5 7916846 B5E=8G5A:CN 4 7916851 B5E=>;>3859 4 7916855 B5E=>;>388 38 7916859 B5E=>;>38G5A:89 11 7916897 B5E=>;>38G5A:>3> 6 7916908 B5E=>;>38G5A:>< 5 7916914 B5E=>;>38O 59 7916919 B5E?>445@6:C 8 7916978 B5G5=85 373 7916986 B5G5=88 13 7917359 B5GL 777 7917372 B7 7 7918149 B71 10 7918156 B72 9 7918166 B7?5@540=> 3 7918175 B83@8=80 16 7918178 B8;L 9 7918194 B8;L40 6 7918203 B8<0 54 7918209 B8? 99975 7918263 B8?smsA@54AB2B5;5D>=88 45 8018238 B8?url 38 8018283 B8?urls3 4 8018321 B8?url2=5H=53>E@0=8;8I042>8G=KE40==KE 50 8018325 B8?xml 16 8018375 B8?0 10172 8018391 B8?04@5A040==KE:>=B0:B0 32 8028563 B8?04@5A0<3=>25==KEA>>1I5=8940==KE:>=B0:B0 32 8028595 B8?04@5A0M;5:B@>==>9?>GBK40==KE:>=B0:B0 37 8028627 B8?0;3>@8B<0E5H8@>20=8O?0@>;59?>;L7>20B5;59 118 8028664 B8?0;3>@8B<0E5H8@>20=8O?0@>;O 29 8028782 B8?0< 56 8028811 B8?0<8 48 8028867 B8?0=0;870 18 8028915 B8?0??@>:A8<0F88 9 8028933 B8?0??@>:A8<0F88;8=88B@5=404803@0<<K 34 8028942 B8?0B@81CB0 36 8028976 B8?0B@81CB0xml 67 8029012 B8?0E 87 8029079 B8?1CE30;B5@A:>3>>AB0B:0 14 8029166 B8?1CE30;B5@A:>3>>AB0B:0:><?>=>2:840==KE 25 8029180 B8?25104@5A040==KE:>=B0:B0 52 8029205 B8?2;045;5F 9 8029257 B8?2=5H=59:><?>=5=BK 32 8029266 B8?2=5H=59A8AB5<K 32 8029298 B8?2>72@0I05<>3>7=0G5=8Oxdto 9 8029330 B8?2>7=03@0645=8O 4 8029339 B8?2A5AAK;:8 123 8029343 B8?2A5AAK;:8B>G5:<0@H@CB0187=5A?@>F5AA>2 12 8029466 B8?2AB@>5==>9?>:C?:8 19 8029478 B8?2AB@>5==>9B01;8FK 6 8029497 B8?2K2>400:BC0;L=>AB840==KE:><?>=>2:840==KE 26 8029503 B8?2K2>40:0@B8=:8:><?>=>2:840==KE 29 8029529 B8?2K2>40:>?88107K40==KE:><?>=>2:840==KE 26 8029558 B8?2K2>40B5:AB0:><?>=>2:840==KE 53 8029584 B8?35=5@0B>@0 6 8029637 B8?3@0D8G5A:>3>?@54AB02;5=8O 13 8029643 B8?3@0D8G5A:>3>?@54AB02;5=8O24803@0<<5 10 8029656 B8?3@0D8G5A:>3>?@54AB02;5=8OA5@884803@0<<K 49 8029666 B8?3@C??8@>2:8 27 8029715 B8?3@C??8@>2:8:><?>=>2:840==KE 30 8029742 B8?3@C??K 15 8029772 B8?3@C??KM;5<5=B>2>B1>@0:><?>=>2:840==KE 25 8029787 B8?40==KE 61 8029812 B8?40==KExml 62 8029873 B8?40==KEB01;8FK 9 8029935 B8?40==KEB01;8FK2=5H=53>8AB>G=8:040==KE 30 8029944 B8?42CAB>@>==59?5G0B8 38 8029974 B8?4803@0<<K 575 8030012 B8?4>102;5=8O?@54AB02;5=89 23 8030587 B8?4>:C<5=B0 5 8030610 B8?4>?>;=5=8O 28 8030615 B8?4>?>;=5=8O?5@8>40:><?>=>2:840==KE 150 8030643 B8?4>?>;=5=8O?5@8>40<8 9 8030793 B8?4>?>;=5=8O?5@8>40<8AE5<K70?@>A0 64 8030802 B8?5 21 8030866 B8?548=8FK8=B5@20;02@5<5=80=0;87040==KE 106 8030887 B8?548=8FKH:0;K2@5<5=8 58 8030993 B8?703>;>2:0?>;59 22 8031051 B8?703>;>2:0?>;59:><?>=>2:840==KE 42 8031073 B8?70?8A8 36 8031115 B8?70?8A870?@>A0 32 8031151 B8?70?>;=5=8O>1;0AB8B01;8G=>3>4>:C<5=B0 30 8031183 B8?70?>;=5=8OB01;8FK 4 8031213 B8?70?>;=5=8OB01;8FK@57C;LB0B00=0;87040==KE 29 8031217 B8?72>=:0 21 8031246 B8?72>=:06C@=0;072>=:>2 35 8031267 B8?72>=:0A@54AB2B5;5D>=88 5 8031302 B8?7=0G 5 8031307 B8?7=0G5=8O 449 8031312 B8?7=0G5=8Ojson 64 8031761 B8?7=0G5=8Oxdto 118 8031825 B8?7=0G5=8OA?8A:0 11 8031943 B8?7=G 82 8031954 B8?87<5=5=8O 9 8032036 B8?87<5@5=8O 26 8032045 B8?87<5@5=8O?>AB@>8B5;O70?@>A0 32 8032071 B8?87<5@5=8O?>AB@>8B5;O>BG5B0 32 8032103 B8?8<?>@B0 5 8032135 B8?8<?>@B0A5@89A;>O35>3@0D8G5A:>9AE5<K 19 8032140 B8?8=B5@=5BA>548=5=8O 29 8032159 B8?8A?>;L7>20=8OG8A;>2KE7=0G5=890=0;87040==KE 19 8032188 B8?8AB>G=8:040==KE 25 8032207 B8?8AB>G=8:040==KE?>8A:00AA>F80F89 19 8032232 B8?8G=K9 3 8032251 B8?:0<5@K 25 8032254 B8?:0<5@KCAB@>9AB20 40 8032279 B8?:0=>=8G5A:>3>xml 53 8032319 B8?:0B0;>30 18 8032372 B8?:0B0;>30181;8>B5:8<>18;L=>3>CAB@>9AB20 35 8032390 B8?:;85=BA:>3>?@8;>65=8O 39 8032425 B8?:=>?:8 42 8032464 B8?:=>?:8:><0=4=>9?0=5;8 53 8032506 B8?:>40 28 8032559 B8?:>40?;0=0284>2@0AG5B0 31 8032587 B8?:>40A?@02>G=8:0 31 8032618 B8?:>48@>2:8 40 8032649 B8?:>;>=:8 22 8032689 B8?:>;>=:80=0;87040==KE45@52>@5H5=89 24 8032711 B8?:>;>=:80=0;87040==KE:;0AB5@870F8O 35 8032735 B8?:>;>=:80=0;87040==KE>1I0OAB0B8AB8:0 19 8032770 B8?:>;>=:80=0;87040==KE?>8A:0AA>F80F89 24 8032789 B8?:>;>=:80=0;87040==KE?>8A:?>A;54>20B5;L=>AB59 29 8032813 B8?:>;>=:8<>45;8?@>3=>70 28 8032842 B8?:><?>=5=BK 387 8032870 B8?:><?>=5=BKxs 325 8033257 B8?:>=B@035=B0 6 8033582 B8?:>=B@>;L=>9B>G:8 9 8033588 B8?:>=B@>;L=>9B>G:8AE5<K70?@>A0 24 8033597 B8?:C@A>@>2 9 8033621 B8?:C@A>@>2B01;8G=>3>4>:C<5=B0 15 8033630 B8?;8=88 21 8033645 B8?;8=8835>3@0D8G5A:>9AE5<K 39 8033666 B8?;8=884803@0<<K 44 8033705 B8?;8=88@8AC=:0B01;8G=>3>4>:C<5=B0 44 8033749 B8?;8=88OG59:8B01;8G=>3>4>:C<5=B0 67 8033793 B8?<0:5B0 92 8033860 B8?<0:5B01 13 8033952 B8?<0:5B02 13 8033965 B8?<0:5B03@C??8@>2:8:><?>=>2:840==KE 20 8033978 B8?<0:5B0>1;0AB8:><?>=>2:840==KE 48 8033998 B8?<0@:5@035>3@0D8G5A:>9AE5<K 68 8034046 B8?<0@:5@04803@0<<K 57 8034114 B8?<3=>25==KEA>>1I5=89 18 8034171 B8?<5@K@0AAB>O=8O 4 8034189 B8?<5@K@0AAB>O=8O0=0;87040==KE 25 8034193 B8?<>4C;O:@8?B>3@0D88 42 8034218 B8?=0:>?;5=8O 9 8034260 B8?=0:>?;5=8O24803@0<<5 10 8034269 B8?=0:>?;5=8OA5@884803@0<<K 39 8034279 B8?=0?@02;5=8O?5@5E>40B01;8G=>3>4>:C<5=B0 25 8034318 B8?=><5=:;0BC@K 26 8034343 B8?=><5@0 43 8034369 B8?=><5@0187=5A?@>F5AA0 31 8034412 B8?=><5@04>:C<5=B0 35 8034443 B8?=><5@07040G8 31 8034478 B8?=><5@0B5;5D>=040==KE:>=B0:B0 67 8034509 B8?>1;0AB8 30 8034576 B8?>1;0AB8>D>@<;5=8O 25 8034606 B8?>1;0AB8OG55:B01;8G=>3>4>:C<5=B0 30 8034631 B8?>1@01>B:8=0AB@>5:2B>@>3>D0:B>@00CB5=B8D8:0F88 19 8034661 B8?>1E>40 12 8034680 B8?>1J548=5=8O 9 8034692 B8?>1J548=5=8OAE5<K70?@>A0 19 8034701 B8?>1J5:B0 11 8034720 B8?>1J5:B0xdto 123 8034731 B8?>1J5:B>2 14 8034854 B8?>2 1821 8034868 B8?>2>9 4 8036689 B8?>2KE 4 8036693 B8?>< 437 8036697 B8?>@30=870F888AB>G=8:040==KE 13 8037134 B8?>@30=870F888AB>G=8:040==KE35>3@0D8G5A:>9AE5<K 19 8037147 B8?>A==0G8A;5=89 7 8037166 B8?>AB0B:0 14 8037173 B8?>AB0B:0:><?>=>2:840==KE 25 8037187 B8?>B1>@0 11 8037212 B8?>B<5B:8 5 8037223 B8?>B<5B:8OG59:8B01;8FK 5 8037228 B8?>B=>H5=8940==KE:>=B0:B0 87 8037233 B8?>B>1@065=8O 20 8037320 B8?>B>1@065=8O2K45;5=8OB01;8G=>3>4>:C<5=B0 20 8037340 B8?>B>1@065=8O;8=89A2>4=>9B01;8FK 20 8037360 B8?>B>1@065=8OA5@88A;>O35>3@0D8G5A:>9AE5<K 62 8037380 B8?>B>1@065=8OB>G5G=>3>>1J5:B035>3@0D8G5A:>9AE5<K 28 8037442 B8?>B>1@065=8OH:0;KM;5<5=B0;535=4K35>3@0D8G5A:>9AE5<K 19 8037470 B8?>B@8A>2:8 23 8037489 B8?>BA5G5=8O?@028; 4 8037512 B8?>BA5G5=8O?@028;0AA>F80F88 19 8037516 B8?>H81:8 9 8037535 B8?>H81:8>B?@02:84>AB02;O5<>3>C254><;5=8O 44 8037544 B8??0@03@0D0 11 8037588 B8??0@03@0D0D>@<0B8@>20==>3>4>:C<5=B0 25 8037599 B8??0@0<5B@0 9 8037624 B8??0@0<5B@04>ABC?=>9B01;8FKAE5<K70?@>A0 39 8037633 B8??0@0<5B@0:><0=4K 18 8037672 B8??5@8>40 14 8037690 B8??5@8>40:><?>=>2:840==KE 20 8037704 B8??;0BD>@<K 102 8037724 B8??>2545=8O:;028H8enter 28 8037826 B8??>4:;NG5=8O 54 8037854 B8??>4:;NG5=8O2=5H=59:><?>=5=BK 32 8037908 B8??>4?8A8 64 8037940 B8??>4?8A8pdf 15 8038004 B8??>4?8A8:@8?B>3@0D88 104 8038019 B8??>4?8AG8:0 14 8038123 B8??>4?8AG8:04>AB02;O5<KEC254><;5=89 47 8038137 B8??>4A25B:8 6 8038184 B8??>4A25B:8:0<5@K 25 8038190 B8??>8A:0 5 8038215 B8??>8A:0>1J5:B>235>3@0D8G5A:>9AE5<K 33 8038220 B8??>:C?:8 5 8038253 B8??>;CG05<>3>?>;O 5 8038258 B8??>;O 26 8038263 B8??>;O0=0;87040==KE 19 8038289 B8??@54<5B0>B;04:8 48 8038308 B8??@54>?@545;5==>3>7=0G5=8O 6 8038356 B8??@8;>65=8O 10 8038362 B8??@8<5=5=8O>B1>@0:><?>=>2:840==KE 30 8038372 B8??@>25@:8xml 28 8038402 B8??@>25@:8?@028;L=>AB8 18 8038430 B8??@>5:F8835>3@0D8G5A:>9AE5<K 194 8038448 B8?@07<5I5=8O87<5@5=89 38 8038642 B8?@07<5I5=8O8B>3>2 33 8038680 B8?@07<5I5=8O@5:2878B>287<5@5=89 38 8038713 B8?@07<5I5=8OB5:AB04803@0<<K30=B0 24 8038751 B8?@07<5I5=8OB5:AB0:><?>=>2:840==KE 39 8038775 B8?@07<5I5=8OB5:AB0B01;8G=>3>4>:C<5=B0 35 8038814 B8?@0<:8 20 8038849 B8?@0<:8M;5<5=B0C?@02;5=8O 64 8038869 B8?@57C;LB0B0 23 8038933 B8?@57C;LB0B0domxpath 67 8038956 B8?@5?;8:0F88 14 8039023 B8?@5?;8:0F88:>?88107K40==KE 28 8039037 B8?@8AC=:0 22 8039065 B8?@8AC=:0B01;8G=>3>4>:C<5=B0 85 8039087 B8?A10:5B>< 4 8039172 B8?A2>4=>94803@0<<K 27 8039176 B8?A2O78 42 8039203 B8?A2O782;>65=8Opdf 38 8039245 B8?A2O784803@0<<K30=B0 29 8039283 B8?A2O78=01>@>240==KE:><?>=>2:840==KE 20 8039312 B8?A<5I5=8OB01;8G=>3>4>:C<5=B0 33 8039332 B8?A>45@68<>3> 76 8039365 B8?A>45@68<>3>4;O2K1>@0?@8;>65=8O 5 8039441 B8?A>548=5=8O 9 8039446 B8?A>548=5=8O7=0G5=89?>A5@8O<4803@0<<K 42 8039455 B8?A>548=5=8OAE5<K70?@>A0 29 8039497 B8?A>548=5=8OB>G5:4803@0<<K 47 8039526 B8?A>548=5=8OB>G5:?@8?@>?CI5==KE7=0G5=8OE4803@0<<K 52 8039573 B8?A>548=8B5;L=>9;8=88 39 8039625 B8?A>>1I5=8O 16 8039664 B8?AB0=40@B870F880=0;87040==KE 15 8039680 B8?AB0=40@B870F8840==KE 4 8039695 B8?AB>@>=KM;5<5=B03@0D8G5A:>9AE5<K 46 8039699 B8?AB@ 6 8039745 B8?AC14 19 8039751 B8?AC14:>?88107K40==KE 37 8039770 B8?B5:AB0 30 8039807 B8?B5:AB0=>2KEM;5<5=B>2 9 8039837 B8?B5:AB0=>2KEM;5<5=B>2?;0=8@>2I8:0 19 8039846 B8?B5:AB0?>GB>2>3>A>>1I5=8O 37 8039865 B8?B5:CI53>7=0G5=8O 17 8039902 B8?B>20@0 6 8039919 B8?B@51>20=8O=07=0G5=8O 11 8039925 B8?C 529 8039936 B8?C7;0 528 8040465 B8?C7;0dom 238 8040993 B8?C7;0xml 117 8041231 B8?C7>@0B01;8G=>3>4>:C<5=B0 110 8041348 B8?C?>@O4>G820=8O 26 8041458 B8?C?>@O4>G820=8O?@028;0AA>F80F880=0;87040==KE 24 8041484 B8?C?>@O4>G820=8OH01;>=>2?>A;54>20B5;L=>AB590=0;87040==KE 15 8041508 B8?C?@>I5=8O 4 8041523 B8?C?@>I5=8O45@520@5H5=89 19 8041527 B8?D09;0 112 8041546 B8?D09;00@E820 95 8041658 B8?D09;04>:C<5=B0pdf 39 8041753 B8?D09;0?0:5B0>B>1@0605<KE4>:C<5=B>2 58 8041792 B8?D09;0B01;8FK 32 8041850 B8?D09;0B01;8G=>3>4>:C<5=B0 127 8041882 B8?D09;0D>@<0B8@>20==>3>4>:C<5=B0 43 8042009 B8?D>@<K 38 8042052 B8?D>@<K>BG5B0 31 8042090 B8?E@0=8;8I0 15 8042121 B8?E@0=8;8I042>8G=KE40==KE 20 8042136 B8?E@0=8;8I0A5@B8D8:0B>2:@8?B>3@0D88 37 8042156 B8?F5= 5 8042193 B8?H:0;K@040@=>94803@0<<K 26 8042198 B8?HB@8E:>40 106 8042224 B8?K 839 8042330 B8?Kmime 14 8043169 B8?K2284545@520 9 8043183 B8?K4;O>1@01>B:82>AAB0=>2;5=8O 16 8043192 B8?K=><5=:;0BC@K 28 8043208 B8?KA>45@68<>3> 9 8043236 B8?KF5= 19 8043245 B8?KG;5=>2>1J548=5=8O 13 8043264 B8?M;5<5=B0 93 8043277 B8?M;5<5=B08=D>@<0F88>2K?>;=5=88>1=>2;5=8O:>=D83C@0F88107K40==KE 24 8043370 B8?M;5<5=B0@57C;LB0B0:><?>=>2:840==KE 25 8043394 B8?M;5<5=B0A?8A:0 10 8043419 B8?M;5<5=B0C?@02;5=8O 18 8043429 B8@06=K9 10 8043447 B8@06=KE 10 8043457 B8B;0 573 8043467 B8B;> 573 8044040 B8BC;L=89 5 8044613 B8BC;L=>3> 5 8044618 B8BC;L=K9 5 8044623 B8D 7 8044628 B<? 5 8044635 B> 15548 8044640 B>103> 12 8060188 B>2 11 8060200 B>20@ 1139 8060211 B>20@0 88 8061350 B>20@0< 7 8061438 B>20@=0O 83 8061445 B>20@=K570?0AK 10 8061528 B>20@=K570?0AK>AB0B:8 18 8061538 B>20@=K9 110 8061556 B>20@=KE 27 8061666 B>20@>1J5:B 9 8061693 B>20@>2 56 8061702 B>20@AAK;:0 35 8061758 B>20@C 22 8061793 B>20@K 687 8061815 B>20@K=0A:;040E 15 8062502 B>20@K=><5=:;0BC@0=0G0;>2K1>@0 5 8062517 B>340 1787 8062522 B>3> 1560 8064309 B>65 61 8065869 B>9 2015 8065930 B>:0@ 6 8067945 B>:0@L 7 8067951 B>:0@N 6 8067958 B>:5= 99 8067964 B>:5=0 124 8068063 B>:5=0<8 12 8068187 B>:5=4>ABC?0 123 8068199 B>:5=4>ABC?00CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC87<5=5= 36 8068322 B>:5=4>ABC?02>AAB0=>2;5=8O?0@>;O87<5=5= 36 8068358 B>:5=>2 4 8068394 B>:5=>< 8 8068398 B>:5=C 18 8068406 B>;AB>3> 122 8068424 B>;AB>9 250 8068546 B>;AB>< 128 8068796 B>;ABK9 85137 8068924 B>;ABK9:;85=B 63 8154061 B>;ABK9:;85=B>1KG=>5?@8;>65=85 16 8154124 B>;ABK9:;85=BC?@02;O5<>5?@8;>65=85 16 8154140 B>;I8=0 130 8154156 B>;I8=02BC;:887<5@8B5;L=>94803@0<<K 10 8154286 B>;I8=0H:0;K87<5@8B5;L=>94803@0<<K 10 8154296 B>;I8=>9 4 8154306 B>;I8=C 41 8154310 B>;I8=K 41 8154351 B>;L:> 34976 8154392 B>;L:>18><5B@8G5A:0O 9 8189368 B>;L:>2845>:>=D5@5=F8O 7 8189377 B>;L:>2=5H=55 13 8189384 B>;L:>2>2A5E459AB28OE 9 8189397 B>;L:>4;O70?>;=5==>3> 26 8189406 B>;L:>4>ABC?=> 6 8189432 B>;L:>4>ABC?=>3> 18 8189438 B>;L:>4>ABC?=KE 5 8189456 B>;L:>70?8AL 24 8189461 B>;L:>70@538AB@8@>20==K5 6 8189485 B>;L:>70I8I5==0O0CB5=B8D8:0F8Oimap 9 8189491 B>;L:>70I8I5==0O0CB5=B8D8:0F8Opop3 17 8189500 B>;L:>70I8I5==0O0CB5=B8D8:0F8Osmtp 37 8189517 B>;L:>70I8I5==0O0CB5=B8D8:0F8Osmtp0CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 36 8189554 B>;L:>70I8I5==0O0CB5=B8D8:0F8Osmtp2>AAB0=>2;5=8O?0@>;O 36 8189590 B>;L:>85@0@E8O 45 8189626 B>;L:>;>:0;L=>5 13 8189671 B>;L:>>1>@>BK 16 8189684 B>;L:>?>420; 9 8189700 B>;L:>?@>A<>B@ 226 8189709 B>;L:>GB5=85 94 8189935 B>< 1709 8190029 B><0 1709 8191738 B><0B=K9 13 8193447 B><C 89 8193460 B>= 3 8193549 B>=5@ 4 8193552 B>=:89 36874 8193556 B>=:89:;85=B 78 8230430 B>=:8< 5 8230508 B>=:>3> 215 8230513 B>=:>9 16 8230728 B>=:>< 207 8230744 B>=>< 3 8230951 B>? 488 8230954 B>?;5=>5 5 8231442 B>?;5=>5<>;>:> 12 8231447 B>?;5=K9 5 8231459 B>?>;>38G5A:89 42 8231464 B>?>;>38G5A:8E 16 8231506 B>?>;>38G5A:>9 9 8231522 B>?>;>38G5A:CN 4 8231531 B>@3>2;O 11 8231535 B>@3>2>5>1>@C4>20=85 6 8231546 B>@3>2K9 62 8231552 B>B 19283 8231614 B>G5: 619 8250897 B>G5G=0O 97 8251516 B>G5G=>3> 12 8251613 B>G5G=>5 4 8251625 B>G5G=>9 35 8251629 B>G5G=K5 6 8251664 B>G5G=K9 153 8251670 B>G5G=K9>1J5:B35>3@0D8G5A:>9AE5<K 165 8251823 B>G:0 2613 8251988 B>G:0n 8 8254601 B>G:02K1>@020@80=B0 15 8254609 B>G:04803@0<<K 131 8254624 B>G:04803@0<<K30=B0 142 8254755 B>G:07=0G5=85 9 8254897 B>G:07=0G5=85?@>F5=B 9 8254906 B>G:07=0G5=85@07<5@ 9 8254915 B>G:0< 40 8254924 B>G:0<0@H@CB0 154 8254964 B>G:0<0@H@CB0187=5A 6 8255118 B>G:0<0@H@CB0187=5A?@>F5AA0 11 8255124 B>G:0<0@H@CB0187=5A?@>F5AA0AAK;:0 290 8255135 B>G:0<8 49 8255425 B>G:0?>4:;NG5=8O 13 8255474 B>G:0?@>F5=B 9 8255487 B>G:0@07<5@ 9 8255496 B>G:0E 66 8255505 B>G:5 218 8255571 B>G:8 1124 8255789 B>G:84803@0<<K 55 8256913 B>G:84803@0<<K30=B0 58 8256968 B>G:8<0@H@CB0 65 8257026 B>G:8<=>3>B>G5G=>3>>1J5:B035>3@0D8G5A:>9AE5<K 44 8257091 B>G:8?>4:;NG5=8O 13 8257135 B>G:>9 52 8257148 B>G:C 523 8257200 B>G=0O 9 8257723 B>G=89 66 8257732 B>G=> 14 8257798 B>G=>3> 5 8257812 B>G=>5 12 8257817 B>G=>5A>>B25BAB285 36 8257829 B>G=>9 16 8257865 B>G=>< 8 8257881 B>G=><C 52 8257889 B>G=>AB8 23 8257941 B>G=>ABL 177 8257964 B>G=>ABL?5G0B8 37 8258141 B>G=>ABLN 24 8258178 B>G=K9 135 8258202 B>G=K< 4 8258337 B>O 161 8258341 B@020 10 8258502 B@0:B>20BL 4 8258512 B@0:B>20BLAO 29 8258516 B@0:BC5BAO 29 8258545 B@0=70:F88 801 8258574 B@0=70:F89 67 8259375 B@0=70:F8>==0O 9 8259442 B@0=70:F8>==>9 20 8259451 B@0=70:F8>==CN 10 8259471 B@0=70:F8>==K9 68 8259481 B@0=70:F8>==KE 48 8259549 B@0=70:F8N 32 8259597 B@0=70:F8O 954 8259629 B@0=70:F8O0:B82=0 23 8260583 B@0=70:F8O<8 6 8260606 B@0=70:F8OE 40 8260612 B@0=A:@8?F8O 12 8260652 B@0=A?>=8@>20=85 4 8260664 B@0=A?>=8@>20=8O 4 8260668 B@0=A?>=8@>20BL 11 8260672 B@0=A?>@B8@>2:0 4 8260683 B@0=A?>@B8@>2:8 4 8260687 B@0=AD>@< 25 8260691 B@0=AD>@<0 25 8260716 B@0D8: 8 8260741 B@51>20;>AL 4 8260749 B@51>20=85 630 8260753 B@51>20=85< 4 8261383 B@51>20=88 4 8261387 B@51>20=89 56 8261391 B@51>20=8N 8 8261447 B@51>20=8O 142 8261455 B@51>20=8O< 361 8261597 B@51>20=8O<8 5 8261958 B@51>20=8OE 5 8261963 B@51>20=L5 56 8261968 B@51>20B5;L=> 4 8262024 B@51>20B5;L=K9 4 8262028 B@51>20BL 1711 8262032 B@51>20BL2KA>:>5 9 8263743 B@51>20BL4;OC?@02;5=8O 9 8263752 B@51>20BLA@54=55?@54C?@5640BL=8652KA>:>3> 9 8263761 B@51>20BLAO 3142 8263770 B@51C5<0O 4 8266912 B@51C5<0O0:BC0;L=>ABL40==KE 58 8266916 B@51C5<0OB>G=>ABL 17 8266974 B@51C5<>3> 166 8266991 B@51C5<>5 19 8267157 B@51C5<>52@5<O0:BC0;L=>AB840==KE 31 8267176 B@51C5<>9 458 8267207 B@51C5<>< 9 8267665 B@51C5<><C 15 8267674 B@51C5<CN 15 8267689 B@51C5<K5 21 8267704 B@51C5<K5?0@0<5B@K 6 8267725 B@51C5<K5@07@5H5=8O<>18;L=>3>?@8;>65=8O 10 8267731 B@51C5<K9 852 8267741 B@51C5<K< 110 8268593 B@51C5<K<8 6 8268703 B@51C5<KE 14 8268709 B@51C5B 1639 8268723 B@51C5BAO 3089 8270362 B@51C5BAO2K?>;=5=85 10 8273451 B@51C5BAO4>?>;=8B5;L=0O?@>25@:0?>;L7>20B5;O 34 8273461 B@51C5BAO7025@H5=85A50=A0 12 8273495 B@51C5BAO@071;>:8@>2:0M:@0=0 9 8273507 B@51CNB 16 8273516 B@51CNBAO 49 8273532 B@51CNI0O 14 8273581 B@51CNI53>AO 104 8273595 B@51CNI85 24 8273699 B@51CNI89 43 8273723 B@51CNI89AO 104 8273766 B@51CNI8<8 5 8273870 B@53 11 8273875 B@5=4 125 8273886 B@5=40 125 8274011 B@5B89 31 8274136 B@5B89@0745;8B5;L 7 8274167 B@5BL5 56 8274174 B@5BL53> 41 8274230 B@5BL5< 5 8274271 B@5BL8< 10 8274276 B@5BL8E 5 8274286 B@5BLO 21 8274291 B@5C3>;L=8: 39 8274312 B@5C3>;L=8:0 8 8274351 B@5C3>;L=8:0<8 8 8274359 B@5E 55 8274367 B@5E<5@=K9 4 8274422 B@8 166 8274426 B@8040 6 8274592 B@804K 6 8274598 B@83>=><5B@8G5A:89 5 8274604 B@83>=><5B@8G5A:8E 5 8274609 B@8:>B06=0O 49 8274614 B@8:>B06=K9 49 8274663 B@8=8404 12 8274712 B@8A>AB>O=8O 20 8274724 B@8A>AB>O=8OD;06:0 11 8274744 B@8AB0 6 8274755 B@>5B>G85 37 8274761 B@>5B>G85< 37 8274798 B@C4=>AB8 5 8274835 B@C4=>ABL 5 8274840 BC 33 8274845 BC1;5@0 8 8274878 BC40 9 8274886 BC<1;5@ 86 8274895 BC<1;5@0 12 8274981 BC=8A 12 8274993 BC@5F:89 38 8275005 BC@5F:>3> 14 8275043 BC@:<5=A:89 20 8275057 BC@:<5=A:>3> 14 8275077 BC@F8O 12 8275091 BCA:;> 15 8275103 BCA:;>>;82:>2K9 12 8275118 BCA:;>@>7>2K9 12 8275130 BCA:;>A5@K9 12 8275142 BCA:;K9 15 8275154 BCA:=CBL 15 8275169 BCG0 251 8275184 BCO 19 8275435 BDA 5 8275454 BK;L=>9 4 8275459 BK;L=K9 4 8275463 BKAOG 4 8275467 BKAOG0 6 8275471 BKAOG5;5B85 5 8275477 BKAOG8 10 8275482 BL<0 495 8275492 BO65AB8 5 8275987 BO65ABL 5 8275992 C 4508 8275997 C1548B5AL 8 8280505 C1548BLAO 8 8280513 C18@0BL 4 8280521 C18@0O 4 8280525 C1@0=0 5 8280529 C1@0=89 5 8280534 C1@0==K9 5 8280539 C1@0BL 13 8280544 C1K2 243 8280557 C1K205B 4 8280800 C1K20=85 226 8280804 C1K20=8N 159 8281030 C1K20=8O 51 8281189 C1K20BL 4 8281240 C1K20NI89 4 8281244 C1K20NI8< 4 8281248 C1KBL 243 8281252 C254><8BL 13 8281495 C254><8BL>4>AB02:5 14 8281508 C254><8BL>?@>GB5=88 13 8281522 C254><;5=85 357 8281535 C254><;5=88 12 8281892 C254><;5=89 137 8281904 C254><;5=8O 150 8282041 C254><;5=8O:;85=B0 10 8282191 C254><;5=8O<8 5 8282201 C254><;5=8OE 4 8282206 C254><;5=L5 137 8282210 C254><;O5B 7 8282347 C254><;OBL 7 8282354 C254><;OBLAO 10 8282361 C254><;ONBAO 10 8282371 C25;8G5=85 95 8282381 C25;8G5=85480<5B@0 9 8282476 C25;8G5=85?;>I048 9 8282485 C25;8G5=8O 16 8282494 C25;8G5==>< 4 8282510 C25;8G5==K9 9 8282514 C25;8G8205B 11 8282523 C25;8G8205BAO 76 8282534 C25;8G820BL 11 8282610 C25;8G820BLAO 76 8282621 C25;8G820NI89 4 8282697 C25;8G820NI8E 4 8282701 C25;8G8B5;L=K9 4 8282705 C25;8G8B5;L=K< 4 8282709 C25;8G8BL 34 8282713 C25;8G8BL7=0G5=85 10 8282747 C25;8G8BL<0AHB01 12 8282757 C25@5= 4 8282769 C25@5==>ABL 22 8282773 C25@5==K9 4 8282795 C25AL 807 8282799 C2845BL 24 8283606 C2>;L=5=85 6 8283630 C3;0 34 8283636 C3;>20O 5 8283670 C3;>2>9 15 8283675 C3;>2K5 4 8283690 C3;>2KE 9 8283694 C3;>< 8 8283703 C3;C 55 8283711 C3>4=> 10 8283766 C3>4=K9 10 8283776 C3>; 223 8283786 C3>;23@04CA0E 18 8284009 C3>;3@04CAK 16 8284027 C3>;=0:;>=0 9 8284043 C3>;=0:;>=0?>4?8A59 13 8284052 C3>;@0480=K 16 8284065 C4020BLAO 19 8284081 C405BAO 19 8284100 C40;0AL 8 8284119 C40;5= 272 8284127 C40;5=0 30 8284399 C40;5=85 2497 8284429 C40;5=8542865=89 48 8286926 C40;5=85< 192 8286974 C40;5=85<=>65AB25==KE7=0G5=89 11 8287166 C40;5=85>1J5:B0 82 8287177 C40;5=85H01;>=02B>@>3>D0:B>@00CB5=B8D8:0F88 36 8287259 C40;5=88 264 8287295 C40;5=8N 31 8287559 C40;5=8O 1452 8287590 C40;5==0O 8 8289042 C40;5==>3> 15 8289050 C40;5==>5 14 8289065 C40;5==>9 56 8289079 C40;5==><C 5 8289135 C40;5==K5 33 8289140 C40;5==K5>D8AK 6 8289173 C40;5==K9 627 8289179 C40;5==K<8 4 8289806 C40;5==KE 112 8289810 C40;5=> 88 8289922 C40;5=?>;L7>20B5;5< 9 8290010 C40;5=K 348 8290019 C40;89 15 8290367 C40;8< 15 8290382 C40;8B 6 8290397 C40;8BL 3746 8290403 C40;8BL0A8=E 29 8294149 C40;8BL0B@81CB 261 8294178 C40;8BL107C40==KE 9 8294439 C40;8BL25@A88 19 8294448 C40;8BL2K3@C7:C40==KE 15 8294467 C40;8BL2K3@C7:C40==KE0A8=E 15 8294482 C40;8BL40==K5 50 8294497 C40;8BL40==K50A8=E 14 8294547 C40;8BL40==K58=D>@<0F8>==>9107K 11 8294561 C40;8BL4>?>;=8B5;L=CN3@0<<0B8:C8=D>@<0F8>==>9107K 10 8294572 C40;8BL4>?>;=8B5;L=CN3@0<<0B8:CA50=A0 10 8294582 C40;8BL4>G5@=89 420 8294592 C40;8BL703>;>2>: 10 8295012 C40;8BL703>;>2>:B01;8FK 10 8295022 C40;8BL7=0G>: 4 8295032 C40;8BL872@5<5==>3>E@0=8;8I0 11 8295036 C40;8BL87>1@01>B:8?>A;570?8A825@A89 72 8295047 C40;8BL8<5=>20==K9M;5<5=B 57 8295119 C40;8BL:0;5=40@L 14 8295176 C40;8BL:>=B0:B 14 8295190 C40;8BL<>45;L@0A?>7=020=8O4;O8=D>@<0F8>==>9107K 10 8295204 C40;8BL=0:;59:C 10 8295214 C40;8BL=0AB@>9:C?>C<>;G0=8N 12 8295224 C40;8BL=54>?CAB8<K5A8<2>;Kxml 15 8295236 C40;8BL=58A?>;L7C5<K5 10 8295251 C40;8BL=5?>A@54AB25==> 12 8295261 C40;8BL>1;0ABL 24 8295273 C40;8BL>1@01>BG8: 9 8295297 C40;8BL>1J5:BK 13 8295306 C40;8BL?0@0<5B@ 12 8295319 C40;8BL?>420;B01;8FK 10 8295331 C40;8BL?>:0B53>@88 10 8295341 C40;8BL?>D8;LB@C 10 8295351 C40;8BL?>GB>2K9OI8: 11 8295361 C40;8BL@538AB@0F8N87<5=5=89 16 8295372 C40;8BLA>1KB85 14 8295388 C40;8BLA>>1I5=85 20 8295402 C40;8BLA>>1I5=8O 32 8295422 C40;8BLAB@>:C 33 8295454 C40;8BLAE5<C 10 8295487 C40;8BLC75;0B@81CB0 268 8295497 C40;8BLD09;K 30 8295765 C40;8BLD09;K0A8=E 28 8295795 C40;8BLM;5<5=BA>AB>O=8O?@>A<>B@0 10 8295823 C40;8BLM;5<5=BA?8A:0 6 8295833 C40;8BLM;5<5=BA?8A:0=5?>A@54AB25==> 6 8295839 C40;8BLM;5<5=BK 23 8295845 C40;8BLOG59:C 10 8295868 C40;>AL 267 8295878 C40;O5< 11 8296145 C40;O5<0O 109 8296156 C40;O5<>3> 197 8296265 C40;O5<>5 57 8296462 C40;O5<>9 118 8296519 C40;O5<K5 16 8296637 C40;O5<K5@5:2878BK 5 8296653 C40;O5<K9 1312 8296658 C40;O5<K< 23 8297970 C40;O5<KE 54 8297993 C40;O5B 2076 8298047 C40;O5BAO 780 8300123 C40;OBL 2499 8300903 C40;OBL02B><0B8G5A:8 13 8303402 C40;OBL02B><0B8G5A:8?@8>B<5=5?@>2545=8O 9 8303415 C40;OBL40==K5 10 8303424 C40;OBL?>;CG5==K5 12 8303434 C40;OBLA>>1I5=8O 5 8303446 C40;OBLAO 1099 8303451 C40;ONBAO 329 8304550 C40;ONI53> 6 8304879 C40;ONI55 60 8304885 C40;ONI89 66 8304945 C40;OO 26 8305011 C40;Q==>9 42 8305037 C40;Q==><C 6 8305079 C40BLAO 275 8305085 C40G=> 33 8305360 C40G=>3> 4 8305393 C40G=>9 36 8305397 C40G=K9 73 8305433 C420820BL 7 8305506 C420820BLAO 11 8305513 C420820NBAO 11 8305524 C42>5==><C 4 8305535 C42>5==K9 9 8305539 C42>5==K<8 5 8305548 C45@60=8O>@30=870F89 5 8305553 C4>1=55 3 8305558 C4>1=> 14 8305561 C4>1=>3> 27 8305575 C4>1=>5 10 8305602 C4>1=>9 4 8305612 C4>1=>< 4 8305616 C4>1=K9 81 8305620 C4>1=K< 16 8305701 C4>1=K<8 4 8305717 C4>1>G8B05<>5 20 8305721 C4>1>G8B05<>< 5 8305741 C4>1>G8B05<>ABL 47 8305746 C4>1>G8B05<K9 21 8305793 C4>1AB20 8 8305814 C4>1AB2> 8 8305822 C4>2;5B2>@8B5;L=K9 4 8305830 C4>2;5B2>@8B5;L=K< 4 8305834 C4>2;5B2>@O5B 18 8305838 C4>2;5B2>@OBL 76 8305856 C4>2;5B2>@ONB 13 8305932 C4>2;5B2>@ONI5<C 28 8305945 C4>2;5B2>@ONI85 40 8305973 C4>2;5B2>@ONI89 97 8306013 C4>2;5B2>@ONI8< 4 8306110 C4>2;5B2>@ONI8E 28 8306114 C4>AB>25@ONI53> 13 8306142 C4>AB>25@ONI89 88 8306155 C4>AB>25@ONI8< 11 8306243 C4>AB>25@ONI8E 69 8306254 C6 1940 8306323 C65 1940 8308263 C715:8AB0= 16 8310203 C715:A:89 22 8310219 C75; 15500 8310241 C75;dom 13 8325741 C75;45@520@5H5=89 46 8325754 C75;845=B8G5= 420 8325800 C75;:>=B5:AB0 15 8326220 C75;:>=B5:AB0dom 5 8326235 C75;>1J5:B 7 8326240 C75;@025= 420 8326247 C75;@0725@=CB 11 8326667 C7:85 9 8326678 C7:89 1953 8326687 C7;0 5891 8328640 C7;0< 12 8334531 C7;0<8 517 8334543 C7;0E 12 8335060 C7;5 421 8335072 C7;>2 4027 8335493 C7;>2>9 4 8339520 C7;>2K5 4 8339524 C7;>< 1261 8339528 C7;C 110 8340789 C7;K 1562 8340899 C7=0BL 27 8342461 C7=0G5=85 5 8342488 C7>@ 113 8342493 C7>@1 9 8342606 C7>@10 9 8342615 C7>@11 9 8342624 C7>@12 9 8342633 C7>@13 9 8342642 C7>@14 9 8342651 C7>@15 9 8342660 C7>@16 9 8342669 C7>@17 9 8342678 C7>@2 9 8342687 C7>@3 9 8342696 C7>@4 9 8342705 C7>@5 9 8342714 C7>@6 9 8342723 C7>@7 9 8342732 C7>@8 9 8342741 C7>@9 9 8342750 C7>@0 14 8342759 C7>@>2 4 8342773 C:068B5 22 8342777 C:0702 35 8342799 C:070; 4 8342834 C:070= 3023 8342838 C:070=0 638 8345861 C:070=85 1223 8346499 C:070=85< 408 8347722 C:070=85B8?0 5 8348130 C:070=88 144 8348135 C:070=89 654 8348279 C:070=8O 553 8348933 C:070==0O 198 8349486 C:070==>3> 1310 8349684 C:070==>5 555 8350994 C:070==>9 865 8351549 C:070==>< 156 8352414 C:070==><C 988 8352570 C:070==CN 406 8353558 C:070==K5 195 8353964 C:070==K9 9646 8354159 C:070==K< 1550 8363805 C:070==K<8 202 8365355 C:070==KE 380 8365557 C:070=> 2326 8365937 C:070=><C 12 8368263 C:070=K 374 8368275 C:070=L5 4 8368649 C:070B5;5< 8 8368653 C:070B5;8 4 8368661 C:070B5;L 69 8368665 C:070B5;O 28 8368734 C:070B8 2357 8368762 C:070BL 1940 8371119 C:07K205< 12 8373059 C:07K205<>3> 5 8373071 C:07K205<K9 23 8373076 C:07K205<KE 6 8373099 C:07K205B 2925 8373105 C:07K205BAO 875 8376030 C:07K205BAO;52>825@E 18 8376905 C:07K205BAO@0A?>;>65=85 27 8376923 C:07K209B5 4 8376950 C:07K20;8 8 8376954 C:07K20;AO 6 8376962 C:07K20BL 3473 8376968 C:07K20BLAO 1078 8380441 C:07K20NB 22 8381519 C:07K20NBAO 154 8381541 C:07K20NI0O 34 8381695 C:07K20NI53> 14 8381729 C:07K20NI89 147 8381743 C:07K20O 6 8381890 C:07K25B 4 8381896 C:;04K205BAO 59 8381900 C:;04K20BLAO 64 8381959 C:@08=0 28 8382023 C:@08=A:89 51 8382051 C:@08=A:>3> 27 8382102 C;8F0 43 8382129 C;8FK 12 8382172 C;CG05B 4 8382184 C;CG0BL 4 8382188 C;CGH5==>9 12 8382192 C;CGH5==K9 12 8382204 C;CGH8B 4 8382216 C;CGH8BL 4 8382220 C;LB@0 62 8382224 C;LB@0<0@8= 13 8382286 C<5=LH05B 10 8382299 C<5=LH05BAO 5 8382309 C<5=LH0BL 10 8382314 C<5=LH0BLAO 21 8382324 C<5=LH0NBAO 16 8382345 C<5=LH0NI89 4 8382361 C<5=LH0NI8E 4 8382365 C<5=LH5=0 4 8382369 C<5=LH5=85 46 8382373 C<5=LH5=85480<5B@0 9 8382419 C<5=LH5=85?;>I048 9 8382428 C<5=LH5=88 5 8382437 C<5=LH5=8O 13 8382442 C<5=LH5==K9 4 8382455 C<5=LH8;>AL 8 8382459 C<5=LH8BL 32 8382467 C<5=LH8BL7=0G5=85 10 8382499 C<5=LH8BL<0AHB01 12 8382509 C<5=LH8BLAO 8 8382521 C<5AB82H85AO 20 8382529 C<5AB82H89AO 20 8382549 C<5AB8;0AL 8 8382569 C<5AB8BLAO 13 8382577 C<5I05BAO 43 8382590 C<5I0BLAO 98 8382633 C<5I0NBAO 64 8382731 C<=>65=85 45 8382795 C<=>65=85< 4 8382840 C<=>65=8O 4 8382844 C<=>65==>5 5 8382848 C<=>65==>9 5 8382853 C<=>65==K9 26 8382858 C<=>65=> 16 8382884 C<=>68B8 16 8382900 C<>;G0=85 12674 8382916 C<>;G0=88 6 8395590 C<>;G0=8N 12668 8395596 C<>;G0=8O 4 8408264 C=0@=0O 5 8408268 C=0@=K5 27 8408273 C=0@=K9 33 8408300 C=0@=K<8 5 8408333 C=0A;54>20= 5 8408338 C=0A;54>20==K9 5 8408343 C=825@A0; 8 8408348 C=825@A0;L=0O40B0 9 8408356 C=825@A0;L=0O40B04>:>B>@>92K?>;=OBL>G8AB:C 15 8408365 C=825@A0;L=0O40B0=0G0;070:@KB>3>:;NG0 9 8408380 C=825@A0;L=0O40B0>:>=G0=8O70:@KB>3>:;NG0 9 8408389 C=825@A0;L=0O40B0?@>25@:8 10 8408398 C=825@A0;L=>3> 76 8408408 C=825@A0;L=>5 78 8408484 C=825@A0;L=>52@5<O 31 8408562 C=825@A0;L=>9 8 8408593 C=825@A0;L=>< 8 8408601 C=825@A0;L=CN 10 8408609 C=825@A0;L=K5 48 8408619 C=825@A0;L=K9 238 8408667 C=825@A0;L=K<8 7 8408905 C=825@A0;L=KE 9 8408912 C=8:0;5= 8 8408921 C=8:0;L=0O 45 8408929 C=8:0;L=> 558 8408974 C=8:0;L=>3> 88 8409532 C=8:0;L=>5 61 8409620 C=8:0;L=><C 35 8409681 C=8:0;L=>AB8 152 8409716 C=8:0;L=>ABL 374 8409868 C=8:0;L=>ABL:><0=4K 9 8410242 C=8:0;L=>ABLN 4 8410251 C=8:0;L=K 24 8410255 C=8:0;L=K5 36 8410279 C=8:0;L=K9 1750 8410315 C=8:0;L=K9845=B8D8:0B>@ 1236 8412065 C=8:0;L=K9845=B8D8:0B>@>1J5:B0 11 8413301 C=8:0;L=K9845=B8D8:0B>@?>;L7>20B5;O 9 8413312 C=8:0;L=K9845=B8D8:0B>@D>@<K 86 8413321 C=8:0;L=K< 119 8413407 C=8:0;L=K<8 9 8413526 C=8:0;L=KE 64 8413535 C=8>= 81 8413599 C=8D8F8@>20==K9 10 8413680 C=8D8F8@>20BL 10 8413690 C=8GB>605<>9 5 8413700 C=8GB>605<K9 5 8413705 C=8GB>605B 3 8413710 C=8GB>605BAO 7 8413713 C=8GB>60BL 3 8413720 C=8GB>60BLAO 7 8413723 C=8GB>60NI53> 3 8413730 C=8GB>60NI89 3 8413733 C=8GB>65=0 4 8413736 C=8GB>65=85 41 8413740 C=8GB>65=88 7 8413781 C=8GB>65=8N 4 8413788 C=8GB>65=8O 14 8413792 C=8GB>65==K9 17 8413806 C=8GB>65=K 13 8413823 C=8GB>68BL 15 8413836 C?0:>20= 17 8413851 C?0:>20==>9 5 8413868 C?0:>20==><C 10 8413873 C?0:>20==K9 54 8413883 C?0:>20==K<8 21 8413937 C?0:>20=K 14 8413958 C?0:>2:0 8 8413972 C?0:>2:8 8 8413980 C?0:>2K20BL 4 8413988 C?0:>2K20BLAO 8 8413992 C?0:>2K20NBAO 8 8414000 C?><8=0=85 7 8414008 C?><8=0=8O 3 8414015 C?>@O4>G 52 8414018 C?>@O4>G5= 11 8414070 C?>@O4>G5=0 12 8414081 C?>@O4>G5==>3> 3 8414093 C?>@O4>G5==>< 4 8414096 C?>@O4>G5==>AB8 4 8414100 C?>@O4>G5==>ABL 8 8414104 C?>@O4>G5==K9 60 8414112 C?>@O4>G5==K98B5@0B>@C7;>2 13 8414172 C?>@O4>G5==K9A=8<>:C7;>2 21 8414185 C?>@O4>G5==K< 4 8414206 C?>@O4>G5=K 5 8414210 C?>@O4>G8205<>ABL 13 8414215 C?>@O4>G8205BAO 31 8414228 C?>@O4>G820=85 618 8414259 C?>@O4>G820=85< 51 8414877 C?>@O4>G820=88 45 8414928 C?>@O4>G820=8N 5 8414973 C?>@O4>G820=8O 325 8414978 C?>@O4>G820BL 170 8415303 C?>@O4>G820BLAO 72 8415473 C?>@O4>G820NBAO 35 8415545 C?>@O4>G8BL 219 8415580 C?>B@51;5=85 4 8415799 C?>B@51;O5BAO 4 8415803 C?>B@51;OBLAO 4 8415807 C?@028B8 51 8415811 C?@02;5=85 4505 8415862 C?@02;5=858B>30<8 6 8420367 C?@02;5=85< 304 8420373 C?@02;5=85?>8A:>< 35 8420677 C?@02;5=88 5 8420712 C?@02;5=8N 177 8420717 C?@02;5=8O 3784 8420894 C?@02;O5<0O 25 8424678 C?@02;O5<>3> 99 8424703 C?@02;O5<>5 9 8424802 C?@02;O5<>5?@8;>65=85 58 8424811 C?@02;O5<>9 884 8424869 C?@02;O5<>< 73 8425753 C?@02;O5<CN 7 8425826 C?@02;O5<K5 25 8425833 C?@02;O5<K9 1267 8425858 C?@02;O5<K< 5 8427125 C?@02;O5<KE 106 8427130 C?@02;O5B 391 8427236 C?@02;O5BAO 16 8427627 C?@02;OBL 579 8427643 C?@02;OBLAO 16 8428222 C?@02;ONB 6 8428238 C?@02;ONI55 4 8428244 C?@02;ONI85 23 8428248 C?@02;ONI89 67 8428271 C?@02;ONI8< 5 8428338 C?@02;ONI8E 17 8428343 C?@02>;O5<>9 4 8428360 C?@>AB8BL 10 8428364 C?@>I05B 4 8428374 C?@>I0BL 18 8428378 C?@>I5=85 13 8428396 C?@>I5=8O 13 8428409 C?@>I5==0O@538AB@0F8O 6 8428422 C?@>I5==>9 6 8428428 C?@>I5==>< 4 8428434 C?@>I5==CN 6 8428438 C?@>I5==K9 21 8428444 C?@>I5==K920@80=B 5 8428465 C?@O4>G820=85 5 8428470 C@02=5=85 60 8428475 C@02=5=89 44 8428535 C@02=5=8O 12 8428579 C@02=5=L5 44 8428591 C@4 14 8428635 C@4C 14 8428649 C@>25=L 1277 8428663 C@>25=L157>?0A=>AB8A>548=5=89 58 8429940 C@>25=L225@E 12 8429998 C@>25=L22K1>@:5 37 8430010 C@>25=L23@C??8@>2:5 5 8430047 C@>25=L2=87 12 8430052 C@>25=L4>ABC?0 5 8430064 C@>25=L6C@=0;0@538AB@0F88 56 8430069 C@>25=L87>;OF88 7 8430125 C@>25=L87>;OF88B@0=70:F89 46 8430132 C@>25=L8A?>;L7>20=8O70I8I5==>3>A>548=5=8O 6 8430178 C@>25=L8A?>;L7>20=8O70I8I5==>3>A>548=5=8Oftp 35 8430184 C@>25=L>B:07>CAB>9G82>AB8 11 8430219 C@>25=LA60B8O 48 8430230 C@>25=LA60B8Ozip 37 8430278 C@>25=LA60B8OD09;00@E820 46 8430315 C@>2=5 55 8430361 C@>2=59 146 8430416 C@>2=5< 93 8430562 C@>2=8 94 8430655 C@>2=N 41 8430749 C@>2=O 485 8430790 C@>2=O< 5 8431275 C@C3209 12 8431280 C@N?8=A:B>@3 44 8431292 CA 851 8431336 CA0 851 8432187 CA5:0BL 5 8433038 CA5G5=85 8 8433043 CA:>@5=85 8 8433051 CA:>@5=8O 8 8433059 CA:>@O5B 4 8433067 CA:>@OBL 4 8433071 CA;>285 1471 8433075 CA;>285< 10 8434546 CA;>285>B1>@0 5 8434556 CA;>285A2O78 20 8434561 CA;>288 136 8434581 CA;>289 121 8434717 CA;>28N 159 8434838 CA;>28O 488 8434997 CA;>28O< 125 8435485 CA;>28O<8 16 8435610 CA;>28OE 36 8435626 CA;>2=89 8 8435662 CA;>2=> 25 8435670 CA;>2=>3> 269 8435695 CA;>2=>5 89 8435964 CA;>2=>5>D>@<;5=85 226 8436053 CA;>2=>5>D>@<;5=85:><?>=>2:840==KE 181 8436279 CA;>2=>5>D>@<;5=85:><?>=>2:840==KE=54>ABC?=>5 12 8436460 CA;>2=>5@0745;5=85 18 8436472 CA;>2=>< 10 8436490 CA;>2=><C 10 8436500 CA;>2=K 5 8436510 CA;>2=K9 424 8436515 CA;>2=K< 11 8436939 CA;>2=K<8 6 8436950 CA;>2=KE 20 8436956 CA;>2L5 121 8436976 CA;C3 5 8437097 CA;C30 18 8437102 CA;C38 7 8437120 CA>25@H5=AB2>20=85 130 8437127 CA>25@H5=AB2>20=8O 120 8437257 CA>25@H5=AB2>20==>9 18 8437377 CA>25@H5=AB2>20==K9 18 8437395 CA>25@H5=AB2>20BL?>4?8AL 18 8437413 CA>25@H5=AB2>20BL?>4?8AL0A8=E 13 8437431 CA?5BL 4 8437444 CA?5E 4 8437448 CA?5E0 4 8437452 CA?5H=0 20 8437456 CA?5H=0O 5 8437476 CA?5H=> 178 8437481 CA?5H=>3> 199 8437659 CA?5H=>5 58 8437858 CA?5H=>9 15 8437916 CA?5H=>< 8 8437931 CA?5H=>AB8 12 8437939 CA?5H=>ABL 16 8437951 CA?5H=CN 10 8437967 CA?5H=K9 493 8437977 CA?5H=K< 34 8438470 CAB0=02;8205< 10 8438504 CAB0=02;8205<0O 21 8438514 CAB0=02;8205<>3> 79 8438535 CAB0=02;8205<>5 222 8438614 CAB0=02;8205<>9 5 8438836 CAB0=02;8205<>< 5 8438841 CAB0=02;8205<K5 55 8438846 CAB0=02;8205<K5?0@0<5B@K 11 8438901 CAB0=02;8205<K9 750 8438912 CAB0=02;8205<K< 13 8439662 CAB0=02;8205<K<8 60 8439675 CAB0=02;8205<KE 14 8439735 CAB0=02;8205B 3406 8439749 CAB0=02;8205BAO 1126 8443155 CAB0=02;820BL 3829 8444281 CAB0=02;820BL?@0204;O=>2KE>1J5:B>2 36 8448110 CAB0=02;820BL?@0204;O@5:2878B>28B01;8G=KEG0AB59?>C<>;G0=8N 36 8448146 CAB0=02;820BLAO 1222 8448182 CAB0=02;820NBAO 71 8449404 CAB0=02;820NI0O 17 8449475 CAB0=02;820NI89 17 8449492 CAB0=02;820O 15 8449509 CAB0=02;825BAO 4 8449524 CAB0=0;8205B 4 8449528 CAB0=>282 4 8449532 CAB0=>282H53> 40 8449536 CAB0=>282H5< 15 8449576 CAB0=>282H89 61 8449591 CAB0=>28;> 5 8449652 CAB0=>28< 28 8449657 CAB0=>28B 5 8449685 CAB0=>28B5 5 8449690 CAB0=>28B8 6809 8449695 CAB0=>28BAO 10 8456504 CAB0=>28BL 3641 8456514 CAB0=>28BLhtml 12 8460155 CAB0=>28BLhtml4>:C<5=B0 10 8460167 CAB0=>28BL04@5A>1=>2;5=8O 25 8460177 CAB0=>28BL04@5AA5@25@0A8AB5<K0=0;8B8:8 10 8460202 CAB0=>28BL04@5AM;5:B@>==>9?>GBK01>=5=B0 11 8460212 CAB0=>28BL0:B82=>ABL 92 8460223 CAB0=>28BL0A8=E 4 8460315 CAB0=>28BL0B@81CB 261 8460319 CAB0=>28BL0B@81CB845=B8D8:0B>@ 261 8460580 CAB0=>28BL157>?0A=K9@568< 16 8460841 CAB0=>28BL157>?0A=K9@568<@0745;5=8O40==KE 16 8460857 CAB0=>28BL18B 11 8460873 CAB0=>28BL1;>:8@>2:CA50=A>2 15 8460884 CAB0=>28BL254CI85@0AG5BK 5 8460899 CAB0=>28BL25@A8N?>;=>B5:AB>2>3>?>8A:0 16 8460904 CAB0=>28BL25@A8NAB0=40@B=>9@5?;8:0F88 10 8460920 CAB0=>28BL2=5H=NN:><?>=5=BC 42 8460930 CAB0=>28BL2=5H=NN:><?>=5=BC0A8=E 32 8460972 CAB0=>28BL2@5<O 56 8461004 CAB0=>28BL2@5<O7025@H5=8OA50=A0?@8157459AB288 11 8461060 CAB0=>28BL2@5<O7025@H5=8OA?OI53>A50=A0 11 8461071 CAB0=>28BL2@5<O70AK?0=8O?0AA82=>3>A50=A0 11 8461082 CAB0=>28BL2@5<O87<5=5=8O 26 8461093 CAB0=>28BL2@5<O87<5=5=8O0A8=E 20 8461119 CAB0=>28BL2@5<O>6840=8O1;>:8@>2:840==KE 11 8461139 CAB0=>28BL2@5<O?@54C?@5645=8O>7025@H5=88A50=A0?@8157459AB288 11 8461150 CAB0=>28BL2A5 11 8461161 CAB0=>28BL2K45;5==K5<=>65AB25==K57=0G5=8O 11 8461172 CAB0=>28BL2K45;5==K5>1;0AB8 10 8461183 CAB0=>28BL2K45;5==K5M;5<5=BK 22 8461193 CAB0=>28BL2K?>;=5=85>1@01>BG8:>2A>1KB8O 11 8461215 CAB0=>28BL2K?>;=5=85?>A;5>1@01>BG8:>2A>1KB8O 12 8461226 CAB0=>28BL2K@065=858B>3>2KE70?8A59 12 8461238 CAB0=>28BL2K@065=8O 17 8461250 CAB0=>28BL2KB5A=ONI85@0AG5BK 5 8461267 CAB0=>28BL3;02=K9C75; 13 8461272 CAB0=>28BL3;C18=CF25B0 10 8461285 CAB0=>28BL3@0=8FC 13 8461295 CAB0=>28BL3@0=8FK2K45;5=8O 59 8461308 CAB0=>28BL40==K5 145 8461367 CAB0=>28BL40==K5@01>BKA@5GLN8=D>@<0F8>==>9107K 10 8461512 CAB0=>28BL40==K5@538AB@0F888=D>@<0F8>==>9107K 11 8461522 CAB0=>28BL42>8G=K540==K5 25 8461533 CAB0=>28BL459AB285 121 8461558 CAB0=>28BL459AB285?@8=5A>>B25BAB288?0@>;59?>;L7>20B5;59B@51>20=8O<?@80CB5=B8D8:0F88 11 8461679 CAB0=>28BL4>:C<5=B 12 8461690 CAB0=>28BL4>?>;=8B5;L=CN3@0<<0B8:C8=D>@<0F8>==>9107K 15 8461702 CAB0=>28BL4>?>;=8B5;L=CN3@0<<0B8:CA50=A0 10 8461717 CAB0=>28BL4>ABC?=K57=0G5=8O 33 8461727 CAB0=>28BL4>ABC?=K5?>;O 70 8461760 CAB0=>28BL5A;8=5?>4:;NG5=> 50 8461830 CAB0=>28BL703>;>2>: 14 8461880 CAB0=>28BL70?8AK205<K5?>;O 12 8461894 CAB0=>28BL70?@5B70AK?0=8O:><?LNB5@0 16 8461906 CAB0=>28BL70?@5I0NI55B@51>20=85=07=0G5=8ODC=:F8>=0;L=>AB8 12 8461922 CAB0=>28BL7=0G5=85 77 8461934 CAB0=>28BL7=0G5=85?0@0<5B@0 166 8462011 CAB0=>28BL7=0G5=85?>;O 10 8462177 CAB0=>28BL845=B8D8:0B>@ 12 8462187 CAB0=>28BL845=B8D8:0B>@?>;=>M:@0==>9@5:;0<K 14 8462199 CAB0=>28BL845=B8D8:0B>@@5:;0<=>3>10==5@0 10 8462213 CAB0=>28BL8742>8G=KE40==KE 10 8462223 CAB0=>28BL87<5=O5<K5?>;O 17 8462233 CAB0=>28BL87AB@>:8 10 8462250 CAB0=>28BL8<5=>20==K9M;5<5=B 56 8462260 CAB0=>28BL8<OD09;0B5;0 34 8462316 CAB0=>28BL8=45=B8D8:0B>@2845>>1JO2;5=8OA2>7=03@0645=85< 15 8462350 CAB0=>28BL8=8F80;870F8N?@54>?@545;5==KE40==KE 48 8462365 CAB0=>28BL8=B5@20; 12 8462413 CAB0=>28BL8A?>;L7>20=85 10 8462425 CAB0=>28BL8A?>;L7>20=8503@530B>2 12 8462435 CAB0=>28BL8A?>;L7>20=85107K40==KE:>?88MB>9:>?859 10 8462447 CAB0=>28BL8A?>;L7>20=854>?>;=8B5;L=KE8=45:A>2 11 8462457 CAB0=>28BL8A?>;L7>20=856C@=0;0@538AB@0F88 13 8462468 CAB0=>28BL8A?>;L7>20=858B>3>2 44 8462481 CAB0=>28BL8A?>;L7>20=85:0:E@0=8;8I0?>C<>;G0=8N 10 8462525 CAB0=>28BL8A?>;L7>20=85A>1KB8O6C@=0;0@538AB@0F88 59 8462535 CAB0=>28BL8A?>;L7>20=85B5:CI8E8B>3>2 24 8462594 CAB0=>28BL8A?>;L7C5<K9A5@25@ 22 8462618 CAB0=>28BL8AE>4=K540==K5 19 8462640 CAB0=>28BL:0@B8=:C 12 8462659 CAB0=>28BL:=>?:8 12 8462671 CAB0=>28BL:>;8G5AB2>7040=898=45:A8@>20=8O 14 8462683 CAB0=>28BL:>;8G5AB2>7040=89?5@5AG5B08B>3>2 11 8462697 CAB0=>28BL:><<5=B0@8925@A888AB>@8840==KE 132 8462708 CAB0=>28BL:@0B:89703>;>2>: 14 8462840 CAB0=>28BL<0:5B 12 8462854 CAB0=>28BL<0:5B>D>@<;5=8O?>;L7>20B5;O 10 8462866 CAB0=>28BL<0:A8<0;L=>52@5<O2K?>;=5=8O459AB28O 10 8462876 CAB0=>28BL<0:A8<0;L=K9?5@8>4@0AAG8B0==KE8B>3>2 47 8462886 CAB0=>28BL<0:A8<0;L=K9@07<5@8=45:A8@C5<KE40==KE 10 8462933 CAB0=>28BL<0:A8<0;L=K9A@>:459AB28O?0@>;59?>;L7>20B5;59 11 8462943 CAB0=>28BL<8=8<0;L=CN4;8=C?0@>;59?>;L7>20B5;59 11 8462954 CAB0=>28BL<8=8<0;L=K98<0:8<0;L=K9?5@8>4@0AAG8B0==KE8B>3>2 11 8462965 CAB0=>28BL<8=8<0;L=K98<0:A8<0;L=K9?5@8>4K@0AAG8B0==KE8B>3>2 24 8462976 CAB0=>28BL<8=8<0;L=K9?5@8>4@0AAG8B0==KE8B>3>2 47 8463000 CAB0=>28BL<8=8<0;L=K9@07<5@70?8AK205<KE40==KE 10 8463047 CAB0=>28BL<8=8<0;L=K9A@>:459AB28O?0@>;59?>;L7>20B5;59 11 8463057 CAB0=>28BL<>45;L@0A?>7=020=8O4;O8=D>@<0F8>==>9107K 10 8463068 CAB0=>28BL<>=>?>;L=K9@568< 33 8463078 CAB0=>28BL=08<5=>20=85?@8;>65=8O 10 8463111 CAB0=>28BL=0:;59:C 28 8463121 CAB0=>28BL=0AB@>9:8 92 8463149 CAB0=>28BL=0AB@>9:802B><0B8G5A:>3>A>E@0=5=8O0CB5=B8D8:0F88 10 8463241 CAB0=>28BL=0AB@>9:802B><0B8G5A:>3>A>E@0=5=8O?0@0<5B@>20CB5=B8D8:0F88 13 8463251 CAB0=>28BL=0AB@>9:80CB5=B8D8:0F88G5@57M;5:B@>==CN?>GBC 14 8463264 CAB0=>28BL=0AB@>9:82>AAB0=>2;5=8O?0@>;O 22 8463278 CAB0=>28BL=0AB@>9:8:;85=B0;8F5=78@>20=8O 11 8463300 CAB0=>28BL=0AB@>9:8>1@01>B:8>H81>:?@870?CA:5 10 8463311 CAB0=>28BL=0AB@>9:8?>;L7>20B5;O 10 8463321 CAB0=>28BL=0AB@>9:8?@>25@:8@0A:@KB8O?0@>;O 15 8463331 CAB0=>28BL=0G0;>AB>;5B8O8=D>@<0F8>==>9107K 11 8463346 CAB0=>28BL=52848<>ABL 19 8463357 CAB0=>28BL=52848<>ABL0A8=E 18 8463376 CAB0=>28BL=87:89?@8>@8B5B?>B>:0 9 8463394 CAB0=>28BL=>2K9:>4 39 8463403 CAB0=>28BL=>2K9=><5@ 59 8463442 CAB0=>28BL=><5@B5:CI53>:04@0 10 8463501 CAB0=>28BL>1=>2;5=85?@54>?@545;5==KE40==KE 75 8463511 CAB0=>28BL>1=>2;5=85?@54>?@545;5==KE40==KE8=D>@<0F8>==>9107K 20 8463586 CAB0=>28BL>1I85=0AB@>9:8 10 8463606 CAB0=>28BL>1I85?0@0<5B@KA>548=5=8O 12 8463616 CAB0=>28BL>1I89<0:5B>D>@<;5=8O 10 8463628 CAB0=>28BL>1J5:B 12 8463638 CAB0=>28BL>1O70B5;L=>58A?>;L7>20=85 10 8463650 CAB0=>28BL>3@0=8G5=85?>2B>@5=8O?0@>;59?>;L7>20B5;59A@548?>A;54=8E 11 8463660 CAB0=>28BL>3@0=8G5=8O8A?>;L7>20=8O23@C??8@>2:5 15 8463671 CAB0=>28BL>3@0=8G5=8O8A?>;L7>20=8O2>B1>@5 15 8463686 CAB0=>28BL>3@0=8G5=8O8A?>;L7>20=8O2?>@O4:5 15 8463701 CAB0=>28BL>?8A0=85 40 8463716 CAB0=>28BL>?8A0=852K3@C7:840==KE 15 8463756 CAB0=>28BL>?8A0=852K3@C7:840==KE0A8=E 15 8463771 CAB0=>28BL>B:;NG5=85157>?0A=>3>@568<0 16 8463786 CAB0=>28BL>B:;NG5=8570I8BK>B>?0A=KE459AB289 18 8463802 CAB0=>28BL>B<5B:C 10 8463820 CAB0=>28BL>B>1@065=85703>;>2:0>A 10 8463830 CAB0=>28BL>B>1@065=85>?>25I5=89>1AC645=8O 11 8463840 CAB0=>28BL>B>1@065=85@5:;0<=>3>10==5@0 18 8463851 CAB0=>28BL?0;8B@C 26 8463869 CAB0=>28BL?0@0<5B@ 77 8463895 CAB0=>28BL?0@0<5B@K2=5H=53>?>4:;NG5=8O8=D>@<0F8>==>9107K 10 8463972 CAB0=>28BL?0@0<5B@K2=5H=53>?>4:;NG5=8OA50=A0 10 8463982 CAB0=>28BL?0@0<5B@K2K1>@0?@8;>65=8O 10 8463992 CAB0=>28BL?0@0<5B@KA>548=5=8O?>;L7>20B5;O 12 8464002 CAB0=>28BL?0@0<5B@KA>548=5=8OA50=A0 12 8464014 CAB0=>28BL?0@0<5B@KDC=:F8>=0;L=KE>?F898=B5@D59A0 16 8464026 CAB0=>28BL?0@0<5B@KDC=:F8>=0;L=KE>?F89D>@<K 15 8464042 CAB0=>28BL?5@8>4 23 8464057 CAB0=>28BL?5@8>4@0745;5=8OE@0=5=8O40==KE6C@=0;0@538AB@0F88 22 8464080 CAB0=>28BL?;0= 14 8464102 CAB0=>28BL?;>B=>ABL 10 8464116 CAB0=>28BL?>4A:07:C22>40 14 8464126 CAB0=>28BL?>;5703>;>2:0 14 8464140 CAB0=>28BL?>;=K98=B5@20; 19 8464154 CAB0=>28BL?>;L7>20B5;LA:8540==K5 420 8464173 CAB0=>28BL?><5B:CC40;5=8O 143 8464593 CAB0=>28BL?><5B:CC40;5=8OM;5<5=B0A?8A:0 6 8464736 CAB0=>28BL?>@O4>: 10 8464742 CAB0=>28BL?@54AB02;5=852K@065=89 17 8464752 CAB0=>28BL?@54AB02;5=852K@065=8O45B0;L=KE70?8A59 12 8464769 CAB0=>28BL?@54AB02;5=852K@065=8O8B>3>2KE70?8A59 12 8464781 CAB0=>28BL?@54AB02;5=8OH01;>=0A>>1I5=8O 15 8464793 CAB0=>28BL?@54AB02;5=8OH01;>=0A>>1I5=8O0A8=E 15 8464808 CAB0=>28BL?@58<CI5AB25==>58A?>;L7>20=85>A=>2=>3>A5@25@0 17 8464823 CAB0=>28BL?@828;538@>20==K9@568< 16 8464840 CAB0=>28BL?@82O7:C 25 8464856 CAB0=>28BL?@>25@:C@0A:@KB8O?0@>;59?>;L7>20B5;59 11 8464881 CAB0=>28BL?@>25@:CA;>6=>AB8?0@>;59?>;L7>20B5;59 11 8464892 CAB0=>28BL@07<5@ 76 8464903 CAB0=>28BL@07<5@0A8=E 54 8464979 CAB0=>28BL@0ABO3820=85?>3>@87>=B0;8 19 8465033 CAB0=>28BL@0AH8@5=85?>;CG5=8O8=D>@<0F88>:><?LNB5@50A8=E 11 8465052 CAB0=>28BL@0AH8@5=85@01>BKA:@8?B>3@0D859 27 8465063 CAB0=>28BL@0AH8@5=85@01>BKA:@8?B>3@0D8590A8=E 32 8465090 CAB0=>28BL@0AH8@5=85@01>BKAD09;0<8 32 8465122 CAB0=>28BL@0AH8@5=85@01>BKAD09;0<80A8=E 22 8465154 CAB0=>28BL@538>=0;L=K5=0AB@>9:88=D>@<0F8>==>9107K 25 8465176 CAB0=>28BL@568< 16 8465201 CAB0=>28BL@568<03@530B>2 12 8465217 CAB0=>28BL@568<8A?>;L7>20=8OE@0=8;8I042>8G=KE40==KE 10 8465229 CAB0=>28BL@568<=01;N45=8O 11 8465239 CAB0=>28BL@568<>A=>2=>3>>:=0 14 8465250 CAB0=>28BL@568<>B>1@065=8O@57C;LB0B0 14 8465264 CAB0=>28BL@568<?>;=>B5:AB>2>3>?>8A:0 21 8465278 CAB0=>28BL@568<@0745;5=8O8B>3>2 29 8465299 CAB0=>28BL@568<@0745;5=8OA>AB02=KEA;>2 14 8465328 CAB0=>28BL@568<@07<5I5=8O:>?8940==KE2E@0=8;8I542>8G=KE40==KE 10 8465342 CAB0=>28BL@568<GB5=8O70?8A8E@0=8;8I042>8G=KE40==KE 10 8465352 CAB0=>28BL@57C;LB0B480;>302K1>@0D09;0 14 8465362 CAB0=>28BL@5:2878B 6 8465376 CAB0=>28BLA2>9AB2>>1J5:B>2 10 8465382 CAB0=>28BLA5@8N 34 8465392 CAB0=>28BLA>2<5AB=>58A?>;L7>20=85?@8;>65=8901>=5=B0 11 8465426 CAB0=>28BLA>548=5=85 24 8465437 CAB0=>28BLA>548=5=85A2=5H=8<8AB>G=8:><40==KE 11 8465461 CAB0=>28BLA>>B25BAB285>1J5:B08@5:2878B0D>@<K 25 8465472 CAB0=>28BLA>>B25BAB285>1J5:B08D>@<K 21 8465497 CAB0=>28BLA>>B25BAB285?@>AB@0=AB208<5= 11 8465518 CAB0=>28BLA>AB02 10 8465529 CAB0=>28BLA>AB02AB0=40@B=>3>8=B5@D59A0odata 17 8465539 CAB0=>28BLA>AB02D>@< 10 8465556 CAB0=>28BLA>AB02E@0=8<KE40==KE 10 8465566 CAB0=>28BLA?8A>:87?0@>;59 15 8465576 CAB0=>28BLA?8A>:87A>E@0=O5<KE7=0G5=89?0@>;59 11 8465591 CAB0=>28BLA?>A>1?@>25@:8?>4?8A8<>18;L=>3>:;85=B0 11 8465602 CAB0=>28BLA@>:?@54C?@5645=8O>18AB5G5=88A@>:0459AB28O?0@>;59?>;L7>20B5;59 11 8465613 CAB0=>28BLAAK;:C=>2>3> 197 8465624 CAB0=>28BLAB@>:C 100 8465821 CAB0=>28BLAE5<C 79 8465921 CAB0=>28BLAO 10 8466000 CAB0=>28BLB5:AB 47 8466010 CAB0=>28BLB5:AB70?@>A0 19 8466057 CAB0=>28BLB5:CI53>?>;L7>20B5;O 15 8466076 CAB0=>28BLB5:CI85?>;L7>20B5;LA:85=0AB@>9:8 10 8466091 CAB0=>28BLB5:CI8920@80=B 10 8466101 CAB0=>28BLB5:CI89:0B0;>3 10 8466111 CAB0=>28BLB5:CICN>1;0ABL 10 8466121 CAB0=>28BLB5;>8742>8G=KE40==KE 29 8466131 CAB0=>28BLB5;>87AB@>:8 28 8466160 CAB0=>28BLB8?0;3>@8B<0E5H8@>20=8O?0@>;59?>;L7>20B5;59 19 8466188 CAB0=>28BLB8?D09;0 16 8466207 CAB0=>28BLB>;L:>GB5=85 29 8466223 CAB0=>28BLB>;L:>GB5=850A8=E 18 8466252 CAB0=>28BLB>G:C 33 8466270 CAB0=>28BLC75;0B@81CB0 269 8466303 CAB0=>28BLC75;0B@81CB0845=B8D8:0B>@0 269 8466572 CAB0=>28BLC=825@A0;L=>52@5<O87<5=5=8O 18 8466841 CAB0=>28BLC=825@A0;L=>52@5<O87<5=5=8O0A8=E 18 8466859 CAB0=>28BLD;038A>>1I5=89 10 8466877 CAB0=>28BLD;06:8 12 8466887 CAB0=>28BLD;06>: 12 8466899 CAB0=>28BLD>@<0B 10 8466911 CAB0=>28BLD>@<0B8@>20==CNAB@>:C 12 8466921 CAB0=>28BLG0A>2>9?>OA8=D>@<0F8>==>9107K 21 8466933 CAB0=>28BLG0A>2>9?>OAA50=A0 16 8466954 CAB0=>28BLM;5<5=B 14 8466970 CAB0=>28BLM;5<5=BC?@02;5=8O 44 8466984 CAB0=>2:0 2024 8467028 CAB0=>2:0< 10 8469052 CAB0=>2:0<8 58 8469062 CAB0=>2:0?0@0<5B@>2A50=A0 30 8469120 CAB0=>2:0?@8;>65=89 9 8469150 CAB0=>2:0E 6 8469159 CAB0=>2:5 419 8469165 CAB0=>2:8 631 8469584 CAB0=>2:>9 79 8470215 CAB0=>2:C 198 8470294 CAB0=>2;5= 2491 8470492 CAB0=>2;5=0 853 8472983 CAB0=>2;5=85 5 8473836 CAB0=>2;5=8O 5 8473841 CAB0=>2;5==0O 18 8473846 CAB0=>2;5===K< 4 8473864 CAB0=>2;5==> 5 8473868 CAB0=>2;5==>3> 336 8473873 CAB0=>2;5==>5 151 8474209 CAB0=>2;5==>9 262 8474360 CAB0=>2;5==>< 82 8474622 CAB0=>2;5==><C 147 8474704 CAB0=>2;5==>AB8 4 8474851 CAB0=>2;5==>ABL 5 8474855 CAB0=>2;5==CN 18 8474860 CAB0=>2;5==K5 443 8474878 CAB0=>2;5==K9 8617 8475321 CAB0=>2;5==K< 321 8483938 CAB0=>2;5==K<8 88 8484259 CAB0=>2;5==KE 133 8484347 CAB0=>2;5=> 3557 8484480 CAB0=>2;5=D;03 10 8488037 CAB0=>2;5=K 293 8488047 CAB0=>2;8205B 4 8488340 CAB0=>2>: 143 8488344 CAB0@5205B 5 8488487 CAB0@520=85 15 8488492 CAB0@520=8O 15 8488507 CAB0@520BL 5 8488522 CAB0@52H55 9 8488527 CAB0@52H59 5 8488536 CAB0@52H5<C 8 8488541 CAB0@52H89 36 8488549 CAB0@52H8< 20 8488585 CAB0@5; 6 8488605 CAB0@5;> 8 8488611 CAB0@5BL 14 8488619 CAB>9G82K9 15 8488633 CAB@0=8B 9 8488648 CAB@0=8BL 9 8488657 CAB@0=O5BAO 4 8488666 CAB@0=OBLAO 4 8488670 CAB@>9AB2 50 8488674 CAB@>9AB20 469 8488724 CAB@>9AB20< 5 8489193 CAB@>9AB20<8 4 8489198 CAB@>9AB20E 264 8489202 CAB@>9AB25 203 8489466 CAB@>9AB2> 911 8489669 CAB@>9AB2>< 22 8490580 CB25@640NI0O 18 8490602 CB5@O=0 5 8490620 CB5@O==K9 5 8490625 CB5H5==K9 103 8490630 CB8;8B0 12 8490733 CB8;8BK 12 8490745 CB>G=5=85 173 8490757 CB>G=5=85< 38 8490930 CB>G=5=85?5@8>40 187 8490968 CB>G=5=8N 5 8491155 CB>G=5=8O 144 8491160 CB>G=8B8 4 8491304 CB>G=8BL 4 8491308 CB>G=O5B 5 8491312 CB>G=O5BAO 4 8491317 CB>G=OBL 11 8491321 CB>G=OBLAO 4 8491332 CB>G=ONB 6 8491336 CB>G=ONI89 11 8491342 CB>G=ONI8E 11 8491353 CB@0 24 8491364 CB@> 24 8491388 CE>4 5 8491412 CE>45 5 8491417 CF 7 8491422 CG0AB2>202H89 9 8491429 CG0AB2>202H8E 9 8491438 CG0AB2>20BL 368 8491447 CG0AB2C5B 283 8491815 CG0AB2CNB 78 8492098 CG0AB2CNI53> 42 8492176 CG0AB2CNI85 22 8492218 CG0AB2CNI89 98 8492240 CG0AB2CNI8< 4 8492338 CG0AB2CNI8E 30 8492342 CG0AB85 223 8492372 CG0AB8O 23 8492595 CG0AB:8 5 8492618 CG0AB=8: 154 8492623 CG0AB=8:0 42 8492777 CG0AB=8:0< 9 8492819 CG0AB=8:2845>:>=D5@5=F88 9 8492828 CG0AB=8:8 44 8492837 CG0AB=8:>1AC645=8O 9 8492881 CG0AB=8:>2 92 8492890 CG0AB>: 5 8492982 CG5ABL 4 8492987 CG5B 1465 8492991 CG5B0 410 8494456 CG5B=0O 31 8494866 CG5B=0O70?8AL 50 8494897 CG5B=0O70?8AL:0;5=40@59 43 8494947 CG5B=0O70?8AL:>=B0:B0 6 8494990 CG5B=0O70?8AL:>=B0:B>2 43 8494996 CG5B=>9 236 8495039 CG5B=><5=:;0BC@K 86 8495275 CG5B=><5=:;0BC@K>AB0B:88>1>@>BK 7 8495361 CG5B=CN 31 8495368 CG5B=K5 17 8495399 CG5B=K9 327 8495416 CG5B=KE 51 8495743 CG5B>< 1081 8495794 CG5BB>20@>2 45 8496875 CG8B8 10 8496920 CG8BK205B 25 8496930 CG8BK205BAO 196 8496955 CG8BK20BL 795 8497151 CG8BK20BL>@85=B0F8NAB@0=8FK 20 8497946 CG8BK20BL?@8G8=K 5 8497966 CG8BK20BL@0745;8B5;8AB@>: 9 8497971 CG8BK20BL@538AB@ 9 8497980 CG8BK20BLAO 789 8497989 CG8BK20NBAO 583 8498778 CG8BL 10 8499361 CGB5==K9 10 8499371 CGB5=K 10 8499381 CGQB=>9 4 8499391 CGQB=CN 4 8499395 CGQB>< 8 8499399 CN 24 8499407 CO728<>AB8 4 8499431 CO728<>ABL 4 8499435 D01@8:0 153 8499439 D01@8:0xdto 197 8499592 D01@8:5 5 8499789 D01@8:8 19 8499794 D01@8:C 25 8499813 D07 4 8499838 D070 17 8499842 D075 4 8499859 D09; 5863 8499863 D09;0 3116 8505726 D09;0< 167 8508842 D09;0<8 595 8509009 D09;0E 29 8509604 D09;5 418 8509633 D09;70H8D@>20==>3>:>=B59=5@0base64 12 8510051 D09;:0@B8=:8 5 8510063 D09;>2 936 8510068 D09;>20O 21 8511004 D09;>2>3> 45 8511025 D09;>2>9 199 8511070 D09;>2>< 56 8511269 D09;>2><C 6 8511325 D09;>2CN 63 8511331 D09;>2K5 10 8511394 D09;>2K5?>B>:8 21 8511404 D09;>2K9 436 8511425 D09;>2K9?>B>: 719 8511861 D09;>2K< 9 8512580 D09;>2KE 19 8512589 D09;>< 95 8512608 D09;A5@B8D8:0B0base64 12 8512703 D09;C 443 8512715 D09;K 282 8513158 D0:A 12 8513440 D0:B 87 8513452 D0:B8G5A:0O 15 8513539 D0:B8G5A:8 185 8513554 D0:B8G5A:85 32 8513739 D0:B8G5A:89 372 8513771 D0:B8G5A:89?5@8>4459AB28O 91 8514143 D0:B8G5A:8< 19 8514234 D0:B8G5A:8E 22 8514253 D0:B8G5A:>3> 67 8514275 D0:B8G5A:>5 84 8514342 D0:B8G5A:>9 10 8514426 D0:B8G5A:>< 5 8514436 D0:B8G5A:><C 18 8514441 D0:B>2 39 8514459 D0:B>@ 162 8514498 D0:B>@0 110 8514660 D0:B>@0<8 4 8514770 D0:B>@;8=88B@5=404803@0<<K 24 8514774 D0:B>@>2 9 8514798 D0:BC 5 8514807 D0<8;88 7 8514812 D0<8;8N 9 8514819 D0<8;8O 86 8514828 D0@5@A:85 12 8514914 D0@5@A:89 14 8514926 D0@D>@ 49 8514940 D0A 4 8514989 D0A5B 507 8514993 D0A5Bxdto 27 8515500 D0A5B0 239 8515527 D0A5B4;8=K 9 8515766 D0A5B4;8=Kxs 848 8515775 D0A5B:>;8G5AB20@07@O4>24@>1=>9G0AB8 9 8516623 D0A5B:>;8G5AB20@07@O4>24@>1=>9G0AB8xs 849 8516632 D0A5B<0:A8<0;L=>3>2:;NG0NI53>7=0G5=8Oxs 862 8517481 D0A5B<0:A8<0;L=>3>8A:;NG0NI53>7=0G5=8Oxs 861 8518343 D0A5B<0:A8<0;L=>94;8=K 9 8519204 D0A5B<0:A8<0;L=>94;8=Kxs 849 8519213 D0A5B<8=8<0;L=>3>2:;NG0NI53>7=0G5=8Oxs 861 8520062 D0A5B<8=8<0;L=>3>8A:;NG0NI53>7=0G5=8Oxs 861 8520923 D0A5B<8=8<0;L=>94;8=K 9 8521784 D0A5B<8=8<0;L=>94;8=Kxs 849 8521793 D0A5B>1@07F0 9 8522642 D0A5B>1@07F0xs 849 8522651 D0A5B>1I53>:>;8G5AB20@07@O4>2 9 8523500 D0A5B>1I53>:>;8G5AB20@07@O4>2xs 849 8523509 D0A5B>2 34 8524358 D0A5B?5@5G8A;5=8O 9 8524392 D0A5B?5@5G8A;5=8Oxs 849 8524401 D0A5B?@>15;L=KEA8<2>;>2 9 8525250 D0A5B?@>15;L=KEA8<2>;>2xs 853 8525259 D0A5BC 4 8526112 D0A5BK 36 8526116 D52@0;L 8 8526152 D545@0F88 8 8526160 D545@0F8O 24 8526168 D5= 20 8526192 D5@<0 5 8526212 D5@<>9 5 8526217 D83C@ 4 8526222 D83C@0 148 8526226 D83C@0:0@B8=:8<=>65AB25==>3>7=0G5=8O 10 8526374 D83C@0:0@B8=:8<=>65AB25==>3>7=0G5=8O?>;O22>40 24 8526384 D83C@0:=>?:8 28 8526408 D83C@8@>20BL 96 8526436 D83C@8@C5B 55 8526532 D83C@8@CNB 5 8526587 D83C@8@CNI55 11 8526592 D83C@8@CNI89 11 8526603 D83C@=K9 14 8526614 D83C@=KE 14 8526628 D83C@C 32 8526642 D83C@K 40 8526674 D83C@K3@0D8G5A:>9AE5<K 79 8526714 D878G5A:0O 14 8526793 D878G5A:8 46 8526807 D878G5A:85;8F0 6 8526853 D878G5A:89 135 8526859 D878G5A:>3> 21 8526994 D878G5A:>5 9 8527015 D878G5A:>9 16 8527024 D878G5A:>< 8 8527040 D878G5A:><C 8 8527048 D878G5A:CN 12 8527056 D87;8F 5 8527068 D87;8F0 11 8527073 D87;8F0A?8A>: 5 8527084 D87;8F> 64 8527089 D8:A0F88 41 8527153 D8:A0F8N 4 8527194 D8:A0F8O 90 8527198 D8:A0F8O2B01;8F5 40 8527288 D8:A0F8O:><?>=>2:840==KE 22 8527328 D8:A0F8OA25@EC 28 8527350 D8:A0F8OA;520 28 8527378 D8:A0F8OA=87C 11 8527406 D8:A0F8OA?@020 11 8527417 D8:A8@>20= 10 8527428 D8:A8@>20=0 5 8527438 D8:A8@>20==0O 63 8527443 D8:A8@>20==0O:>;;5:F8O 44 8527506 D8:A8@>20==0OAB@C:BC@0 195 8527550 D8:A8@>20==>3> 93 8527745 D8:A8@>20==>5 53 8527838 D8:A8@>20==>5A>>B25BAB285 122 8527891 D8:A8@>20==>9 41 8528013 D8:A8@>20==>< 4 8528054 D8:A8@>20==CN 19 8528058 D8:A8@>20==K5 26 8528077 D8:A8@>20==K5=0AB@>9:8 47 8528103 D8:A8@>20==K9 781 8528150 D8:A8@>20==K9<0AA82 737 8528931 D8:A8@>20==K9@07<5@ 9 8529668 D8:A8@>20==K9A?8A>::><?>=5=Bxs 209 8529677 D8:A8@>20==K9D>= 11 8529886 D8:A8@>20==K< 4 8529897 D8:A8@>20==K<8 5 8529901 D8:A8@>20==KE 31 8529906 D8:A8@>20BL 483 8529937 D8:A8@>20BL703>;>2>:87<5@5=89 9 8530420 D8:A8@>20BL703>;>2>:H:0;K2@5<5=8 9 8530429 D8:A8@>20BLA25@EC 5 8530438 D8:A8@>20BLA;520 5 8530443 D8:A8@>20BLAO 19 8530448 D8:A8@C5B 6 8530467 D8:A8@C5BAO 12 8530473 D8:A8@CNBAO 5 8530485 D8:B82=>9 4 8530490 D8:B82=CN 5 8530494 D8:B82=K9 9 8530499 D8;0 365 8530508 D8;52 5 8530873 D8;8??8=K 12 8530878 D8;LB@ 363 8530890 D8;LB@1 10 8531253 D8;LB@2 10 8531263 D8;LB@xpath 15 8531273 D8;LB@0 75 8531288 D8;LB@0F88 76 8531363 D8;LB@0F8O 169 8531439 D8;LB@2K1>@:8 6 8531608 D8;LB@480;>30 5 8531614 D8;LB@5 21 8531619 D8;LB@8<5=D09;>2 11 8531640 D8;LB@>1@01>B:8A:0=8@>20=8O4>:C<5=B>2 24 8531651 D8;LB@>2 44 8531675 D8;LB@>20BL 10 8531719 D8;LB@>20BLAO 4 8531729 D8;LB@>< 13 8531733 D8;LB@C 24 8531746 D8;LB@C5<K9 4 8531770 D8;LB@C5<KE 4 8531774 D8;LB@C7;>2dom 106 8531778 D8;LB@CNBAO 4 8531884 D8;LB@K 8 8531888 D8;LB@K>1@01>B:8 9 8531896 D8;O 365 8531905 D8=0; 39 8532270 D8=0=A>2K9 5 8532309 D8=8H 48 8532314 D8=;O=48O 16 8532362 D8=A:89 34 8532378 D8=A:>3> 14 8532412 D8> 5 8532426 D8>;5B>2> 5 8532431 D8>;5B>2K9 38 8532436 D8@<0 16 8532474 D8@<K 16 8532490 D;03 331 8532506 D;030 44 8532837 D;03020@89=>3>7025@H5=8O 4 8532881 D;030<8 6 8532885 D;038 19 8532891 D;0388=B5@=5B?>GB>2>3>A>>1I5=8O 55 8532910 D;03>2 9 8532965 D;03>< 33 8532974 D;03C 4 8533007 D;06:0 239 8533011 D;06:0< 5 8533250 D;06:8 27 8533255 D;06:>2 5 8533282 D;06:>< 10 8533287 D;06>: 415 8533297 D;06>:CAB0=>2;5= 9 8533712 D;0B 9 8533721 D>:CA 18 8533730 D>:CA0 14 8533748 D>= 1294 8533762 D>=0 1198 8535056 D>=0@8: 14 8536254 D>=0@8:0 11 8536268 D>=5 14 8536279 D>=>20O 5 8536293 D>=>20O:0@B8=:0 11 8536298 D>=>289 251 8536309 D>=>2>3> 251 8536560 D>=>2>5 161 8536811 D>=>2>57040=85 205 8536972 D>=>2>57040=85<>18;L=>3>?@8;>65=8O 48 8537177 D>=>2>57040=85D09;>2>3>20@80=B0 48 8537225 D>=>2>9 10 8537273 D>=>2>< 111 8537283 D>=>2CN 5 8537394 D>=>2K5 68 8537399 D>=>2K57040=8O 21 8537467 D>=>2K9 587 8537488 D>=>2K< 10 8538075 D>=>2KE 93 8538085 D>=>:=0 11 8538178 D>=>< 8 8538189 D>=B 820 8538197 D>=C 4 8539017 D>@0 5345 8539021 D>@8=B 7 8544366 D>@< 1138 8544373 D>@<0 20352 8545511 D>@<01 27 8565863 D>@<0xml 38 8565890 D>@<00B@81CB>2?>C<>;G0=8N 15 8565928 D>@<020@80=B0 18 8565943 D>@<02K1>@0 157 8565961 D>@<02K1>@03@C??K 15 8566118 D>@<03@C??K 15 8566133 D>@<040==KE25@A888AB>@8840==KE 18 8566148 D>@<04>:C<5=B0 18 8566166 D>@<0703@C7:8 18 8566184 D>@<0703@C7:820@80=B>2>BG5B>2 12 8566202 D>@<0703@C7:8=0AB@>5:40==KED>@< 12 8566214 D>@<0703@C7:8?>;L7>20B5;LA:8E=0AB@>5:>BG5B>2 12 8566226 D>@<070?8A8 17 8566238 D>@<08AB>@8887<5=5=898AB>@8840==KE 18 8566255 D>@<0:;85=BA:>3>?@8;>65=8O 951 8566273 D>@<0:>=AB0=B 18 8567224 D>@<0;L=89 16 8567242 D>@<0;L=> 13 8567258 D>@<0;L=>3> 16 8567271 D>@<0;L=K9 40 8567287 D>@<0;L=KE 21 8567327 D>@<0< 45 8567348 D>@<0<8 89 8567393 D>@<0=01>@070?8A59 12 8567482 D>@<0=0AB@>5: 18 8567494 D>@<0>1J5:B0 26 8567512 D>@<0>BG5B0 9 8567538 D>@<0?>8A:0 18 8567547 D>@<0?@54AB02;5=8Oxs 35 8567565 D>@<0@07;8G8925@A898AB>@8840==KE 18 8567600 D>@<0A>E@0=5=8O 18 8567618 D>@<0A>E@0=5=8O20@80=B>2>BG5B>2 12 8567636 D>@<0A>E@0=5=8O=0AB@>5:40==KED>@< 12 8567648 D>@<0A>E@0=5=8O?>;L7>20B5;LA:8E=0AB@>5:>BG5B>2 12 8567660 D>@<0A>E@0=5=8OD09;0 10 8567672 D>@<0A?8A:0 88 8567682 D>@<0B 2494 8567770 D>@<0B0 325 8570264 D>@<0B0C48>70?8A8 30 8570589 D>@<0B0E 24 8570619 D>@<0B2B01;8F540==KE 48 8570643 D>@<0B2B01;8F540==KE4803@0<<K 5 8570691 D>@<0B3@C??8@>2:8F8D@G8A5; 54 8570696 D>@<0B40==KE 34 8570750 D>@<0B40==KEAB@>:8 9 8570784 D>@<0B40BK 14 8570793 D>@<0B40BKjson 40 8570807 D>@<0B4=O 15 8570847 D>@<0B4=OH:0;K2@5<5=8 30 8570862 D>@<0B5 1025 8570892 D>@<0B6C@=0;0@538AB@0F88 36 8571917 D>@<0B7=0G5=892?>4?8AOE 58 8571953 D>@<0B7=0G5=892?>4?8AOE4803@0<<K 5 8572011 D>@<0B8>@20==>3> 6 8572016 D>@<0B8@20==>3> 5 8572022 D>@<0B8@>20=85 141 8572027 D>@<0B8@>20=88 21 8572168 D>@<0B8@>20=8N 12 8572189 D>@<0B8@>20=8O 97 8572201 D>@<0B8@>20==0O 41 8572298 D>@<0B8@>20==0OAB@>:0 334 8572339 D>@<0B8@>20==>3> 414 8572673 D>@<0B8@>20==>9 72 8573087 D>@<0B8@>20==>< 28 8573159 D>@<0B8@>20==CN 18 8573187 D>@<0B8@>20==K9 584 8573205 D>@<0B8@>20==K94>:C<5=B 149 8573789 D>@<0B8@>20BL 82 8573938 D>@<0B8@>20BLAO 4 8574020 D>@<0B8@C5<>5 5 8574024 D>@<0B8@C5<K9 5 8574029 D>@<0B8@C5BAO 4 8574034 D>@<0B:0@B8=:8 105 8574038 D>@<0B=0O 47 8574143 D>@<0B=0OAB@>:0 40 8574190 D>@<0B=0OAB@>:0G8A;0 14 8574230 D>@<0B=>9 94 8574244 D>@<0B=><5@0 6 8574338 D>@<0B=CN 113 8574344 D>@<0B=K5 4 8574457 D>@<0B=K9 232 8574461 D>@<0B>2 109 8574693 D>@<0B>< 13 8574802 D>@<0B?5@5=5A5==KE703>;>2:>2H:0;K2@5<5=8 9 8574815 D>@<0B?>4?8A59 9 8574824 D>@<0B?@54AB02;5=8O2@5<5=8 54 8574833 D>@<0B?@54AB02;5=8O40BK 54 8574887 D>@<0B?@>F5=B>22?>4?8AOE 35 8574941 D>@<0B@540:B8@>20=8O 165 8574976 D>@<0BA5@80;870F8840B 9 8575141 D>@<0BAB@>: 23 8575150 D>@<0BAB@>:B01;8G=>3>4>:C<5=B0 28 8575173 D>@<0BC 26 8575201 D>@<0BH0?:8 9 8575227 D>@<0BH:0;K7=0G5=89 18 8575236 D>@<0BK 79 8575254 D>@<0E 70 8575333 D>@<0M;5<5=B0 20 8575403 D>@<0M;5<5=B>2?>C<>;G0=8N 15 8575423 D>@<5 1176 8575438 D>@<5B5 4 8576614 D>@<8@>20=85 1168 8576618 D>@<8@>20=85< 74 8577786 D>@<8@>20=88 332 8577860 D>@<8@>20=8N 4 8578192 D>@<8@>20=8O 552 8578196 D>@<8@>20BL 498 8578748 D>@<8@>20BL>BG5B>1>H81:5 7 8579246 D>@<8@>20BLAO 477 8579253 D>@<8@C5<0O 8 8579730 D>@<8@C5<>3> 20 8579738 D>@<8@C5<>9 10 8579758 D>@<8@C5<>< 4 8579768 D>@<8@C5<CN 8 8579772 D>@<8@C5<K5187=5A?@>F5AAK 13 8579780 D>@<8@C5<K57040G8 12 8579793 D>@<8@C5<K9 106 8579805 D>@<8@C5<KE 35 8579911 D>@<8@C5B 442 8579946 D>@<8@C5BAO 323 8580388 D>@<8@CNBAO 44 8580711 D>@<8@CNI5< 6 8580755 D>@<8@CNI89 11 8580761 D>@<8@CNI8E 5 8580772 D>@<8@CO 5 8580777 D>@<>9 59 8580782 D>@<AB@>:0 7 8580841 D>@<C 1680 8580848 D>@<C; 4 8582528 D>@<C;0 34 8582532 D>@<C;5 16 8582566 D>@<C;K 4 8582582 D>@<K 12962 8582586 D>B> 14 8595548 D>B>2A?KH:0 6 8595562 D>B>3@0D859 4 8595568 D>B>3@0D88 29 8595572 D>B>3@0D89 4 8595601 D>B>3@0D8@>20=85 4 8595605 D>B>3@0D8@>20BL 9 8595609 D>B>3@0D8@C5B 9 8595618 D>B>3@0D8N 4 8595627 D>B>3@0D8O 56 8595631 D>B>A=8<:0 14 8595687 D>B>A=8<>: 18 8595701 D>B>AJ5<:0 5 8595719 D>B>AJ5<:C 5 8595724 D? 7 8595729 D?4 6 8595736 D@03<5=B 708 8595742 D@03<5=Bxs 849 8596450 D@03<5=B0 409 8597299 D@03<5=B0<8 5 8597708 D@03<5=B4>:C<5=B0 1132 8597713 D@03<5=B4>:C<5=B0dom 806 8598845 D@03<5=B:><0=4=>3>8=B5@D59A0 10 8599651 D@03<5=B>2 28 8599661 D@03<5=BK 125 8599689 D@07 12 8599814 D@070 75 8599826 D@075 12 8599901 D@07K 50 8599913 D@0=F89 12 8599963 D@0=F8O 12 8599975 D@0=FC7A:89 50 8599987 D@0=FC7A:>3> 14 8600037 D@59< 105 8600051 D@59<0 60 8600156 D@59<5 16 8600216 D@59<>2 12 8600232 D@<B5:4>: 4 8600244 D@>=B 9 8600248 D@>=B0;L=0O 4 8600257 D@>=B0;L=K9 4 8600261 DA 6 8600265 DC:A8= 18 8600271 DC:A8=B5<=K9 12 8600289 DC:A8O 13 8600301 DC=:F859 36 8600314 DC=:F88 1213 8600350 DC=:F884;OB5E=8G5A:>3>A?5F80;8AB0 13 8601563 DC=:F89 294 8601576 DC=:F8>=0; 73 8601870 DC=:F8>=0;0 50 8601943 DC=:F8>=0;C 14 8601993 DC=:F8>=0;L=0O 8 8602007 DC=:F8>=0;L=0O>?F8O 263 8602015 DC=:F8>=0;L=>3> 5 8602278 DC=:F8>=0;L=>9 200 8602283 DC=:F8>=0;L=>AB8 65 8602483 DC=:F8>=0;L=>ABL 129 8602548 DC=:F8>=0;L=>ABL<>18;L=>3>?@8;>65=8O 200 8602677 DC=:F8>=0;L=>ABLN 5 8602877 DC=:F8>=0;L=CN 19 8602882 DC=:F8>=0;L=K5 13 8602901 DC=:F8>=0;L=K5>?F88 10 8602914 DC=:F8>=0;L=K9 323 8602924 DC=:F8>=0;L=K< 15 8603247 DC=:F8>=0;L=K<8 7 8603262 DC=:F8>=0;L=KE 82 8603269 DC=:F8>=8@>20=85 35 8603351 DC=:F8>=8@>20=8O 8 8603386 DC=:F8N 93 8603394 DC=:F8O 3022 8603487 DC=:F8O1 6 8606509 DC=:F8O< 113 8606515 DC=:F8O<8 21 8606628 DC=:F8OE 19 8606649 DK=L 6 8606668 E 79 8606674 E999EE99 11 8606753 Epath 4 8606764 E020 6 8606768 E0:8 18 8606774 E0:8B5<=K9 12 8606792 E0=B 26 8606804 E0@0:B5@ 15 8606830 E0@0:B5@87>20BL 4 8606845 E0@0:B5@87>20BLAO 4 8606849 E0@0:B5@87C5B 4 8606853 E0@0:B5@87C5BAO 4 8606857 E0@0:B5@87CNI0O 5 8606861 E0@0:B5@87CNI89 5 8606866 E0@0:B5@8AB8: 2128 8606871 E0@0:B5@8AB8:0 2379 8608999 E0@0:B5@8AB8:0:><?>=>2:840==KEAE5<K70?@>A0 83 8611378 E0@0:B5@8AB8:0<8 19 8611461 E0@0:B5@8AB8:0=><5=:;0BC@K 5 8611480 E0@0:B5@8AB8:8 448 8611485 E0@0:B5@8AB8:8:><?>=>2:840==KEAE5<K70?@>A0 44 8611933 E0@0:B5@=> 4 8611977 E0@0:B5@=K9 4 8611981 E20B05B 21 8611985 E20B0BL 21 8612006 E2>AB>2>9 30 8612027 E2>AB>2KE 30 8612057 E5H 190 8612087 E5H0 12 8612277 E5H8@>20=85 51 8612289 E5H8@>20=8540==KE 60 8612340 E5H8@>20=8O 35 8612400 E5HAC<<0 159 8612435 E5HC 12 8612594 E5HDC=:F8O 54 8612606 E8=48 14 8612660 E<; 5 8612674 E>4 35 8612679 E>40 35 8612714 E>45 31 8612749 E>48BL 5 8612780 E>4OI89 5 8612785 E>7@0AG5B=K9 59 8612790 E>7O8= 41 8612849 E>7O9AB25==>9 5 8612890 E>7O9AB25==K9 18 8612895 E>7O9AB25==KE 13 8612913 E>;>4=0O 10 8612926 E>;>4=89 9 8612936 E>;>4=K9 10 8612945 E>;>4=KE 4 8612955 E>@ 9 8612959 E>@20B8O 12 8612968 E>@20BA:89 14 8612980 E>@>H8< 6 8612994 E>@>H> 8 8613000 E>AB 90 8613008 E>ABs3A10:5B><2A>AB025?CB8 18 8613098 E>AB0 30 8613116 E>B5BL 217 8613146 E>B8< 10 8613363 E>BO 203 8613373 E>G5B 4 8613576 E@0=5=85 456 8613580 E@0=5=89 4 8614036 E@0=5=8N 8 8614040 E@0=5=8O 365 8614048 E@0=5=L5 4 8614413 E@0=8;88I57=0G5=89 5 8614417 E@0=8;8I 39 8614422 E@0=8;8I0 919 8614461 E@0=8;8I0< 14 8615380 E@0=8;8I0<8 16 8615394 E@0=8;8I0=0AB@>5: 25 8615410 E@0=8;8I0=0AB@>5:<5=5465@ 22 8615435 E@0=8;8I0E 15 8615457 E@0=8;8I5 1912 8615472 E@0=8;8I520@80=B>2 13 8617384 E@0=8;8I520@80=B>2>BG5B>2 38 8617397 E@0=8;8I52=5H=8E40==KE=02830F8>==KEAAK;>: 31 8617435 E@0=8;8I52=CB@5==8E=0AB@>5: 6 8617466 E@0=8;8I52=CB@5==8E=0AB@>5:?>C<>;G0=8N 6 8617472 E@0=8;8I540==KE 10 8617478 E@0=8;8I542>8G=KE40==KE 18 8617488 E@0=8;8I57=0G5=8O 247 8617506 E@0=8;8I5:0@B8=:8 21 8617753 E@0=8;8I5< 80 8617774 E@0=8;8I5=0AB@>5: 308 8617854 E@0=8;8I5=0AB@>5:40==KED>@< 38 8618162 E@0=8;8I5=0AB@>5:<5=5465@ 155 8618200 E@0=8;8I5=0AB@>5:>1@01>B:8>H81>: 6 8618355 E@0=8;8I5>1I8E=0AB@>5: 38 8618361 E@0=8;8I5?>;L7>20B5;LA:8E=0AB@>5:48=0<8G5A:8EA?8A:>2 39 8618399 E@0=8;8I5?>;L7>20B5;LA:8E=0AB@>5:>BG5B>2 38 8618438 E@0=8;8I5?>C<>;G0=8N 13 8618476 E@0=8;8I5A5@B8D8:0B>2:@8?B>3@0D88 174 8618489 E@0=8;8I5A8AB5<=KE=0AB@>5: 58 8618663 E@0=8;8I5A8AB5<=KE=0AB@>5:?>C<>;G0=8N 6 8618721 E@0=8;8IC 95 8618727 E@0=8<0O 5 8618822 E@0=8<>5 20 8618827 E@0=8<>9 5 8618847 E@0=8<>< 4 8618852 E@0=8<K5 44 8618856 E@0=8<K9 163 8618900 E@0=8<KE 85 8619063 E@0=8B 107 8619148 E@0=8BAO 238 8619255 E@0=8BL 295 8619493 E@0=8BLAO 379 8619788 E@0=OB 4 8620167 E@0=OBAO 95 8620171 E@0=OI0OAO 4 8620266 E@0=OI53> 17 8620270 E@0=OI53>AO 10 8620287 E@0=OI59 62 8620297 E@0=OI59AO 12 8620359 E@0=OI5<CAO 4 8620371 E@0=OI85 5 8620375 E@0=OI85AO 39 8620380 E@0=OI89 4 8620419 E@0=OI89AO 108 8620423 E@0=OI8<8AO 20 8620531 E@0=OI8<AO 5 8620551 E@0=OI8E 5 8620556 E@0=OI8EAO 14 8620561 E@0=OICN 4 8620575 E@>=>;>388 18 8620579 E@>=>;>38G5A:8 4 8620597 E@>=>;>38G5A:89 24 8620601 E@>=>;>38G5A:8E 5 8620625 E@>=>;>38G5A:>9 5 8620630 E@>=>;>38G5A:>< 14 8620635 E@>=>;>38O 18 8620649 EC65 4 8620667 EMH 12 8620671 EMH8@>20=85 4 8620683 EMH8@>20=8O 4 8620687 EV4 4 8620691 F25AB8 5 8620695 F25B 3778 8620700 F25B0 441 8624478 F25B04803@0<<K 11 8624919 F25B0:B82=>AB8 15 8624930 F25B0:F5=B0 15 8624945 F25B0<8 8 8624960 F25B0AB8;O 191 8624968 F25B0E 4 8625159 F25B206=>3> 15 8625163 F25B206=>9:=>?:8 7 8625178 F25B24803@0<<5 9 8625185 F25B2BC;:887<5@8B5;L=>94803@0<<K 10 8625194 F25B2KE>4=KE4=59 11 8625204 F25B3@0=8FK 32 8625215 F25B4>?>;=8B5;L=>9=02830F88 15 8625247 F25B703@0=8F59?>;=>3>8=B5@20;0 9 8625262 F25B:>=F03@0485=B=>9?0;8B@K 23 8625271 F25B;8=88 38 8625294 F25B;8=88>BG5B0 11 8625332 F25B;8=88A5B:8 9 8625343 F25B;8=88H:0;K 9 8625352 F25B;8=89 29 8625361 F25B;8=89A2O759 9 8625390 F25B<>@A:>92>;=K 12 8625399 F25B<>@A:>92>;=K=59B@0;L=K9 12 8625411 F25B<>@A:>92>;=KA25B;K9 12 8625423 F25B<>@A:>92>;=KB5<=K9 12 8625435 F25B=02830F88 15 8625447 F25B=0G0;03@0485=B=>9?0;8B@K 23 8625462 F25B>1@07F0 9 8625485 F25B>1KG=>9:=>?:8 7 8625494 F25B>2 211 8625501 F25B>2>5 4 8625712 F25B>2>9 26 8625716 F25B>2K5 4 8625742 F25B>2KE 10 8625746 F25B>: 5 8625756 F25B>:15;K9 12 8625761 F25B>< 307 8625773 F25B>A>1>3>B5:AB0 11 8626080 F25B>B<5B:8 5 8626091 F25B>B@8F0B5;L=>3>G8A;0 36 8626096 F25B?>25@E=>AB8 9 8626132 F25B?>4?8A59 9 8626141 F25B@0<:8 758 8626150 F25B@0<:8:=>?:8 11 8626908 F25B@0<:8?>4?8A59 10 8626919 F25BA>548=5=8O7=0G5=89?>A5@8O< 33 8626929 F25BB5:AB0 660 8626962 F25BB5:AB02K45;5=8O 22 8627622 F25BB5:AB02K45;5=8O?>;O 11 8627644 F25BB5:AB03@C??8@>2:8 11 8627655 F25BB5:AB0703>;>2:0 41 8627666 F25BB5:AB0703>;>2:>2 11 8627707 F25BB5:AB0:=>?:8 66 8627718 F25BB5:AB0<=>65AB25==KE7=0G5=89 10 8627784 F25BB5:AB0>1;0AB59?>;59 9 8627794 F25BB5:AB0?>420;0 33 8627803 F25BB5:AB0?>420;0B01;8FK 11 8627836 F25BB5:AB0?>4?8A59 19 8627847 F25BB5:AB0?>4A:07:8 11 8627866 F25BB5:AB0?>;O 88 8627877 F25BB5:AB0D>@<K 11 8627965 F25BB5:AB0H0?:8 24 8627976 F25BB5:AB0H0?:8B01;8FK 11 8628000 F25BC 5 8628011 F25BC7>@0 22 8628016 F25BD83C@K 9 8628038 F25BD>=0 807 8628047 F25BD>=02K45;5=8O 22 8628854 F25BD>=02K45;5=8O?>;O 11 8628876 F25BD>=03@C??8@>2:8 11 8628887 F25BD>=03@C??8@>2:8>BG5B01 11 8628898 F25BD>=03@C??8@>2:8>BG5B02 11 8628909 F25BD>=0703>;>2:0 18 8628920 F25BD>=0703>;>2:0A:@KB>3>>B>1@065=8O 9 8628938 F25BD>=0703>;>2:>2 11 8628947 F25BD>=0:=>?:8 84 8628958 F25BD>=0:=>?>: 9 8629042 F25BD>=0<=>65AB25==KE7=0G5=89 10 8629051 F25BD>=0>1;0AB59?>;59 9 8629061 F25BD>=0?>420;0 33 8629070 F25BD>=0?>420;0B01;8FK 11 8629103 F25BD>=0?>4?8A59 10 8629114 F25BD>=0?>4A:07:8 11 8629124 F25BD>=0?>;O 101 8629135 F25BD>=0D>@<K 16 8629236 F25BD>=0G5@54>20=8OAB@>: 16 8629252 F25BD>=0H0?:8 24 8629268 F25BD>=0H0?:8>BG5B0 11 8629292 F25BD>=0H0?:8B01;8FK 11 8629303 F25BH:0; 32 8629314 F25BH:0;K 27 8629346 F25BHB@8E>2:8<564C8=B5@20;0<8 13 8629373 F25BK 217 8629386 F5; 29 8629603 F5;0O 9 8629632 F5;52>3> 54 8629641 F5;52>5 36 8629695 F5;52>9 324 8629731 F5;52>9?>B>: 55 8630055 F5;52>< 36 8630110 F5;59 71 8630146 F5;5A>>1@07=K9 6 8630217 F5;5A>>1@07=K< 6 8630223 F5;8 7 8630229 F5;8: 62 8630236 F5;8:>< 62 8630298 F5;8BL 62 8630360 F5;>20BL 16 8630422 F5;>3> 46 8630438 F5;>5 595 8630484 F5;>9 144 8631079 F5;>< 159 8631223 F5;>AB=>AB8 40 8631382 F5;>AB=>ABL 52 8631422 F5;>G8A;5==>5 39 8631474 F5;>G8A;5==K9 43 8631513 F5;CN 16 8631556 F5;K5 4 8631572 F5;K9 762 8631576 F5;K< 94 8632338 F5;K<8 5 8632432 F5;KE 69 8632437 F5;L 218 8632506 F5;LN 66 8632724 F5;OE 12 8632790 F5= 42 8632802 F5=0 539 8632844 F5=0B>20@0 5 8633383 F5=0E 6 8633388 F5=>9 9 8633394 F5=B 16 8633403 F5=B0 6 8633419 F5=B>2 7 8633425 F5=B@ 572 8633432 F5=B@0 67 8634004 F5=B@0;87>20=> 5 8634071 F5=B@0;L=89 90 8634076 F5=B@0;L=>3> 90 8634166 F5=B@0;L=>< 30 8634256 F5=B@0;L=K9 126 8634286 F5=B@0;L=K9A5@25@ 11 8634412 F5=B@0;L=K< 10 8634423 F5=B@0<8 4 8634433 F5=B@25@E 9 8634437 F5=B@5 22 8634446 F5=B@8@>20BL 9 8634468 F5=B@8@>20BLAO 5 8634477 F5=B@=87 9 8634482 F5=B@>2 69 8634491 F5=B@>< 11 8634560 F5=B@BO65AB8 18 8634571 F5=B@C 83 8634589 F5=B@K 4 8634672 F5=C 12 8634676 F5=K 44 8634688 F5=K270?@>A5 9 8634732 F5=K:>=:C@5=B>2 6 8634741 F5=KB>20@0 9 8634747 F5?>G5: 16 8634756 F5?>G:0 75 8634772 F5?>G:0< 19 8634847 F5?>G:5 4 8634866 F5?>G:8 24 8634870 F5?>G:C 8 8634894 F7O> 6 8634902 F80= 33 8634908 F80=0:20@5;L=K9 12 8634941 F80==59B@0;L=K9 12 8634953 F80=A25B;K9 12 8634965 F80=B5<=K9 12 8634977 F8:; 2987 8634989 F8:;0 69 8637976 F8:;0<8 6 8638045 F8:;5 15 8638051 F8:;8G5A:8 4 8638066 F8:;8G5A:85 10 8638070 F8:;8G5A:85AAK;:8 6 8638080 F8:;8G5A:89 39 8638086 F8:;8G5A:8E 16 8638125 F8:;8G5A:>3> 17 8638141 F8:;8G5A:>9 5 8638158 F8:;>2 6 8638163 F8:;O 15 8638169 F8;8=4@8G5A:0O 4 8638184 F8;8=4@8G5A:0O?@>5:F8O<8;;5@0 13 8638188 F8;8=4@8G5A:0O?@>5:F8O@02=KE>1;0AB59;0<15@B0 9 8638201 F8;8=4@8G5A:0O@02=>C40;5==0O?@>5:F8O 9 8638210 F8;8=4@8G5A:0OAB5@5>3@0D8G5A:0O?@>5:F8O30;;0 9 8638219 F8;8=4@8G5A:89 12 8638228 F8;8=4@8G5A:>9 8 8638240 F8A;0 4 8638248 F8B8@>20=85 4 8638252 F8B8@>20=8O 4 8638256 F8B8@>20BLA>>1I5=85 9 8638260 F8D@ 181 8638269 F8D@0 633 8638450 F8D@0<8 34 8639083 F8D@>20O 4 8639117 F8D@>2>9 54 8639121 F8D@>2CN 16 8639175 F8D@>2K5 26 8639191 F8D@>9 5 8639217 F8D@C 5 8639222 F8D@K 447 8639227 F8D@K8?C=:BC0F8O 9 8639674 F8D@K=><5@0 6 8639683 FAA 14 8639689 G 37 8639703 G0@ 53 8639740 G0@0 53 8639793 G0@8 53 8639846 G0@K 53 8639899 G0A 392 8639952 G0A0 114 8640344 G0A0< 35 8640458 G0A5 6 8640493 G0A>2 56 8640499 G0A>289 78 8640555 G0A>2> 83 8640633 G0A>2>3> 73 8640716 G0A>2>9 250 8640789 G0A>2>9?>OA 76 8641039 G0A>2>9?>OAA50=A0 20 8641115 G0A>2>< 83 8641135 G0A>2><C 5 8641218 G0A>2K5 55 8641223 G0A>2K9 250 8641278 G0A>2K< 10 8641528 G0A>2KE 76 8641538 G0A>B=0G0;0?5@8>40 9 8641614 G0AB59 275 8641623 G0AB8 2608 8641898 G0AB840B 6 8644506 G0AB840BK 86 8644512 G0AB8B8 2608 8644598 G0AB8BL 2608 8647206 G0AB8G=0O 4 8649814 G0AB8G=> 125 8649818 G0AB8G=>3> 8 8649943 G0AB8G=>5 25 8649951 G0AB8G=K5 9 8649976 G0AB8G=K9 164 8649985 G0AB8G=K< 4 8650149 G0AB8G=KE 8 8650153 G0AB=>5 13 8650161 G0AB=>< 5 8650174 G0AB=>AB8 78 8650179 G0AB=>ABL 78 8650257 G0AB=K9 13 8650335 G0AB=K< 4 8650348 G0AB> 12 8650352 G0AB>< 5 8650364 G0AB>B0 43 8650369 G0AB>B048A:@5B870F88 14 8650412 G0AB>B>9 4 8650426 G0AB>BC 12 8650430 G0AB>BK 8 8650442 G0ABK9 30 8650450 G0ABK9?C=:B8@ 9 8650480 G0ABK<8 4 8650489 G0ABL 3850 8650493 G0ABL40BK 22 8654343 G0ABLN 376 8654365 G0ABO< 39 8654741 G0ABO<8 91 8654780 G0ABOE 19 8654871 G0AK 103 8654890 G0B 4 8654993 G0B0 4 8654997 G0I0 9 8655001 G0I5 9 8655010 G2= 16 8655019 G3 30 8655035 G4F 51 8655065 G53> 133 8655116 G59 94 8655249 G5;>25: 4 8655343 G5;>25:0 4 8655347 G5< 350 8655351 G5<C 4 8655701 G5@54>20=85 40 8655705 G5@54>20=85@0A?>;>65=8OAB@0=8F 47 8655745 G5@54>20=85F25B>2AB@>: 26 8655792 G5@54>20=8O 23 8655818 G5@54>20BLAO 18 8655841 G5@54CNBAO 18 8655859 G5@54CNI89AO 4 8655877 G5@54CNI8EAO 4 8655881 G5@57 1953 8655885 G5@5?8F0 19 8657838 G5@=0 12 8657857 G5@=> 29 8657869 G5@=>15;0O 5 8657898 G5@=>15;0O?5G0BL 29 8657903 G5@=>15;K9 5 8657932 G5@=>15;K9?@>A<>B@ 21 8657937 G5@=>28: 10 8657958 G5@=>3>@8O 22 8657968 G5@=>5 16 8657990 G5@=>9 12 8658006 G5@=>< 4 8658018 G5@=K5 12 8658022 G5@=K9 66 8658034 G5@=K9F25B 4 8658100 G5@=K< 12 8658104 G5@B 39 8658116 G5@B0 49 8658155 G5@B0A25@EC 9 8658204 G5@BC 9 8658213 G5@BK 10 8658222 G5B25@3 16 8658232 G5B25@B8 10 8658248 G5B25@B89 16 8658258 G5B25@B>3> 16 8658274 G5B25@BK9 16 8658290 G5B25@BL 15 8658306 G5B:89 4 8658321 G5B:> 4 8658325 G5B=K5 8 8658329 G5B=K9 8 8658337 G5BK@5 83 8658345 G5BK@5< 20 8658428 G5BK@5E 11 8658448 G5BK@L<O 8 8658459 G5HA:0O 12 8658467 G5HA:89 16 8658479 G8;8 12 8658495 G8A5; 331 8658507 G8A;0 595 8658838 G8A;0<8 24 8659433 G8A;5 466 8659457 G8A;5==89 5 8659923 G8A;5==>3> 5 8659928 G8A;5==>5 31 8659933 G8A;5==>ABL 13 8659964 G8A;5==K9 36 8659977 G8A;8B5;L=>3> 15 8660013 G8A;8B5;L=>5 35 8660028 G8A;8B5;L=K9 35 8660063 G8A;8B5;L=K< 6 8660098 G8A;8B5;L=KE 12 8660104 G8A;> 16211 8660116 G8A;>1 25 8676327 G8A;>2 25 8676352 G8A;>20O 15 8676377 G8A;>289 53 8676392 G8A;>2>3> 49 8676445 G8A;>2>5 90 8676494 G8A;>2>57=0G5=85 9 8676584 G8A;>2>9 278 8676593 G8A;>2><C 4 8676871 G8A;>2K5 40 8676875 G8A;>2K< 10 8676915 G8A;>2KE 69 8676925 G8A;>2M:?>=5=F80;L=><D>@<0B5 4 8676994 G8A;>40B0 6 8676998 G8A;>8742>8G=>9AB@>:8 17 8677004 G8A;>87H5AB=04F0B5@8G=>9AB@>:8 13 8677021 G8A;>< 156 8677034 G8A;><5AOF52 6 8677190 G8A;>?@>?8ALN 28 8677196 G8A;>@07@O4>2 5 8677224 G8A;>@07@O4>24@>1=>9G0AB8 5 8677229 G8A;>A8<2>;>2 37 8677234 G8A;>A>:>=G0=85< 9 8677271 G8A;>C7;>2 5 8677280 G8A;C 92 8677285 G8B05<40BC 7 8677377 G8B05<>3> 36 8677384 G8B05<>5 84 8677420 G8B05<>< 12 8677504 G8B05<K9 148 8677516 G8B05<KE 8 8677664 G8B05B 41 8677672 G8B05BAO 9 8677713 G8B0B5;5< 3 8677722 G8B0B5;L 3 8677725 G8B0BL 75 8677728 G8B0BLAO 36 8677803 G8B0NBAO 27 8677839 G;5= 19 8677866 G;5=>2 14 8677885 G;5=>< 5 8677899 G= 21 8677904 G> 24 8677925 G@3 22 8677949 G@4 24 8677971 GA 30 8677995 GB5=85 48290 8678025 GB5=85fastinfoset 318 8726315 GB5=85html 47 8726633 GB5=85json 96 8726680 GB5=85pdf 151 8726776 GB5=85xml 500 8726927 GB5=85zipD09;0 68 8727427 GB5=8540==KE 493 8727495 GB5=857025@H5=> 9 8727988 GB5=8570?8AL 5 8727997 GB5=8570D8:A8@>20==KE 13 8728002 GB5=85870?8AL 18 8728015 GB5=858AB>@8840==KE 6 8728033 GB5=858AB>@8840==KE>BACBAB2CNI8E40==KE 6 8728039 GB5=858AB>@88>BACBAB2CNI8E40==KE 5 8728045 GB5=85< 4 8728050 GB5=85=570D8:A8@>20==KE 9 8728054 GB5=85@07@5H5=> 11 8728063 GB5=85A>>1I5=8O 39 8728074 GB5=85A>>1I5=8O>1<5=0 88 8728113 GB5=85B5:AB0 65 8728201 GB5=85C7;>2dom 302 8728266 GB5=85D09;00@E820 68 8728568 GB5=88 350 8728636 GB5=8N 16 8728986 GB5=8O 3333 8729002 GB> 4220 8732335 GB>1K 927 8736555 GC2AB28B5;L=>AB8 26 8737482 GC2AB28B5;L=>ABL 30 8737508 GC2AB28B5;L=K 120 8737538 GC2AB28B5;L=K9 120 8737658 GD 9 8737778 GF 24 8737787 GG 26 8737811 GL5 17 8737837 GL8 69 8737854 H01;>= 602 8737923 H01;>=urlhttpA5@28A0 246 8738525 H01;>=0 249 8738771 H01;>=0< 5 8739020 H01;>=0E 72 8739025 H01;>=5 39 8739097 H01;>==0AB@>9:82B>@>3>D0:B>@00CB5=B8D8:0F88 57 8739136 H01;>==89 34 8739193 H01;>==>3> 32 8739227 H01;>==>5 21 8739259 H01;>==><C 10 8739280 H01;>==K5 10 8739290 H01;>==K9 46 8739300 H01;>==K< 10 8739346 H01;>==KE 10 8739356 H01;>=>2 28 8739366 H01;>=?>8A:0 6 8739394 H01;>=?>A;54>20B5;L=>AB80=0;87040==KE 43 8739400 H01;>=A>>1I5=8O 9 8739443 H01;>=A>>1I5=8OA8AB5<K2708<>459AB28O 52 8739452 H01;>=C 32 8739504 H01;>=K 20 8739536 H01;>=Kurl 9 8739556 H01;>=K=0AB@>5:2B>@>3>D0:B>@00CB5=B8D8:0F88 14 8739565 H01;>=K>3@0=8G5=89 48 8739579 H01;>=K?>A;54>20B5;L=>AB59 18 8739627 H03 118 8739645 H030 14 8739763 H030< 17 8739777 H030<8 29 8739794 H035 28 8739823 H03@07<5B:8 20 8739851 H03H:0;K 9 8739871 H0?:0 212 8739880 H0?:04>:C<5=B0 5 8740092 H0?:5 63 8740097 H0?:8 109 8740160 H0?:C 9 8740269 H0@ 12 8740278 H0@0 12 8740290 H0E<0B=0OA5B:0 9 8740302 H0E<0B=>< 4 8740311 H0E<0B=K9 4 8740315 H254A:89 16 8740319 H259F0@8O 18 8740335 H25F8O 12 8740353 H59? 8 8740365 H5;:>2K9 5 8740373 H5;:>2K9>BB5=>: 12 8740378 H5AB0O 20 8740390 H5AB=04F0B5@8G=0O 5 8740410 H5AB=04F0B5@8G=0OAB@>:0 6 8740415 H5AB=04F0B5@8G=>5 4 8740421 H5AB=04F0B5@8G=CN 5 8740425 H5AB=04F0B5@8G=K9 21 8740430 H5AB=04F0B5@8G=KE 15 8740451 H5AB>3> 16 8740466 H5AB>9 36 8740482 H5ABL 6 8740518 H8@5 8 8740524 H8@8=0 1482 8740532 H8@8=02<5AOF0E 13 8742014 H8@8=02K?040NI53>A?8A:0 10 8742027 H8@8=03>@;02>@>=:8 10 8742037 H8@8=0:>;>=:8 18 8742047 H8@8=0?>4G8=5==KEM;5<5=B>2 33 8742065 H8@8=0?>4G8=5==KEM;5<5=B>2D>@<K 47 8742098 H8@8=0?>;O 18 8742145 H8@8=0A60B8O@57C;LB0B0251:;85=B0 7 8742163 H8@8=0A60B8O@57C;LB0B0<>18;L=>3>9?;0BD>@<K 6 8742170 H8@8=0A60B8O@57C;LB0B0<>18;L=>3>:;85=B0 7 8742176 H8@8=0A60B8O@57C;LB0B0<>18;L=>9?;0BD>@<K 6 8742183 H8@8=0A60B8O@57C;LB0B0B>:=>3>:;85=B0 6 8742189 H8@8=0A60B8O@57C;LB0B0B>=:>3>:;85=B0 6 8742195 H8@8=0A?8A:02K1>@0 22 8742201 H8@8=0AB@0=8FK 12 8742223 H8@8=0B01;8FK 28 8742235 H8@8=0M;5<5=B0 26 8742263 H8@8=5 160 8742289 H8@8=>9 24 8742449 H8@8=C 482 8742473 H8@8=K 237 8742955 H8@>:89 41 8743192 H8@>:>9 24 8743233 H8@>B0 24 8743257 H8@>B0A525@=>93@0=8FK 22 8743281 H8@>B0N6=>93@0=8FK 22 8743303 H8@>BC 8 8743325 H8D@>20=85 178 8743333 H8D@>20=8O 87 8743511 H8D@>20BL 5 8743598 H8D@C5B 5 8743603 H:0; 8 8743608 H:0;0 751 8743616 H:0;02@5<5=8 66 8744367 H:0;04803@0<<K 165 8744433 H:0;07=0G5=89 32 8744598 H:0;0A5@89 32 8744630 H:0;0B>G5: 32 8744662 H:0;5 145 8744694 H:0;>9 4 8744839 H:0;C 25 8744843 H:0;K 573 8744868 H>2 10 8745441 H>:>;04=K9 13 8745451 H>AA5 4 8745464 H@8DB 1459 8745468 H@8DB0 207 8746927 H@8DB480;>3>28<5=N 11 8747134 H@8DB703>;>2:0 41 8747145 H@8DB<=>65AB25==KE7=0G5=89 10 8747186 H@8DB>1@07F0 9 8747196 H@8DB>2 27 8747205 H@8DB>2>5 4 8747232 H@8DB>2>9 4 8747236 H@8DB>< 8 8747240 H@8DB?>420;0 32 8747248 H@8DB?>4?8A59 19 8747280 H@8DBA8<2>;0 18 8747299 H@8DBB5:AB0 31 8747317 H@8DBC 5 8747348 H@8DBH0?:8 28 8747353 H@8DBK 42 8747381 H@8DBKAB8;O 42 8747423 HB 6 8747465 HB0<? 45 8747471 HB0B 18 8747516 HB0B=K5548=8FK 6 8747534 HB0B=K9 20 8747540 HB0B=K<8 12 8747560 HB0BK 14 8747572 HB@8E 16 8747586 HB@8E0<8 12 8747602 HB@8E:>4 106 8747614 HB@8E:>40 5 8747720 HB@8E:>4>2 28 8747725 HB@8E:>4K 83 8747753 HB@8E>2:0 17 8747836 HB@8E>2:0<564C8=B5@20;0<8 9 8747853 HB@8E>2:0?5@5:@K20NI8EAO8=B5@20;>2 9 8747862 HB@8E>2:8 4 8747871 HB@8E>2:>9 13 8747875 HBC: 5 8747888 HBC:0 5 8747893 HC< 8 8747898 HC<>2 8 8747906 HK 7 8747914 HV 7 8747921 I5;8 5 8747928 I5;:=8B5 5 8747933 I5;:=CBL 9 8747938 I5;G:5 114 8747947 I5;G:8 5 8748061 I5;G:>< 4 8748066 I5;G:C 10 8748070 I5;G>: 152 8748080 I5;L 5 8748232 K 5 8748237 L 6 8748242 M:204>@ 12 8748248 M:2820;5=Bhttp 9 8748260 M:2820;5=B5= 8 8748269 M:2820;5=B=0 6 8748277 M:2820;5=B=> 57 8748283 M:2820;5=B=>AB8 6 8748340 M:2820;5=B=>ABL 11 8748346 M:2820;5=B=K9 75 8748357 M:75<;O@0 6 8748432 M:75<?;O@ 1008 8748438 M:75<?;O@0 737 8749446 M:75<?;O@5 39 8750183 M:75<?;O@>2 51 8750222 M:75<?;O@>2=0AB@0=8F5 12 8750273 M:75<?;O@>< 4 8750285 M:75<?;O@C 8 8750289 M:75<?;O@K 494 8750297 M:>=><88 16 8750791 M:>=><8G=>< 7 8750807 M:>=><8G=K9 8 8750814 M:>=><8O 16 8750822 M:@0= 373 8750838 M:@0=0 156 8751211 M:@0=0E 6 8751367 M:@0=5 66 8751373 M:@0=8@>20= 9 8751439 M:@0=8@>20=85 21 8751448 M:@0=8@>20=85< 4 8751469 M:@0=8@>20=85A8<2>;>2 14 8751473 M:@0=8@>20=85A8<2>;>2json 28 8751487 M:@0=8@>20=8O 12 8751515 M:@0=8@>20==K9 13 8751527 M:@0=8@>20=K 4 8751540 M:@0=8@>20BL 12 8751544 M:@0=8@>20BL0<?5@A0=4 14 8751556 M:@0=8@>20BL>48=0@=K5:02KG:8 15 8751570 M:@0=8@>20BL@0745;8B5;8AB@>: 14 8751585 M:@0=8@>20BLA;5H 15 8751599 M:@0=8@>20BLAO 22 8751614 M:@0=8@>20BLC3;>2K5A:>1:8 14 8751636 M:@0=8@CNBAO 6 8751650 M:@0==0O 12 8751656 M:@0==>9 16 8751668 M:@0==K9 28 8751684 M:@0=>2 45 8751712 M:@0=C 20 8751757 M:A?;C0B0F88 11 8751777 M:A?;C0B0F8O 11 8751788 M:A?>=5=F80;L=0O 4 8751799 M:A?>=5=F80;L=>9 4 8751803 M:A?>=5=F80;L=>< 4 8751807 M:A?>=5=F80;L=K9 15 8751811 M:A?>@B 204 8751826 M:A?>@B0 4 8752030 M:A?>@B5 9 8752034 M:A?>@B8@>20BLAO 12 8752043 M:A?>@B8@C5<>3> 4 8752055 M:A?>@B8@C5<>9 110 8752059 M:A?>@B8@C5<K5 24 8752169 M:A?>@B8@C5<K9 152 8752193 M:A?>@B8@C5<K< 6 8752345 M:A?>@B8@C5<KE 16 8752351 M:A?>@B8@CNBAO 12 8752367 M:A?>@B<>45;8xdto 14 8752379 M:A?>@B=>9 14 8752393 M:A?>@B=K5 8 8752407 M:A?>@B=K9 42 8752415 M:A?>@B=K< 8 8752457 M:A?>@B=KE 12 8752465 M:A?>@BAE5<Kxml 15 8752477 M;5:B@>==0O 27 8752492 M;5:B@>==>9 259 8752519 M;5:B@>==CN 76 8752778 M;5:B@>==K9 369 8752854 M;5:B@>==K<8 5 8753223 M;5:B@>==KE 22 8753228 M;5:B@>=>6 12 8753250 M;5<5<5=B0< 5 8753262 M;5<5=B 26664 8753267 M;5<5=B1 5 8779931 M;5<5=Bb 5 8779936 M;5<5=Bdom 1335 8779941 M;5<5=Bhtml 1455 8781276 M;5<5=Bn 4 8782731 M;5<5=BzipD09;0 101 8782735 M;5<5=B0 11145 8782836 M;5<5=B0< 157 8793981 M;5<5=B0<8 715 8794138 M;5<5=B0?;5Bhtml 1353 8794853 M;5<5=B0E 83 8796206 M;5<5=B181;8>B5:8<0:5B>2>D>@<;5=8O:><?>=>2:840==KE 50 8796289 M;5<5=B1;>:html 1299 8796339 M;5<5=B1;>:8@>2:8 20 8797638 M;5<5=B1;>:8@>2:840==KE 66 8797658 M;5<5=B1CD5@0>1<5=0 30 8797724 M;5<5=B22>40html 1376 8797754 M;5<5=B2;045;5F 159 8799130 M;5<5=B2AB02:0html 1321 8799289 M;5<5=B3@0D8G5A:>9AE5<K2;>65==K9187=5A?@>F5AA 154 8800610 M;5<5=B3@0D8G5A:>9AE5<K2K1>@20@80=B0 184 8800764 M;5<5=B3@0D8G5A:>9AE5<K459AB285 165 8800948 M;5<5=B3@0D8G5A:>9AE5<K45:>@0B82=0O;8=8O 141 8801113 M;5<5=B3@0D8G5A:>9AE5<K45:>@0F8O 155 8801254 M;5<5=B3@0D8G5A:>9AE5<K7025@H5=85 150 8801409 M;5<5=B3@0D8G5A:>9AE5<K>1@01>B:0 154 8801559 M;5<5=B3@0D8G5A:>9AE5<K@0745;5=85 154 8801713 M;5<5=B3@0D8G5A:>9AE5<KA;8O=85 154 8801867 M;5<5=B3@0D8G5A:>9AE5<KA>548=8B5;L=0O;8=8O 139 8802021 M;5<5=B3@0D8G5A:>9AE5<KAB0@B 142 8802160 M;5<5=B3@0D8G5A:>9AE5<KCA;>285 154 8802302 M;5<5=B3@C??8@>2:8<0:5B0:><?>=>2:840==KE 91 8802456 M;5<5=B40==KE 43 8802547 M;5<5=B40==KE:>=B0:B0 45 8802590 M;5<5=B40==KE:>=B0:B0<3=>25==K5A>>1I5=8O 30 8802635 M;5<5=B45=4@>3@0<<K 68 8802665 M;5<5=B4>:C<5=B0 140 8802733 M;5<5=B4>?>;=8B5;L=KE40==KE70?CA:0?@8;>65=8O<>18;L=>3>CAB@>9AB20 33 8802873 M;5<5=B5 559 8802906 M;5<5=B703>;>2>:html 1296 8803465 M;5<5=B703>;>2>:B01;8FKhtml 1298 8804761 M;5<5=B871@0==>3>@01>BK?>;L7>20B5;O 54 8806059 M;5<5=B87<5@5=8O 106 8806113 M;5<5=B87<5@5=8O?;0=8@>2I8:0 116 8806219 M;5<5=B8=45:A0 8 8806335 M;5<5=B8=D>@<0F88>2K?>;=5=88>1=>2;5=8O:>=D83C@0F88107K40==KE 19 8806343 M;5<5=B8AB>@88@01>BK?>;L7>20B5;O 19 8806362 M;5<5=B:0@B8=:0html 1353 8806381 M;5<5=B:=>?:0html 1331 8807734 M;5<5=B:>;>=:0B01;8FKhtml 1313 8809065 M;5<5=B;535=4K 6 8810378 M;5<5=B;535=4K35>3@0D8G5A:>9AE5<K 68 8810384 M;5<5=B;8=8Ohtml 1299 8810452 M;5<5=B<0AA820 43 8811751 M;5<5=B<5B0html 1312 8811794 M;5<5=B=01>@D@59<>2html 1302 8813106 M;5<5=B=0AB@>9:8>D>@<;5=8O 52 8814408 M;5<5=B=0AB@>9:8A>AB0208=B5@D59A0:;85=BA:>3>?@8;>65=8O 36 8814460 M;5<5=B>1;0AB8<0:5B0>D>@<;5=8O:><?>=>2:840==KE 69 8814496 M;5<5=B>1;0AB8>D>@<;5=8O 48 8814565 M;5<5=B>1J5:Bhtml 1372 8814613 M;5<5=B>2 5010 8815985 M;5<5=B>22B@0=70:F88 12 8820995 M;5<5=B>< 526 8821007 M;5<5=B>B1>@0 133 8821533 M;5<5=B>B1>@0:><?>=>2:840==KE 181 8821666 M;5<5=B?0:5B0>B>1@0605<KE4>:C<5=B>2 43 8821847 M;5<5=B?;020NI89D@59<html 1341 8821890 M;5<5=B?;0=03;>10;L=>3>?>8A:0 86 8823231 M;5<5=B?;0=8@>2I8:0 221 8823317 M;5<5=B?>@O4:0 62 8823538 M;5<5=B?>@O4:0:><?>=>2:840==KE 86 8823600 M;5<5=B?@8:@5?;O5<KE40==KE70?CA:0?@8;>65=8O<>18;L=>3>CAB@>9AB20 47 8823686 M;5<5=B@07<5B:0html 1296 8823733 M;5<5=B@0AH8D@>2:8 6 8825029 M;5<5=B@0AH8D@>2:8:><?>=>2:840==KE3@C??8@>2:0 49 8825035 M;5<5=B@0AH8D@>2:8:><?>=>2:840==KE?>;O 60 8825084 M;5<5=B@57C;LB0B0 24 8825144 M;5<5=B@57C;LB0B03;>10;L=>3>?>8A:0 86 8825168 M;5<5=B@57C;LB0B0:><?>=>2:840==KE 82 8825254 M;5<5=BA2O78 30 8825336 M;5<5=BA2O78?>B8?C 11 8825366 M;5<5=BA2O7Lhtml 1343 8825377 M;5<5=BA:@8?Bhtml 1322 8826720 M;5<5=BA=8<:0 10 8828042 M;5<5=BA>AB020:>?88107K40==KE 76 8828052 M;5<5=BA>AB020>1I53>@5:2878B0 33 8828128 M;5<5=BA>AB020?;0=0>1<5=0 27 8828161 M;5<5=BA>AB020B01;8G=>3>?@>AB@0=AB20 5 8828188 M;5<5=BA>AB020B01;8G=>3>?@>AB@0=AB20107K40==KE 72 8828193 M;5<5=BA>AB020DC=:F8>=0;L=>9>?F88 32 8828265 M;5<5=BA>AB020E@0=8<KE40==KEE@0=8;8I042>8G=KE40==KE 43 8828297 M;5<5=BA>AB>O=8O?@>A<>B@0 10 8828340 M;5<5=BA?8A:0 6 8828350 M;5<5=BA?8A:07=0G5=89 181 8828356 M;5<5=BA?8A:0?>;=>B5:AB>2>3>?>8A:0 33 8828537 M;5<5=BAAK;:0 25 8828570 M;5<5=BAB8;O 296 8828595 M;5<5=BAB@>:0B01;8FKhtml 1453 8828891 M;5<5=BB01;8F0html 1583 8830344 M;5<5=BB5;>html 39 8831927 M;5<5=BC 695 8831966 M;5<5=BC?@02;5=8O 46 8832661 M;5<5=BC?@02;5=8O8=B5@D59A>< 44 8832707 M;5<5=BC?@02;5=8O:>;>=:0<80=0;87040==KE 35 8832751 M;5<5=BC?@02;5=8O=0AB@>9:>9=0AB@>9:8>D>@<;5=8O 53 8832786 M;5<5=BC?@02;5=8O=0AB@>9:>9>1;0AB8>D>@<;5=8O 43 8832839 M;5<5=BC?@02;5=8O=0AB@>9:>9CA;>2=>3>>D>@<;5=8O 48 8832882 M;5<5=BC?@02;5=8O>B1>@>< 148 8832930 M;5<5=BC?@02;5=8O?0@0<5B@0<80=0;87040==KE 39 8833078 M;5<5=BC?@02;5=8O?>@O4:>< 118 8833117 M;5<5=BCA;>2=>3>>D>@<;5=8O 97 8833235 M;5<5=BCA;>2=>3>>D>@<;5=8O:><?>=>2:840==KE 256 8833332 M;5<5=BD09;00@E820 126 8833588 M;5<5=BD0:B8G5A:>3>?5@8>40459AB28O 24 8833714 M;5<5=BD>@<0html 1350 8833738 M;5<5=BD>@<0B8@>20==>3>B5:AB0html 1299 8835088 M;5<5=BD>@<K 69 8836387 M;5<5=BD@59<html 1331 8836456 M;5<5=BH:0;K2@5<5=8 220 8837787 M;5<5=BK 4295 8838007 M;5<5=BKzipD09;0 31 8842302 M;5<5=BK3@0D8G5A:>9AE5<K 36 8842333 M;5<5=BK45=4@>3@0<<K 59 8842369 M;5<5=BK;52>703>;>2:8;52> 9 8842428 M;5<5=BK;52>703>;>2:8?@02> 9 8842437 M;5<5=BK;535=4K35>3@0D8G5A:>9AE5<K 52 8842446 M;5<5=BK<0:5B0>1;0AB8:><?>=>2:840==KE 58 8842498 M;5<5=BK?0:5B0>B>1@0605<KE4>:C<5=B>2 49 8842556 M;5<5=BK?@02>703>;>2:8;52> 9 8842605 M;5<5=BK?@02>703>;>2:8?@02> 9 8842614 M;5<5=BK@0AH8D@>2:8:><?>=>2:840==KE 40 8842623 M;5<5=BKA>AB020B01;8G=KE?@>AB@0=AB2107K40==KE 6 8842663 M;5<5=BKAB8;O 10 8842669 M;5<5=BKD09;00@E820 33 8842679 M;5<5=BKD>@<K 542 8842712 M;5<5=BKF8:;8G5A:8EAAK;>: 5 8843254 M;5<5=BKH:0;K2@5<5=8 64 8843259 M;5<5=BO:>@Lhtml 1358 8843323 M;5<5=BOG59:0B01;8FKhtml 1357 8844681 M;;8?A 40 8846038 M<8@0B 12 8846078 M<8@0BK 12 8846090 M<8B5=B 52 8846102 M<8B5=B0 5 8846154 M<8B5=BB>:5=04>ABC?0 36 8846159 M<?8@8G5A:89 10 8846195 M<?8@8G5A:8< 10 8846205 M<C;8@>20BL 93 8846215 M<C;8@C5B 93 8846308 M=5@3>?>B@51;5=85 10 8846401 M=5@3>?>B@51;5=8O 4 8846411 M=5@3>M:>=><8G=>< 4 8846415 M=5@3>M:>=><8G=K9 4 8846419 M=B@>?88 4 8846423 M=B@>?8O 4 8846427 M@0 4 8846431 M@8B@5O 12 8846435 M@K 4 8846447 MAB>=8O 12 8846451 MAB>=A:89 34 8846463 MAB>=A:>3> 14 8846497 MB0 121 8846511 MB045:040 9 8846632 MB0;>==K9 10 8846641 MB0<0A:0?>4<=>65AB2> 13 8846651 MB0=545;O 9 8846664 MB0? 406 8846673 MB0?5 401 8847079 MB0?>2 5 8847480 MB0D>@<0 11 8847485 MB8 367 8847496 MB8< 225 8847863 MB8<8 10 8848088 MB8E 432 8848098 MB> 2361 8848530 MB>04@5A2@5<5==>3>E@0=8;8I0 11 8850891 MB>0B@81CB?>C<>;G0=8N 27 8850902 MB>3;>10;L=>5>1JO2;5=85 22 8850929 MB>3> 2275 8850951 MB>3@C??0 150 8853226 MB>84 290 8853376 MB>9 622 8853666 MB>:0B0;>3 39 8854288 MB>:0B0;>30A8=E 18 8854327 MB>< 2989 8854345 MB><C 208 8857334 MB>=>2K9 127 8857542 MB>>1JO2;5=8570F8:;5=> 12 8857669 MB>>?@545;5=8570F8:;5=> 48 8857681 MB>?>;C3>485 9 8857729 MB>?>B><>: 22 8857738 MB>?@>15;L=K5A8<2>;K 33 8857760 MB>?@>15;L=K5A8<2>;KM;5<5=B0 414 8857793 MB>A8<2>;L=K540==K5 27 8858207 MB>AAK;:0 44 8858234 MB>B 9064 8858278 MB>B3>4 9 8867342 MB>B5:CI89040?B5@ 9 8867351 MB>B:20@B0; 9 8867360 MB>B<5AOF 9 8867369 MB>B>1J5:B 588 8867378 MB>BC75; 50 8867966 MB>D09; 31 8868016 MB>D09;0A8=E 18 8868047 MBC 91 8868065 MC 28 8868156 MD8>?8O 22 8868184 MDD5:B 43 8868206 MDD5:B0 21 8868249 MDD5:B82=0O 5 8868270 MDD5:B82=55 11 8868275 MDD5:B82=> 93 8868286 MDD5:B82=>5 10 8868379 MDD5:B82=>ABL 6 8868389 MDD5:B82=>ABLN 6 8868395 MDD5:B82=K9 119 8868401 MDD5:BC 5 8868520 N0=L 6 8868525 N3 8 8868531 N30 8 8868539 N32>AB>: 9 8868547 N370?04 9 8868556 N6=0O 20 8868565 N6=>9 9 8868585 N6=K9 29 8868594 O 5 8868623 O28B8AO 559 8868628 O2;NI8EAO 6 8869187 O2;O5BAO 4766 8869193 O2;O5BAO845=B8D8:0B>@>< 26 8873959 O2;O5BAO:0@B>9 9 8873985 O2;O5BAO>H81:>9:0B53>@88 10 8873994 O2;O5BAO?>4<=>65AB2>< 12 8874004 O2;O;0AL 5 8874016 O2;OBLAO 6557 8874021 O2;ONBAO 962 8880578 O2;ONI0OAO 51 8881540 O2;ONI53>AO 119 8881591 O2;ONI59AO 43 8881710 O2;ONI85AO 68 8881753 O2;ONI89AO 878 8881821 O2;ONI8<8AO 4 8882699 O2;ONI8<AO 20 8882703 O2;ONI8EAO 193 8882723 O2;ONICNAO 40 8882916 O2=89 221 8882956 O2=> 407 8883177 O2=>3> 221 8883584 O2=>5 120 8883805 O2=>9 15 8883925 O2=>< 27 8883940 O2=K9 788 8883967 O2=K< 4 8884755 O45@ 5 8884759 O4@> 5 8884764 O7K: 3107 8884769 O7K:0 1839 8887876 O7K:0<8 5 8889715 O7K:0E 32 8889720 O7K:5 916 8889752 O7K:5javascript 4 8890668 O7K:8 11 8890672 O7K:>2 56 8890683 O7K:>20O 4 8890739 O7K:>2>9 18 8890743 O7K:>2CN 3 8890761 O7K:>2K5 4 8890764 O7K:>2K9 18 8890768 O7K:>2K<8 5 8890786 O7K:>2KE 5 8890791 O7K:>< 9 8890796 O7K:C 6 8890805 O:>@59 4 8890811 O:>@L 34 8890815 O:>@N 4 8890849 O:>@O 25 8890853 O:V@ 29 8890878 O<09:0 12 8890907 O=20@L 31 8890919 O=20@O 23 8890950 O=45:A 4 8890973 O?>=8O 12 8890977 O?>=A:89 14 8890989 O@:0O 9 8891003 O@:85 4 8891012 O@:89 37 8891016 O@:8E 4 8891053 O@<0@:0 46 8891057 OG55: 270 8891103 OG59:0 1151 8891373 OG59:0< 14 8892524 OG59:0<0:5B0703>;>2:0:>;;5:F887=0G5=89>1;0AB8:><?>=>2:840==KE 48 8892538 OG59:0<0:5B0:>;;5:F887=0G5=89>1;0AB8:><?>=>2:840==KE 44 8892586 OG59:0<8 4 8892630 OG59:0B01;8FK>1;0AB8:><?>=>2:840==KE 48 8892634 OG59:0E 65 8892682 OG59:0F5;8:>< 6 8892747 OG59:5 160 8892753 OG59:8 592 8892913 OG59:8<0:5B0703>;>2:0:>;;5:F887=0G5=89>1;0AB8:><?>=>2:840==KE 58 8893505 OG59:8<0:5B0:>;;5:F887=0G5=89>1;0AB8:><?>=>2:840==KE 51 8893563 OG59:8B01;8FK>1;0AB8:><?>=>2:840==KE 62 8893614 OG59:>9 70 8893676 OG59:C 58 8893746 OI8: 103 8893804 OI8:0 46 8893907 OI8:5 23 8893953 OI8:>2 17 8893976 OI8:>< 12 8893993 OI8:C 12 8894005 Q<:>ABL 4 8894017 V9 7 8894021 Ô 7 8894028 ×Ô×àØ 7 8894035 ÚÐàØ 7 8894042 ÚØ 7 8894049 ÛÔ 7 8894056 CQ 7 8894063 R 7 8894070 Ò‰ 7 8894077